4OUSA

Crystal structure of zebrafish caprin-2 c1q domain
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
132
structure length
132
Chain Sequence
b'LRVAFSAARTANFAPGTLDQPIAFDLLHTNLGDMFDTGSGRFTCPATGAYVFIFHILKLAISVPLYINLMRNEEVMVSAYANDGAPDHETASNHAVLQLFQGDQVWLRLHRGAIYGSSWKYSTFSGFLLYQD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Caprin-2
publication title Structural insights into the C1q domain of Caprin-2 in canonical Wnt signaling
pubmed doi rcsb
source organism Danio rerio
molecule tags Signaling protein
total genus 29
structure length 132
sequence length 132
ec nomenclature
pdb deposition date 2014-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00386 C1q C1q domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4ousA00
2JG9A 4OULA 4EN0A 1XU2A 1U5YA 2OIIA 2HEWF 4RSUA 4N90A 2WNVA 2R32A 1U5XA 4QQHA 4G3YC 5KC6A 3B94A 1D0GA 2JG8C 4DOUA 4NN0A 5L19A 2TUNA 3AB0A 3MI8A 1O91A 1JTZX 3K48A 3IT8A 2R30A 3WD5A 2Q1MA 4G4FA 1IQAA 3B93A 1U5ZA 4TSVA 2RJLA 4QQPA 4OUSA 3B9IA 2RJKA 4KGQA 4MXVA 1TNRA 4E4SA 1OQDA 2QE3A 4TWTA 4GIQA 4J6GA 1D2QA 4KGGA 2KA3A 4HT1T 4MXWB 1RJ7A 2E7AA 1A8MA 5KWRA 2TNFA 4KG8A 3LKJA 2WNUC 1RJ8A 2JG8B 2QDNA 2JG9C 1PK6C 4MSVA 1KD7A 4F3JA 4QQOA 1C3HA 1DU3D 4MXWA 4D7YA 2WNVC 3FC0A 1WCKA 1DG6A 3V56A 1GR3A 2JG8A 3QD6A 3ALQA 1JH5A 2WNUA 4OUMA 2RE9A 2HEYF 1PK6A 3L9JT 5TSWA 1I9RA 3K51A 1KXGA 2O0OA 1ALYA 1C28A 2X29A 2HEVF 5CIRA 1D4VB 3TYJA 2R6QA 5BNQA 5KC5A 4QPYA 5L36A 2ZPXA 2WNUB 2JG9B 1PK6B 4E4DX 4DB5A 1S55A 1XU1A 1TNFA 3URFA 1OSGA 4QQ2A 2Q8OA 3TWIA 2WNVB 5HBAA 3ME2A 4QQLA 2Z5WA 2AZ5A 1OQEA 2ZJCA 3QBQA
chains in the Genus database with same CATH superfamily
1LHVA 4E9KA 3SHRA 1UKGA 2VOKA 3VD9A 1W8ZA 2XDVA 1RB8G 4Y5TA 3PUAA 3SKVA 2HEWF 4RSUA 3OGVA 5FZMA 4LK6A 3KT7A 1Q8SA 2ZGQA 3LEGA 4QXBA 5LRRA 4LE4A 4MZUA 3ZYHA 5FWEA 3ZYIB 1C8M2 3FJSA 2CWSA 3AMQA 3NMBA 4LA3A 5I8YA 5LY1A 4OMDA 5L7OA 4ZU5A 2O8OA 4XPVA 4NROA 3WDTA 3X29B 5DAQA 4FFIA 4A41A 1W9TA 4X6RB 1DGRA 2R0HA 1H1AA 3J7NA 2XHKA 3BCWA 4MHRA 3HEIA 3TN91 3NNLA 3VHNA 4AVSA 4FOQA 3WG1A 1WLCA 1W0NA 3PVBB 2C0ZA 3W9AA 5CEHA 1AXYA 4AI3A 1NT0A 4NO4A 5IVVA 2VW1A 1QOTA 3JBG2 1NX9A 4UWDA 2W91A 2AREA 3VUOA 1RMU2 2RJLA 5FJKA 3WF2A 2E6VA 3PU8A 4OUSA 5CKQA 2Q0AA 2RJKA 4KGQA 3ZFFA 1QJU3 3TEWA 2QQKA 2XKPA 3N9OA 1IKPA 1JHNA 1VBB3 1CJDA 2DYCA 1RINA 2G9FA 1W3VA 2LM3A 1TMF1 1D0HA 1UOFA 1UU5A 1CPNA 1QU0A 1SCSA 2WS91 2VAUA 3NWKA 4LKDA 1RUD2 3VBUA 1W03A 2DCKA 2ZGKA 1H8TC 3LA2A 3PMEA 5KWRA 1PM4A 1T6GC 1L7LA 4Q5OA 2QVSB 4YRDA 3WG4A 3HNMA 3S7EA 2GDFA 1H30A 2QDRA 5FZBA 4CCOA 1RUC2 3IPVB 4CDUB 5FY9A 1OA3A 1RHI1 1IGOA 1ASJ1 1FOD3 1WD3A 3EB7A 5IVYA 4CP9A 5M0TA 2DU0A 2XONA 2YB7A 3J26N 3KV5A 3QCWA 2UU8A 3ES4A 2ZABA 1S1AA 3ZPOA 3B7MA 4D7TA 5IFPA 1G9DA 3CJXA 1IG3A 4Q4X3 1J3QA 2GC1A 5JSRA 3OB8A 3THTA 3HWJA 1DZQA 3IDBB 1YIPA 4D69A 4LBMA 5EXOA 4PBOA 2WDBA 1GLHA 3LD8A 4XQWA 5FYYA 4AWDA 1PMIA 2DVGA 3WP4A 4A4AA 3L9JT 1GWMA 1I9RA 2WO3A 1UD1A 4IEYA 4A7KA 1UXZA 2VXJA 4QWNA 2UWAA 3BTXA 3D6EA 2RV9A 2ZGOA 5GLVA 1OD3A 1LOEA 1R1A1 5JR2A 2GNDA 4QPYA 2JDHA 5FYCA 3ECQA 2OKXA 5KHIA 3I3DA 2QUOA 4W6YA 1OA2A 1Y9GA 4P9GA 4NRPA 2C5DA 2YFUA 5C5TA 4Q4W3 2ATFA 1ZBA2 2RS53 4XBLA 4BHPA 3H3UA 1DP0A 3WLUA 3CLPA 1YQ8A 1PO21 3MIFA 3NJVA 2ZX2A 4O9EA 5ABJC 3MLKA 1BBT1 1RUF3 1TQ5A 4YNIA 5CISA 1O3QA 5L7OB 4MO3M 4L2NA 4EN0A 3ST7A 3PL0A 1AR91 1EPWA 2XBO1 1QOSA 3GALA 5KHKA 2WA3A 4DIQA 1BEV3 2GAUA 3AK0A 3ZYRA 4KWKA 4WVMA 3VKMA 1LOFC 4AFMA 1NYWA 2XJTA 4Y5SA 3Q8AA 4LULA 4MV2A 4BM8A 4I0BA 3ZSKA 5C33A 1A6CA 1YYNA 5I0RA 4OCTA 1W90A 4D3WA 1SPPA 3WT3A 5JXGA 2FDKA 4CA9A 1AJKA 4NN0A 1R083 4CXYA 4PF1A 3MI8A 3ZFFB 1CN1A 4YGCA 1HX6A 1MS8A 2BDRA 2QQIA 1SLBA 3FE5A 4RR3A 1PO13 3WD5A 1MEC1 4G4FA 1G6NA 1LGNA 3KT4A 4AGRA 2OT7A 5LBBA 4CU6A 3IMMA 2VE1A 4M3CE 1FT9A 2R071 4QPIC 3OF1A 2CTVA 1QJX3 1EV13 3E97A 4GKXA 2HKXA 1IPSA 1C4RA 3SEPA 1OQDA 3NV4A 4TWTA 3SNMA 5K0UC 3MUY1 4FT8A 5LATA 1O4ZA 3NJXA 1JYXA 1X50A 4P14A 2D5FA 1P8JA 3H1YA 4PDWC 5HV0A 1MQTC 3HJRA 3THCA 4CP9B 2SBAA 2VZ1A 2D93A 4IEUA 4QB1A 4NIDA 1I3HA 4KG8A 2PHDA 1GOGA 4AAPA 1O5LA 2DVFA 3CZJA 5CU1A 4JAAA 1LEDA 2RM21 4LBLA 1PVC1 4K40A 1COV3 4IEOA 4IGOA 4PLMA 4ASLA 2LS6A 4C1WA 1YNAA 4Y24A 4Q27A 2P34A 4O9GA 1CQ9A 1X8MA 4LLFA 4XILA 3VKLA 4ATFA 5JAXA 3ATGA 5FREA 2RVAA 1Y9MA 1QXPA 4DNYA 5FZEA 1YIFA 1ND2A 3GZUC 3NVCA 5DDJ3 5JOYA 3IIAA 4QU1A 4PT6A 4X8PA 4DMIA 1NKGA 4YGDA 2DFBA 1T2XA 1QJFA 3VBOC 1DGWX 1WKYA 2YC2A 5FBJA 5LY2A 1C8M1 4GMP3 5BNOB 1BCXA 1QHDA 2VH9A 3KHCA 2X5IC 1PNGA 4R9DA 4AFBA 4YG3A 3FMGA 2A6WA 1RUOA 3VGIA 3H8RA 2GNMA 3TEXA 1TE1B 4XVHA 4COZA 3RZKA 4IEVA 2VNRA 2WLQA 3VBHC 1Q8VA 4B7EA 1IZ3A 4QX3A 2A71A 1REEA 5CG9A 2R6QA 1RVF3 2C6SA 2GN7A 5FKCA 3CDZB 2AACA 1QY4A 2R49A 3JBG1 4FO9A 1GZ9A 1OOPA 2WNUB 1S0DA 1RMU1 2WRAA 2Y0IA 3CKHA 2W1SA 3PUHA 5FPAA 3WP3A 4DXRA 5KBFA 2WFPA 4Y26A 3T08A 2GC3A 2Q1ZB 4EE2A 4QU2A 1RUD3 1WA4A 5FUNA 5FZ1A 2V4VA 4Q4V3 4C0BA 3R4SA 4MHUA 1W2AX 1JYCA 1HJFA 1W8UA 4JKLA 4QQLA 1O5UA 3T30A 4ZS3A 4QXKA 4Q8KA 2ETEA 1QKQA 2JIJA 3KQRA 4H3WA 4CEWC 2W2IA 2YYOA 5BYNA 1J59A 2GALA 2ZGPA 3EBRA 1JU4A 2D43A 2VM9A 3H7YA 1ZBE2 4NPLA 5H9PA 5A7QA 2ENRA 2WABA 3CJIB 5E16A 5J96B 4XFAA 1SPPB 2ZX3A 3E6DA 4GH4A 5C3OA 1GYKA 5JZGB 5DAWA 2R1BA 4GALA 3MF9A 4D7SA 1J1LA 1REFA 1VBA1 4ES8A 1LHUA 2QQJA 4RR3B 1R1ZA 1PIV2 1NQJA 4E27A 4FOVA 4JHTA 5CFDC 2YPDA 2CGPA 2ZS6B 3KF5A 3UK9A 3O1UA 3RZLA 1WWYA 5DZGA 1IS6A 1VJ2A 3CQOA 4QX7A 2ES3A 1OF4A 1OMIA 2XOMA 5FY0A 1W8HA 2BGPA 5A33B 1U5ZA 3ROUA 4N53C 4XXPA 5FZIA 2D6MA 2FMYA 3I2DA 1TME2 1GZTA 5EYYA 4E4HA 2D3SA 1Z7S3 2IWGB 1UZVA 2ADDA 4NJ4A 3DN7A 5CFCC 4WV8A 3GZEA 2DVDA 3T3YA 2P3IA 1QQP3 3QH7A 5HXVA 2HWB2 4AOCA 1VRH1 3F95A 3RMYA 2BW8A 3HR9A 4AVVA 5GLZA 4K3UA 4ZS2A 4CDWA 3AP9A 5FFOC 4Y33A 1CD3G 5A7PA 3UJOA 1A8MA 3GYDA 1U0AA 1N3QA 5EJ1B 1ND2B 1ZBA1 2TNFA 2VCCA 5EWSA 1I6XA 1HXS2 3OD4A 5AVPA 2RDRA 4BPZA 1DQ5A 1FPN1 2XXZA 3C7GA 5A7OA 2Z79A 5CKNA 2P3JA 2DF7A 4NVPA 2OPKA 5JR7B 4YZ3A 4CCKA 4S2HA 2Q5TA 3VZLA 4C90A 3V0AB 1S4CA 2EXIA 3PUQA 1GNZA 3SH4A 1Y7BA 5A6QA 3KSCA 4ZKTB 1DU3D 1EAH2 1UYYA 3VDAA 4LKSA 1YXWA 1JZ6A 4A6SA 1JYNA 1Y3TA 2E7TA 1GNHA 1AF9A 4IW3A 1O59A 2YXSA 3USUA 3OBTA 3I3BA 5IJRA 3BOWA 2J42A 4DXZA 4CU8A 1H8TA 4HONA 3IN9A 2HWC1 3AFGA 2BNMA 1OOPB 4OUMA 2VNGA 5F2SA 4XFBA 2HEYF 2BV4A 5LK5A 2JD9A 1ACCA 2RS13 2AUYA 1XNCA 2DUOA 3U07A 2RMU2 3OSDA 3WCSA 1MS0A 5D8AC 5FYZA 1OUXA 3BU0A 4Y1VA 2W1UA 3BN6A 4Y1XA 3WXPA 4CEYC 1RIRA 3RDIA 5FZLA 3HT1A 3P3NA 3RS6A 5FYSA 2FCTA 2XWJB 3E5QA 4W65A 3M4FA 5HI0A 1ZZ6A 4GH4B 2CU5A 3K4AA 4GAZA 4XBQA 2Q8OA 3TNQA 4MGKE 3VKOA 1CX4A 3WNNA 4I02A 4JQTA 3WHTA 1CPMA 4FVVA 1RUNA 4JX0A 1CONA 1GZWA 2PHTA 1F15A 2NMOA 1IS4A 3HAGA 5E1RA 1RUG3 4E2SA 4AHZA 1QNWA 1W2NA 2YY1A 2W0XA 2Z2SB 4B8EA 2R062 3AX4A 4G3YC 2ILMA 1RUJ2 4NUBA 1NY72 1JZ3A 3N36A 3RQ0A 3HN1A 1FAYA 2AR6A 2X53S 2JKBA 4LNVA 4BMEA 5ABJA 5C8CC 1FXZA 2Y6KA 4B7KA 2JE8A 1XNAA 3VDDA 2NPIA 3IT8A 2XKOA 3BIEA 5K4LA 2LW8A 3B00A 2V5YA 3OBAA 2XVGA 2Q1MA 3NV1A 3PUSA 1RUE1 4V2VA 2WQ4A 4X6QB 1H2MA 4GXLA 1SDDB 2LALA 1US2A 1H6XA 1QEXA 3O7OA 4FBFA 1QWRA 4CDWB 1S2EA 2YHJA 4E2GA 4EWEA 3FLPA 2XVKA 4E8DA 4QPWA 4HOOA 1AYN2 1IOAA 2YV8A 3ZFEA 4AEDB 4D6RA 1V6KA 4XF4A 4GIQA 4E4ZA 3VBRC 4AAXA 2BPA2 1ZYBA 2CNAA 2VVDA 2HYKA 5FZ3A 3J7MA 3KM5A 3RZHA 4ASKA 2E7AA 4XFCA 4E8CA 3WDXA 1DGLA 4KG0A 1AYM1 3H3LA 1ZREA 1UL9A 5CZKA 3O1MA 4XMAA 5L73A 4H7LA 1KS5A 1LHOA 1CIYA 2MEV3 2N7GA 2UYAA 4Z07A 3WSOA 2P6CA 2OZ6A 4QGLA 3WW4A 1PGL2 1H2LA 2QKDA 3THPA 3W58A 2GH2A 1QDOA 3ZXEA 2JKXA 1HB3A 3N35A 1ZBE1 5FXXA 1G9CA 4ASMB 5JSOA 4A2UA 5A1LA 3UGFA 1NCRC 1O4TA 3IMNA 1NA1B 2C9AA 2CSGA 4P00B 4PDWA 1W8NA 2Z42A 5EP9A 4PF5A 1K5JA 2YBPA 2IXHA 2XJUA 4YW2A 5T5LA 2LUWA 1NE4A 3RPQA 2A3YA 4JGZC 3FN9A 3GDBA 4JRAA 3WNKA 1N3OA 1PIV1 3ALQA 2JDMA 2ZEWA 2PHFA 3AZYA 3AXEA 3IAPA 3ORJA 4KWLA 4RHV3 4D0QA 5FQ0A 3RI8A 3IWZA 4JDNA 1TME3 2HWD3 3N9LA 2O0OA 1HV1A 2Z69A 4XJUA 4AW7A 5FRAA 2WR9A 3AZXA 2XUMA 4YZ2A 1JZ8A 2VMHA 5J1XA 2X8KA 4LBQA 1GZWB 2HWB3 1DHKB 4M0NA 4Y20A 4OQ9A 3VBOA 5AC92 3LIHA 3SQOA 2HBUA 3I2IA 5IAVA 3D0SA 3N9MA 2RJ2A 3TN92 5H9RA 1O3RA 3Q8CA 2VO5A 1AX2A 2PLV1 2DVAA 5A7SA 4B3NA 4LEJA 3ZMOA 3ZSMA 4CCEA 4LO8A 3VBFC 1A3KA 3E1F1 4AG4A 4XUNA 1AXZA 3VB9A 2ZGLA 5J37A 2TBVA 1N3PA 2LRPA 4DY3A 1WBFA 2YU1A 1FMD3 3QLQA 4Y1YA 2OZJA 2VZQA 3LEIA 3N9NA 1PZ7A 2JDAA 3VZNA 3ZO0B 1QJY3 4M00A 5FP4A 5FMDA 1HN0A 3MIDA 5ABJB 1HXS1 2CAUA 2YUEA 4MGQA 2IZWA 1VB4A 3WQ1A 3WDYA 2CDPA 4K1ZA 3VDDB 3HNBM 4FI9A 3UNPA 3V0BA 1TMF2 1D7PM 3I2KA 1US3A 3JQWA 5EJZB 3AKRA 1UMHA 3RYKA 3D0JA 1EAH1 1YWKA 4IV1C 4NIAA 4CUAA 5ANNA 2D6PA 2W46A 4GB33 5C9AC 1CJPA 5K9YA 1L3JA 1O91A 2EVXA 2VCAA 2RMU3 3ZFEB 3MZHA 2QQNA 4EN6B 1RHI2 1EUTA 3NNGA 4P08A 4P02B 1ASJ2 4JKMA 1HW5A 4DY5A 3RFRA 1SACA 5JXJA 4FFGA 2JDKA 3AXDA 3KCYA 3RYPA 5CFDA 4TN7A 4YVSC 5T50A 2D44A 1B09A 1BVVA 2H0BA 1LGBA 2Q8CA 2XPJA 4RS5C 1H1IA 2XHNA 2OYZA 1MACA 2A6XA 3WNOA 3K4ZA 4KGGA 2IUWA 3Q9OA 5FY4A 3MEPA 1NCQA 1UOGA 1VBE3 2A5ZA 3HQXA 3KQ4B 3AZZA 5ERLA 3LFMA 2WL1A 2BVVA 5FZHA 1CESA 2PHLA 4N7IA 4MGSA 1MR5A 5FOJB 5D21A 4N53A 1R1A2 4M3CB 4PDWB 5FP7A 5FZKA 2BP6A 5IFTA 2W94A 2ZGUA 4XMIA 3NV3A 3VBSC 5CFCA 3LEMA 5F6KA 2JE9A 5GLWA 5FQ0B 1H4HA 3TOJA 3USSA 3BU7A 3NRUA 4GKYA 5T5OA 2JDNA 2EAKA 3OGJA 2VGDA 3GBWA 3ZXAC 2JG8A 1YCIA 2R061 4XUTA 2VOWA 1PO22 3IIIA 5C5UA 1RUJ1 4GWJA 1D4M1 1YQCA 3LDRA 5SV8A 4LBQB 4QB2A 1ZZCA 1IS5A 4GMP0 2W5FA 3CZUA 3VBOB 4QX1A 3OGRA 3DF0A 1SMVA 3L2YA 1MS4A 2ZA9A 1LTEA 2X29A 5FYUA 1JODA 3TYJA 4MGIE 3QOPA 4DXTA 3BI3A 2VBDA 3ILNA 4DUWA 5DABA 3W5NA 4DFSA 1IG0A 1KFXL 4COVA 1LB2A 4LMFA 1HRI3 2GU9A 2Q8DA 1B35C 2EALA 3MLJA 3SISA 4AI9A 4FPJA 2WSUA 3KGLA 4L92A 1AYN1 1GANA 2QQLA 3C7HA 1AR61 3T4HB 3K75B 4YG6A 1MEC2 2DDUA 1WLTA 2EIBA 1RUI2 4HG6B 5T52A 2V09A 5IVJA 5JPNB 3WNLA 5FPXA 5FKBA 3V0BB 4I0AA 4N7UA 4Q4Y2 5EJ3A 1SBDA 3B3QE 4KNCA 4BQ5A 2ZHMA 2WIIB 4CP0A 5FCCA 2R072 3B69A 2FHRA 3AC0A 4YVWB 5F5QA 4CEYA 5FYIA 2B46X 4UFHA 2CHHA 2PQSA 3ZSJA 5BV6A 5A3LA 3JCIA 1WMFA 2EICA 1XNDA 5F3CA 3CHXA 2ZACA 3MLLA 4FP3A 1PGL1 3CMGA 5EQUA 1BMV2 5ANQA 2ZEZA 4WM8C 3T0DA 4AEKA 1PVXA 1URXA 3RZZA 5C4WC 4OI0A 4DOUA 5BNPC 3OPZA 3FHIB 3U11A 2TUNA 3AB0A 4D94A 3I7DA 1JTZX 3N7MA 3K48A 4PI0A 2KXLA 4LBQD 3U0ZA 3MIGA 3H3ZA 1H4GA 2VMEA 1MZEA 4OI2A 1JYVA 1VR3A 2IVIB 3OPTA 4JTOA 2YBSA 3QH6A 1NCQB 4PJYA 4P9IA 2FCVA 3RSJA 5IUQA 3TN93 1T6BX 3EO6A 3WCRA 5JMCA 1K5MC 1S0EA 4LOSA 5F3GA 2CWMA 2DUPA 1WW6A 4AE2A 1JOPA 4LHSA 3CL1A 4IV3B 5C8CA 3T09A 5LZ6A 1DGWA 3AP4A 2ZX1A 5AC91 5CFCB 2XJSA 1GZCA 4Z8BA 2VBBA 5A3TA 5L9VA 1V6IA 4GJZA 3ZIWA 3MV01 1SZBA 5ISLA 4RFT0 4N9IA 1SFNA 1AR82 2WO7A 3LKJA 4AQSA 3GBFA 2JG8B 3HN3A 1MVQA 4SBVA 3ZXDA 3DEMA 1PK6C 1UYPA 2IXIA 3A23A 4RD7A 5I93A 5FMOS 1F4HA 1HJGA 1TMF3 4XF9A 1JN2P 3AL5A 3HQUA 2V73A 1Y4WA 4AHWA 3D3AA 1X8EA 3LE0A 1VBC2 2WS93 2B8MA 1AX0A 5IW0A 3VBRA 2PHRA 2WKKA 1RGSA 2D6KA 2B9VA 4UBGA 4CYDA 3FFZA 4IERA 1OLQA 3OG2A 4BK5A 1R091 3S5AA 2FDJA 2P1BA 1S0GA 3M3EA 4FFHA 4WM7A 4XACA 2V4AA 4KL1A 3J7HA 1PM7A 2JENA 5FWJA 1RHI3 4ISQA 4Y5Z0 2EXHA 1ASJ3 4CDXA 3LIGA 3NKGA 3AL6A 4XE9A 2HH9A 5FLIA 3VD7A 1V0AA 5I0TA 2EIGA 2Y6FA 4FPEA 4QKNA 5JIUA 1H9PA 1VBA2 3KV4A 1CAUA 1HLCA 4YW7A 3ZFGC 4XF3A 3WY6A 1G8WA 2UWCA 4LKFA 5BY5A 1NZIA 1X9TA 2ZMLA 5FZ4A 5LK7B 3KVAA 2HWE2 1VP6A 1BKZA 3POEA 2YZ4A 2P2KA 4AFCA 3DECA 4LPLA 3N7JA 5LRSA 1OSGA 1SFPA 1UQXA 1NLSA 3UT0A 1WZXA 2JB8A 3S30A 1R1A3 1XYOA 5HCAA 3WUDA 4DINB 4FAGA 1HKDA 2Y6HA 4Y4YA 4A6OA 4IEPA 1E5IA 2Y6LA 3KZ4C 1UPSA 4AR2A 4RGKA 1XU2A 4L11A 5FPUA 3WX5A 1RYYA 1ZZ8A 4EV0A 1HB2A 4M4RA 5BPXA 4YM3A 3T2PA 3BTAA 4HK8A 1JHJA 4GWIA 4MVTA 3ZVXA 4LBOA 4ZPIA 4GULA 2ZEYA 2P17A 1PO23 1VRH2 3D5OA 4HXCA 1GP6A 3DUIA 5FBZA 5KC6A 1BBT3 3AKQA 3S57A 1AR93 2XBO3 3M70A 2GN3A 2XR4A 3WW3A 2G9ZA 1KS4A 3VBFA 4XETA 4CP2A 2W1WA 2B9UA 1M4WA 3TAYA 1WGPA 1FPN2 3JD72 4S2FA 2VUCA 1EPZA 2A6ZA 2YC0A 3GBGA 4QXCA 1CX1A 4WZFA 4AI1A 2AEZA 4UF0A 4BIFA 2B4KA 4QGMA 1UAIA 5A7WA 2XL7A 3RZJA 2P4EA 3DKQA 1FNZA 5FMOL 1ZRDA 3U75A 4K21A 4OHXA 4QDQA 1W9FA 4BQWA 4XYXA 5C9AA 4IEWA 3RG0A 4R9BA 1MEC3 2HWC2 5A6YA 3SLIA 1W0PA 5CBLA 4XDPA 1GV9A 1QOOA 4TLFA 1KJLA 4MGZE 3BYWA 2A6YA 3PTRB 2R073 3C7OA 4IE5A 5A3PA 2DUQA 3VL8A 4ZU4A 5KXDA 1PX3A 1ZM1A 2ZHKA 3DYPA 2WYFA 3ZXGA 1RUI1 1Q8PA 3MIHA 3ZX7A 4WM7B 1XYNA 4YVSA 3H1WA 2QQUA 3DPRC 4MSVA 2CDOA 4Q4Y1 1TZOA 2ID4A 1ULEA 3B01A 4D6QA 4QQOA 5C70A 4CDXB 3VBUB 2R16A 4RS5A 1OKQA 3UV9A 5KHJA 1MZ5A 3UKTA 4GJYA 2ZBJA 1YFXA 3I54A 4FPLA 4XJWA 2RM23 4FXKB 1PVC3 1CAWA 2IFRA 1CAUB 1QF3A 3FLTA 4XTPA 1QNYA 4OQ8A 4IEQA 4NAMA 4HBNA 1BMV1 2E33A 3R4DB 3OD0A 4UI9L 2C4XA 5HCBA 1OT5A 1ULOA 2HWF1 1HQWA 2ARAA 2ZGTA 4ONUA 5BUVA 5TSWA 4GQ7A 1HQLA 3VBSA 5HCFA 4AHXA 1XB9A 4KBBA 3ETPA 4DPNA 1QMJA 3WP5A 3ZSEA 1J3PA 1WBLA 3SKJE 2WWJA 2XLGA 2OUJA 1C8M3 4OVEA 2AEYA 2VUJA 4R4XA 3FLRA 1LGCA 4RL7A 4NIHA 2VNVA 4LXLA 4Y1ZA 3K4DA 3NQHA 3R4UA 5ACA1 1G9AA 5DUXA 4FPKA 2D40A 3AKPA 4BISA 1YI9A 2RS32 4AQTA 3TWIA 3ME2A 3NJYA 5I0SA 4AEMA 3UGGA 3ITQA 3N9QA 1RUE2 3JBG3 1X36A 3L2HA 1YJLA 1RMU3 2VTFA 4DUXA 4IE7A 3I4IA 1OBNA 1JOJA 5CVRA 3GF6A 2QQVA 3GHMA 1OUSA 1OPOA 3HVDA 1OURA 4N43C 4YYOA 3SCGA 1LODA 5I0DA 1AR81 2D7FA 4K20A 1ULDA 1B35A 4Q2FA 1O4YA 4QQHA 4XUQA 2P3KA 5J36A 3WF0A 3ZLIA 4JCKA 4CXWA 1COV1 2NYYA 1HDKA 5CB7A 3IZOA 5CYYA 1V6LA 1WW4A 2MNGA 4HKLA 1VBC1 4MYEA 3DCQA 1S0CA 1AYM2 1ZVFA 3BOPA 4IEXA 2WZR1 4WVMB 5FPVA 4IEZA 5JVVA 4HVQA 2X09A 5DQ0A 1ZX5A 1BXHA 2DTWA 2V72A 1VBA3 1RUC3 2EF6A 4KU8A 2W92A 2P3YA 5FZ9A 1LECA 5FYHA 4BLJA 1OA4A 3T2OA 2DBNA 2H6CA 4LORA 1ST8A 3BODA 3TRSB 4AK3A 2WT1A 4OHYA 2BOJA 3VZMA 3ZYBA 4CDQA 5IWFA 4WM8A 4LA2A 1Y9QA 1CAXA 2VCBA 2OA2A 3WF4A 2VZVA 4PHZA 4Q0PA 5C4WA 3W20A 1NG0A 2XJQA 5BNPA 1H0BA 2EA7A 1LJ7A 5FZ8A 2K2SA 2HWE1 1ULGA 2Y0OA 1E5RA 2K0GA 4YARA 4RS5B 3Q8BA 1QJZA 4QPGC 3TB0A 2YPJA 1UMIA 2VZ3A 1VAKA 1VBD1 5L9RA 1TG7A 2JB4A 1DYPA 3AZWA 1CGPA 1CAWB 2JG9C 1W9YA 4KH9A 4KI5M 2ZAAA 4Q0QA 4RGAA 1VRH3 3TEZA 3ZPYA 5GZEA 1K5MA 3AP6A 3RJRA 4BE3A 4MXWA 1KRIA 1OFSA 2WNVC 3GZTB 3VBSB 5JUVA 3UETA 2NLRA 4XBNA 3V56A 1DQ1A 1ZBA3 2D97A 2PLV2 4XDOA 3NJZA 4DZGA 5JDBA 4MX3A 5JI9A 1FPN3 2ZZQA 4LLOA 1POV1 3QD6A 5KXEA 3VHPA 1RUH2 1JH5A 4UW3A 1WLWA 2VY0A 3POSA 1G9FA 2WAOA 2YGLA 1OPMA 1ENQA 3GCWA 3ACFA 1PK6A 4FP2A 3SITA 3FX3A 3NL1A 3ZXKA 2DBIA 3JXSA 1CR7A 1UZ0A 3DL3A 1W6NA 3MIEA 4CCLA 1SQ4A 2J22A 3JD71 4PCRA 2HBTA 4AFDA 2WZEA 3IAQA 3NV2A 4HSJA 5FZGA 1UPIA 2OUHA 1QDCA 3GGLA 1KITA 1V9U1 3MHZA 4AQ6A 4AVBA 3FHAA 1ZRRA 4BJ0A 4WBBA 4LOTA 3D8CA 4LK7A 5FAXA 5L36A 1ZZ9A 2HWC3 5GLUA 1C5IA 2WFF2 5B2GB 3O1VA 4FCAA 5JWPA 1XE8A 1AR72 4NOTA 5DAXA 1S55A 3MW4A 2VMIA 3M7AA 2BJSA 2QQOA 3EMRA 4HPKA 1JYWA 2ZGNA 4DEVA 4PBPA 2RR12 1RXGA 4RN5A 1GP5A 1NZCA 2WJSA 1OKOA 3POGA 3VN4A 1H6YA 4MADA 3DGTA 3FBYA 2ZEXA 4ORFA 1UF2C 3HNYM 4QKDA 3EXUA 4J1XA 1DGRN 2WUHA 4ISRA 2UY8A 1PZ8A 2ZKLA 4YWAA 4TLGA 5FDBA 2I2SA 5CKMA 2W08A 4B1MA 4LITA 5LW9A 3GM8A 3ZXFA 2ZMNA 1IS3A 2O14A 3IDEA 4YFWA 4GA9A 3GXUA 1SDWA 1DQ4A 5FZOA 4PI2A 4AI0A 5JLVA 3WV6A 3EQEA 2W68A 4CDQB 4WM8B 4CDUC 5E8AA 3MW3A 1CAXB 2ZHLA 4XF0A 3HIFA 1CZVA 3THDA 2IVJA 2B45X 3H7JA 1JUIA 5DAPA 2BNOA 2BBVA 5I8SA 4XIOA 4ARYA 1EUUA 4CUCA 1XNBA 5JXHA 4TSVA 3LA7A 3LF7A 1JZ4A 2GZWA 1S0JA 1X7NA 2V5DA 3UYJA 1Q43A 1EY2A 3IM0A 2D3PA 2JJ6A 4MXVA 3N4MA 3NO8A 2DCZA 2DCTA 1MS1A 2E31A 3ON7A 3VKNA 4M01A 2XWBB 3R6SA 1D4M2 5H9QA 1LEMA 1PGW1 2PMWB 3AFKA 2VMDA 1RUE3 2VCMA 1W05A 3AZVA 1K5MB 5I91A 2GMMA 3SEEA 1UKRA 4FTBA 4MXWB 1JZ2A 3VDCA 2QQMA 1Q56A 1AZDA 2IXJA 5EHDA 2VZSA 2RS31 4TTGA 2VQUA 5DG1A 1WCUA 1JMUB 5LA0A 4BLIA 1W2OA 2ZGSA 3KT1A 4L8QA 1LOFA 4LKEA 4DS0A 1K12A 3VD5A 2XJRA 3H1MA 5IT6A 4D7YA 2OQ7A 3A0NA 5AFEA 4RA0A 1AYM3 4M0HA 5FP9A 1AR62 5FZFA 3I97A 2QZ2A 1JW6A 1LU2A 2BGOA 4CCNA 5A70A 5L7OC 3PJYA 1UOBA 3W21A 4MG2A 4EWAA 4JVAA 3OBZA 2PXJA 2ZKNA 3VL9A 4DEQA 3LDBA 1ZBE3 3EYPA 1HRV2 2ZCWA 1H9WA 3DPRA 5LASA 1JZ7A 2WAAA 1KXGA 4QPIA 1ALYA 3USUB 5A80A 3KLSA 4A42A 1MPXA 4HPKB 2K46A 1H8TB 4BQYA 5F6LB 2BGCA 2PAKA 3F2ZA 1PIV3 1ZNPA 2XGXA 1X82A 4GZ9A 1QH6A 5K0UA 4BDVB 1Q5OA 2ORZA 2B42B 3RGBA 5C7GA 5F37A 5C3RA 1H2KA 4N8MA 2JDYA 1MQTA 2XH6A 1BLZA 4HLTA 4YG0A 1I1EA 2YMZA 1DQ6A 4R9AA 4XIKA 1N1YA 1JI6A 2FCUA 4DRVA 1PGSA 3H8UA 3QBQA 1F9KA 1PNFA 4BQ2A 4D8MA 5F9TA 3AM2A 4AVAA 2JXAA 3G6JB 2QNKA 5A3WA 2OIIA 5FZOB 2O1QA 5A1AA 4LUKA 4N90A 1CAVA 3MPBA 4EZHA 4J25A 2PLV3 3PVEA 4ZONA 3T2TA 2O8QA 4QD2A 1JS9A 4A7ZA 2FMDA 5F3EA 1W8OA 3BPZA 1YUDA 4HN0A 4OHWA 5FO7B 2WQZC 4YW6A 3GZAA 1FNYA 3PDQA 1J58A 1K3IA 4E2QA 2X5IA 4YM1A 1J3RA 1D0GA 3DKWA 1W6PA 1AL22 1HXS3 2W95A 4XEZA 4CP1A 1CIWA 2KM2A 4O7XA 3VBHA 1GUIA 2IC1A 1DZTA 1KEXA 3MBWA 3ZXLA 5F1RA 1RUH1 1UNBA 1BK1A 1GP4A 3OY8A 1C1LA 2J1RA 4W4ZA 5C8WA 1HV0A 4QKFA 1YJKA 1UZZA 5FZDA 5FUPA 1EAH3 3P1IA 2P6HA 3SMHA 5DUUA 4HK9A 3ZN6A 5F32A 3VKFC 5BNOC 3AP7A 1R092 3ZDSA 5JOWA 3BUCA 3B02A 2FDGA 4A3ZA 1SHWB 1HQNA 1REDA 4A44A 3J7LA 3HPNA 2G9GA 4I3GA 1ONAA 4AGVA 1ENSA 2UWBA 2WFF1 3DXUA 4JRLA 3WNMA 5J09A 5J48A 5KR7A 2XLAA 1AR71 2WA4A 4HT1T 4R9CA 4CEWA 1GQHA 2E26A 2WNEA 3MO4A 4NHKA 2JD4A 1XRUA 4V1PA 3I3MA 5IAXA 5IVCA 2WNUC 1OH4A 4YW1A 4B29A 5CAZA 5LCWL 2RR11 3JZVA 4IXLA 1YRZA 2ZX4A 3K3OA 3C8XA 1DQ0A 3JU9A 4I0WB 3VLBB 2GSYA 3PUIA 1OH3A 3FC0A 4YZ4A 1ZZ7A 1XSQA 3DPRB 4CXXA 4PIYA 1QJU2 2R041 1AJOA 4QPIB 3JQXA 3JUUA 3T0BA 3VD3A 4JHZA 4QPGA 4ZZ8A 3CJIC 4PIXA 2FDFA 4Z92B 5B4NA 5K0UB 3E6CC 5JZGC 2Y6GA 5A1FA 1MS3A 3POFA 3RYRA 2XJPA 3AMNA 1J1TA 2UURA 2XL9A 4JQRA 1MQTB 4I09A 4RR3C 3OPWA 4NIIA 5JOXA 2JECA 4UFIA 3VZJA 4BMBA 3H8XA 2R063 5BNQA 2VQAA 5FZAA 1Q8QA 4F8AA 2VOXA 5KC5A 2I74A 1RUJ3 1TEIA 5FY7A 1D4M3 4LHLA 2VZUA 2J1VA 2EXJA 1UIKA 4FPGA 4IQPA 1W9WA 5JSPA 5IK5A 3IDCB 4BQ1A 1ULCA 4EYUA 1F35A 1S0IA 4UW4A 3I2HA 1XE7A 2OX0A 2HJIA 3VZKA 4Q4X2 2H6BA 2JDPA 1V6JA 3POYA 4JKKA 4LO5B 4R8HA 4QX0A 4HMZA 4YM2A 4XJ8A 4IDZA 3IB3A 1RL3A 1Z78A 2R0FA 4Y20B 2WN3A 5T3NA 5APAA 4OULA 4UYBA 1GNYA 3KS7A 1OQ1A 1U5YA 4Z82A 5DG2A 1VALA 2D3RA 2X5IB 3AJZA 3UKNA 5FP8A 4Q0VA 3UESA 2VNOA 1GWLA 2QZ3A 4KU7A 1AYN3 5GALA 1YQ6A 2VW2A 1AR63 3C7EA 1STMA 2E32A 3OUJA 4NRQA 4OYUA 4RGGA 5FYMA 3VBHB 1ZA7A 1WW7A 3TEYA 1NLRA 3OY8B 4H55A 1E5SA 4NHXA 5A6ZA 1ND2C 2OVUA 4W8JA 3NAPC 4AZZA 1WCSA 2WC2A 4K1YA 1V70A 3LOIA 3ZN6B 4W6WA 1ULPA 1GSLA 3AP5A 2RS52 3ETQA 1QH7A 4NMIA 2EAAA 2YDEA 4U36A 5A3NA 4UFKA 1UU6A 4FXGB 4UAPA 3VDBA 3LA3A 5C71A 5D8AA 2C9KA 3ZYGA 1MS9A 5IVBA 1PX4A 3CBNA 2HYXA 4EN9B 3INAA 3LEKA 2G1MA 1CZSA 1XJAA 4NWWA 1HRV1 2ARXA 3MFCA 4TYSA 4CEWB 4OZXA 4UFLA 1BEV2 4UT5A 1JZ5A 2CV6A 5BNNC 2NN8A 2PAMA 4E4SA 3LZZA 2VOVA 2ARBA 2ZXQA 2OXBA 1LAJA 4JC1A 5FZCA 1D2QA 1WW5A 2HWF2 2PFWA 4AFAA 4JDOA 1UO9A 2D5HA 4PLOA 4BXFA 5CFDB 4CUGA 3AYCA 1LCLA 5EFUA 2BZDA 2I07B 5FPZA 4PQ9A 4TZDA 1PO12 4QPGB 3AVRA 3N7LA 3NNFA 1OF3A 2J1SA 4ZHNA 5AC93 1HB1A 4GH4C 1W8TA 1O6UA 2Y38A 2ZHNA 3MICA 1W39A 5ACA2 1HN1A 2CAVA 5DUVA 3RZMA 3AYAA 5AVAA 4N53B 4JGYC 1EV12 5IVEA 4LO6B 3ES1A 4DQAA 4XJ9A 1W8FA 4EQVA 1N1VA 2GMEA 2K9ZA 4IE6A 4CCJA 4EJRA 3M8LA 3AKSA 4LJHA 4JDMA 3PTYA 1W99A 4Q0SA 3ZXJA 3K51A 3BTZA 4CUBA 3OJBA 1AL21 3BGAA 4XCBA 5IK7A 4HFSA 4HL0A 1O3TA 2LTNA 3H0OA 5EV7A 5CNAA 5FXVA 3J4UH 1OFNA 1O8PA 4XAEA 1R093 4FPYA 3J8F1 1COV2 3ZN4A 1YHFA 3ZYPA 4Z2WA 1ZRCA 2VZTA 1K42A 2VZRA 3LQCA 4UW5A 5FXZA 2BU9A 2WZR2 2IFWA 4OLLA 5FZ7A 2VMCA 4I3PA 3WUCA 3KHBA 1ULFA 2VUDA 4UOJA 5DDJ2 4MGTA 4PIZA 4YM0A 1QXJA 2Y64A 5AFBA 4F83A 4BOWA 4CPBA 1XNKA 1W6OA 4NPMA 3ZR5A 3POIA 3FZ3A 5BXXA 4CDWC 1WD4A 4X8NA 1VMFA 4AYUA 4HVRA 4L0PA 5EYXA 2BUKA 1Y43B 1LOAA 1VAVA 2Y33A 4AEDC 3PVOA 3BALA 3NKTA 5LBCA 1KJRA 3WDWA 3H50A 5G05L 5GZFA 1Q8OA 1QGLA 3PLQA 1UZWA 1XC6A 2A1XA 3T1LA 1NCRA 1RVF2 1NQDA 2QFEA 3I2JA 5CG8A 1LOGA 1GU3A 5D8AB 4JGZA 3TNPB 3IKWA 1VAMA 4GWNA 4OHZA 2FBEA 1G7YA 4CEYB 3I2FA 4V2WA 2JX9A 1VBD2 5GJ6A 1QJU1 4Q4V2 1DCSA 4Q29A 2RDQA 4FPFA 3KMHA 2JICA 3VZOA 3I49A 1GOHA 1OLME 3LAGA 2J1EA 1VBB1 3PNAA 4OI4A 1BQPA 1LHWA 5F5AA 1CVNA 4Y3OA 4MH0E 4HKWA 1K45A 2RHPA 4KQ7A 1FI2A 4QQPA 1NA1C 2QBXA 2NP0A 2YFZA 4A7YA 5IK4A 5K8SA 3ELNA 2OPWA 5IATA 2XJVA 4FAHA 2Q8EA 2WSVA 1DLLA 3U14A 4J6GA 4WZCA 2JDZA 3MUZ1 3M3IA 4CCMA 3GHNA 3HBZA 5I8TA 3T2QA 4P9LA 5E88A 1FOD1 4XAAA 1BZWA 4QM9A 1NXD1 4XCAA 4CCDA 1QIQA 3ENRA 4XTMA 3ZKUA 1BJQA 4CTEA 3WHUA 4Q4X1 1O7FA 1RXFA 3RI9A 4BH9A 1V9U2 3K2OA 4Y22A 4BQ4A 2P37A 5C8CB 4XW3A 4SLIA 4OI1A 2A6VA 3I59A 4KWUA 3S5QA 5BNOA 2BVBA 3U4SA 3O1RA 1VE0A 3NW4A 2JWPA 4F3JA 3GJBA 4YW5A 5CA6A 4YW4A 3C2UA 3U1XA 4AXOA 1UX7A 1N47A 3ZIXA 1WCKA 1VIWB 1OI6A 3SXWA 2Y60A 1Z7S2 4IV1A 1M06G 4W50A 1N1TA 1SLCA 5J98B 3RRDA 3IDAA 2ORXA 1H8VA 3Q8EA 1RUI3 4R52A 1O3SA 2KD7A 3QACA 3RJ2X 1DYKA 1QQP2 1SFYA 2DURA 3LFIA 3ACGA 3LWCA 4Q4Y3 4XJZA 3SCFA 1DQ2A 2WNUA 3WDUA 2ZMKA 4XABA 1A78A 2SLIA 4ZXEA 5B4XA 5FY8A 3AMHA 5FY1A 3EHKA 5I0UA 4XUOA 3VBRB 5LWBA 2FDIA 3VDDC 4QB6A 2Q4SA 2FZ1A 4WVZA 4MOAA 5FK7A 4Q4W1 2WINB 2E9QA 1WUVA 2RS51 2YROA 2HEVF 3PVNA 2A75A 3RVHA 2F6BA 1W6OB 4UFJA 4R4ZA 3BTYA 1CZTA 2ZOEB 3WZ1A 1VMJA 2W9XA 2ZPXA 1RUF1 5DZEA 4XHBA 1F31A 2XQRA 2HWF3 4O61A 3KCCA 4G9SB 3RWNA 3ZFEC 4CU9A 4RQPC 3CJIA 2GP5A 1BEV1 4DB5A 5A6XA 3O1SA 1NOVA 4IE0A 5FMBA 5HPOA 1W3XA 1SLLA 1KQRA 2Q30A 3KD4A 3KF3A 5JZGA 2PHXA 4UXAA 2WYSA 2DU1A 5A3OA 1FX5A 1NCRB 2Z5WA 3M3OA 1OQEA 3GJAA 1X9PA 2Y6JA 3LB9A 4MUVA 4HVOA 4NHLA 1MVEA 4JGZB 2WO2A 2VU9A 1W6QA 5DXDA 1GQPA 4LR4A 5ACA3 1JUHA 3O1TA 2P5BA 2RS12 5A3UA 4CRQA 1R081 3PIJA 1E5HA 2BYVE 2GC0A 4FPOB 1U5XA 2YU2A 3GNEA 1S0FA 2WWSA 4QHOA 1PGW2 4FTSA 4QMAA 1PO11 2NZ9A 1S2KA 2BERA 2XQXA 2FQPA 2QCSB 3OCPA 4QM8A 5A33A 2A3XA 2IXLA 1KFUL 3KCXA 1F5FA 4UBHA 4YPJA 1DBNA 1LHNA 3DYOA 4XF1A 3SC7X 1QJX1 4IGQA 5T55A 2BNNA 1EV11 3B5LB 1H2NA 1AR83 1WMEA 2DTYA 4FFFA 4FOYA 4M3CF 4FPCA 3MGUA 1UW8A 2VZPA 4IE4A 2R30A 3PMSA 1W04A 3RWKX 2QQWA 3AKTA 4XFGA 1VBC3 1FYUA 1RUG2 2Y34A 1UIJA 3VBFB 4COWA 5JMOA 2Q1FA 1W2UA 2A3WA 3W5MA 3B9IA 2WZR3 3OGGA 4CPBD 2WBKA 4EROA 4ITCA 1TNRA 3K46A 2AH2A 2QE3A 3ACLA 3J9SA 4Y22B 5E89A 1LNSA 3NAPA 5FZ0A 4K8FA 3UKVA 1AHSA 1I5ZA 1XPWA 2LROA 2VOTA 4UF0B 5GZGA 3V0AA 3I59B 5A7WB 4AF9A 1VB2A 1F2NA 1UYXA 5C3QA 1VPHA 1W8WA 1RJ7A 3VD4A 3H42B 5GKAC 5DDJ1 2VXRA 4IV1B 5FPBA 1JXNA 1HIXA 4OZOA 4YFZA 3KGZA 2AENA 5C9AB 1RJ8A 2QDNA 3KV9A 4XZUG 4GMP1 4JV4A 1IKQA 2GP3A 5DAVA 3WW2A 5BNNA 1XQNA 2VECA 3M3CA 4HN1A 1UZYA 2HWE3 2J1TA 2VTXA 3WQBA 4BIOA 1C3HA 3I2GA 1ENXA 5GM0A 2CL2A 2VTXJ 5GZCA 2A73B 2Y8KA 1YC61 3ZM8A 3AVSA 1YFWA 4P9XA 1GR3A 1SBEA 1VBD3 1BK0A 3SH5A 3D82A 3Q8FA 1SCRA 1RVF1 1S0BA 2J7MA 3CIHA 4P9JA 2VL4A 1SG3A 5F7UA 4YVSB 2DWRA 4META 4B4PA 4ZZ5A 4YVWC 1PHMA 1XE0A 2PTMA 2ERFA 1JYTA 4NHMA 2H0VA 3PURA 3POWA 4QGNA 2E63A 4FTEA 3WQ7A 1RUD1 5KXCA 1LESA 2PELA 2RDNA 4K9SA 4Q4V1 2WWUA 4XOGA 4YW3A 3WNXA 3O0VA 1D4VB 2MEV2 1POV3 2W39A 5H9SA 4WVVA 1OD5A 2W1QA 1GMMA 5GLTA 4JGYA 1RUC1 4CU7A 2GNBA 3KB5A 4FQ4A 1ND3C 5FYVA 1V00A 2EIDA 5HCHA 1CWPA 1W6QB 2ZGRA 4LIUA 2BRTA 1H1MA 3I3QA 4QX8A 1NUKA 1W28A 5JOZA 3JD73 2W3JA 2X10A 4YZ5A 1GKBA 4JZRA 1OVSA 5HBAA 4LO7A 1SLAA 2CGOA 1V9U3 1V6NA 4Q26A 4BWOA 4D6SA 4EN8B 1YFUA 3PHMA 1NCQC 1WCDJ 3ZYFA 4Z2AA 2AGSA 2ZTNA 3BPSA 2R7EB 3A21A 4H7MA 4UW6A 3U10A 3WOGA 1XNTA 1YQ2A 4RHV2 3UJQA 3T1MA 2JIGA 4TXWA 5D1IA 2WZPP 4UFMA 1LKNA 2HWD2 4IV3C 1F4AA 2OS2A 2UYBA 2WLPA 2ADEA 1KGYA 4AGGA 1NXMA 1DF0A 2D6OX 2WT0A 5F39A 3BIWE 5FR3A 4L99A 2ET1A 3HBKA 4C1XA 1ODNA 5JPMB 3B94A 3MIBA 4KBZA 1W6MA 3VV1A 2DCYA 3WR0A 2DV9A 2JEMA 2JG8C 3OEAA 1Z7S1 2A70A 3FUQA 5FJHA 4KMQA 3MF6A 1B35B 1VRBA 3O14A 1UN1A 4I30A 4AEDA 5SV5A 2DCJA 5GZDA 4NAOA 5FO8B 3NAPB 1QQP1 3OYWA 3ZSLA 2ZGMA 3B93A 3ZFGA 5LEKA 3OUHA 1LU1A 4LE3A 5J3UA 1UX6A 4W6XA 1FMD2 2BTVC 1EYBA 2CYFA 4LBKA 4S2GA 1QJY2 2GC2A 2R042 3LOBA 2VZOA 3WNPA 1XSRA 1Z0HA 3LGRA 2L9LA 3LSDA 1ZRIA 1MS5A 2J1AA 3OBRA 3OTFA 4Y1UA 4WVWA 2XG3A 4GD4A 3ZR6A 5FUIA 5BNNB 2BQPA 5FK8A 5A32A 4FQZA 2VULA 1OLRA 4ATEA 1YLLA 3FHQA 4GB32 1VMHA 2VD7A 5KHGA 4AI8A 5FIXA 4H14A 5T5PA 2DFCA 2PA7A 1NA1A 2C1FA 5C4WB 3H8OA 1W0OA 5BNPB 2C26A 1R64A 4BB3A 1DDLA 1UY0A 4BA6A 1NE6A 1KD7A 1OLMA 1PZ9A 1S2BA 3IBMA 4M4PA 3ZYJB 4DO0A 3TBDA 4L9BA 3S0MA 4FPHA 4QHZA 3SCHA 3U78A 2RS11 1DG6A 2NQYA 4NE9A 3O0WA 5C3SA 5LA1A 2VVFA 2RS33 4NWVA 1MZFA 4HETA 1LULA 5IYYA 3O12A 5JCTA 3MDPA 5IK8A 3FWEA 1LR5A 2VBPA 2VMGA 4P9WA 5LA9A 2ET7A 3UGHA 3W59A 5HXMA 1A34A 1J83A 4A3XA 4JGYB 1F8VA 4QKBA 3CF6E 1UY3A 3E5XA 2RE9A 1QXRA 2QTWB 2TEPA 4NPRA 1VBE2 1UXXX 2PAEA 4XXAA 5A3MA 5D2AA 1GOFA 2CGNA 2YG0A 1OHFA 1JYIA 3POBA 2WQ8A 4EZ4A 3LCPA 4LQRA 1C5HA 3N7KA 4LBNA 1AUYA 1WCQA 3CEWA 4QDRA 2PN5A 3DV8A 5T54A 2XVLA 2Z4FA 5FP3A 1FV2A 4LO4B 3CU7A 1BVP1 3C7FA 1RUG1 1PK6B 4AQ2A 2C24A 3O0XA 1XOYA 4NR1A 4DUVA 1W6NB 2WN2A 4XC9A 4HSLA 5DPNA 1UU4A 1XU1A 1L7RA 1TNFA 4NIGA 2FDHA 4I01A 5F5CA 3ZN5A 4BU2A 3G7DA 4FSJA 1RC6A 1GFF2 4AEJA 4O65A 3P6BA 1UOJA 4GWMA 5F3IA 1SEFA 2G4IA 4NRMA 4B1LA 4XJAA 3OUIA 1LENA 1WMDA 1UY4A 2YGMA 5FLHA 3ZOIA 1TVGA 1W6MB 3ACIA 2G19A 5FYTA 5E6HA 3ZKYA 3WW1A 1DYOA 2I45A 1DLCA 3R05A 1YI7A 1IPKA 4QT6A 1YFYA 3HMYA 3PU3A 2WO1A 4RQPA 4U2AA 5DZFA 2A7AA 2YBKA 3OYWB 3U4XA 3ZFFC 3ZFGB 1XBFA 1W2TA 1L7QA 1HRI2 1AVBA 5FY5A 4QX2A 4OHVA 3WF1A 4XZPA 2NM1A 4YGEA 1POQA 2BWCA 2D98A 1UWWA 2F4LA 1NAEA 2PHWA 1RITA 2PHUA 4WM7C 3LPFA 3M1HA 1UCXA 3NNMA 1WLDA 1GQGA 2WT2A 4P5YA 5FLJA 4CDXC 3VBUC 5J7MA 4RYDA 4OUEA 2AC1A 2VW0A 5C6CA 5A32B 4INDA 2JE7A 4ZU7A 1FV3A 1J84A 2IXKA 4QX5A 5DN2A 5K7PA 4XQ4A 1G9BA 2JDUA 4IETA 4Q8LA 3ILFA 3POJA 2MEV1 4XFFA 3FL7A 3A0KA 5FOBB 4M3CA 1XYPA 2XMLA 5FYBA 2KR2A 1RUH3 4HZFA 2X05A 2D6LX 2VQTA 5FZ6A 3T4VA 4ZY9A 2W52A 1WA6X 4FOWA 3KWVA 2VVEA 2KA3A 3HD8B 1W9SA 2OQ6A 2UY9A 3N9PA 2BEOA 3AMPA 1E57A 4BQXA 2EIEA 3I3EA 1IHMA 4DRRA 3AJYA 2BBAA 3WDVA 4RFRB 2E51A 4K6BA 4YSFA 2VQ0A 1ODMA 2B7YA 4N43A 3J8F2 4BQ3A 4LHNA 4LHKA 4ET7A 3A4UA 3HT2A 4EWDA 1IPJA 4C91A 4XHXA 4URTA 2WFF3 4RHV1 3JB8A 3MPPG 4MGYE 3T0AA 3R0RA 1LOBA 1AR73 3CO2A 1JU3A 3AYDA 4IL7A 1W06A 4L97A 3M2MA 4Q0UA 3I2OA 2VR4A 5EZWA 1APNA 5LA2A 1TME1 2HWD1 2R1DA 4K7JA 2BFUS 2VPVA 5JIAA 1C8NA 1C57A 2ARCA 3A22A 4XQDA 2RR13 4LUMA 4F7ZA 3EJKA 5G04L 2HWB1 5F5IA 3FBMA 3P5BA 2GMPA 4AI2A 4A45A 4AHYA 1KDKA 4XFIA 1O8SA 5IHRA 5C3PA 3BVCA 2VC9A 4XFHA 4N9HA 1C28A 2R043 5CIRA 4QDSA 3WG2A 3E5UA 4CSWA 1ENRA 5EPAA 4COYA 2CY6A 1Q3EA 1SBFA 2BOIA 3M3QA 4YGBA 3RZGA 1OVPA 4COUA 3APBA 2ZZJA 1D2SA 1FMD1 4E4DX 2WS92 1IQDC 2QJVA 4HANA 4XDQA 5F8PA 3RNSA 4YVWA 1QJY1 4AVTA 3O5SA 3K77A 2F17A 4LBJA 4PLNA 2AYHA 3FFQA 3O1OA 1N1SA 1FATA 1VBB2 3OGSA 2AZ5A 1SLIA 2HLEA 2ZJCA 4RQPB 4ZXKA 5JXIA 1YEWA 2JG9A 3BB6A 1XXNA 5KHHA 3LSEA 1PMHX 3I8TA 1AXKA 1BYHA 2VG9A 3A7QA 4Q1RA 4GB31 1JBCA 3LDKA 5FXWA 4C8DA 3ILRA 1ND3A 2EXKA 4MLOA 2E53A 2WNVA 2W87A 3PIGA 5L9BA 2R32A 2RDSA 2RMU1 2WNOA 3AMMA 4HKOA 5KXBA 4LT5A 4CCCA 3VHRA 3H9AA 4Z1VA 2ZX0A 5IVFA 1FOD2 3AYEA 4OFGA 3U37A 4DXSA 3E6BA 1YO8A 5CADA 4CE8A 4YZ1A 4J1WA 3RMXA 2FZ2A 3GCXA 3K3NA 4IESA 5FMCA 1C1FA 1CAVB 2MPFA 3ACHA 3N3HA 3P3PA 4C0HA 5L19A 1DFQA 4ARXA 4BCUA 2OW4A 5DUWA 4LTAA 4S2DA 3O1PA 2F4PA 1VLNA 3HQRA 1IQAA 4IV3A 3ZMNA 1BHGA 1QJEA 1VBE1 4XUPA 3WF3A 1WMXA 2VUAA 2XLFA 1X33A 1W6PB 3ASIA 1LOCA 1ZA4A 4N43B 4BXSV 5FTTC 1DIWA 3WVJA 4URAA 1JOBA 1UY2A 1F5JA 3S7IA 1SLTA 2BFUL 3KVBA 1G86A 4YLZA 5FPLA 1BBT2 1GBGA 1NY71 5FV3A 4B4RA 5LB6A 1HB4A 3B9CA 3UL2A 1AR92 1KDMA 2XBO2 5T5JA 1HRV3 4Q4W2 4JTNA 2NMNA 2B39A 1U5IA 3VHOA 3WEZA 2J1UA 3PJQA 1A8DA 3MV11 4QAWA 4BZ4A 2W47A 1RUF2 1ZRFA 3MFAA 3BKZA 1DZRA 5DMYA 1V6OA 4IGPA 2E7QA 5LBEA 1MZ6A 2BWAA 3WG3A 5A7NA 3WINE 4BK4A 4CZSA 3SH3A 1OOPC 4B4QA 3C3VA 5FO9B 3IPVA 1RTVA 2XB6C 2IXCA 2Y26A 3OOXA 4QXHA 4P5HA 5F2WA 1GWKA 3S6PA 2RG4A 4CDUA 2B5HA 4CVUA 4I2OA 3V65A 1AX1A 4OMCA 2YC4A 3MW2A 1NLQA 1GICA 1HRI1 1UYZA 4EN7B 5EIYB 4IUGA 3ZDVA 2GNTA 4AL9A 3HOBA 4QHBA 5HV4A 3LPGA 5LEJA 1ZZBA 3FUOA 1V6MA 1R082 2VMFA 3D4KA 1UY1A 2PYTA 1OC1A 3CNAA 2MHFA 4BYYA 1YQ5A 1PMJX 3NSTA 2WZ8A 3WP6A 1UMZA 4Y4RA 2PQQA 4AVCA 1U12A 1POV0 3OEBA 3DYMA 2FD8A 2JG9B 5JI7A 2GH8A 4K8RB 2ZAHA 4CDQC 4ES9A 1QJX2 4KWJA 3WQ0A 2DVBA 2D6NA 3JB4C 3V64A 5LBFA 1AL23 4H2AA 3URFA 2QQPA 4QQ2A 1ND3B 1OXCA 2XUEA 3NNJA 2WNVB 4NHYA 3KV6A 3DXTA 4LIVA 2RM22 1EP0A 1PVC2 2VJXA 3J8F3 3MYXA 4P9YA 3ABZA 4PQQA 4XURA 1I5PA 1LRHA 1AL0G 4Q1PA
chains in the Genus database with same CATH topology
1LHVA 4E9KA 3SHRA 1UKGA 2VOKA 1RB8G 2HEWF 4RSUA 3KT7A 1Q8SA 2ZGQA 5LRRA 4LE4A 4MZUA 3ZYIB 1C8M2 3FJSA 2CWSA 3AMQA 5I8YA 4LA3A 5L7OA 4ZU5A 2O8OA 4XPVA 3WDTA 3X29B 4X6RB 1DGRA 2R0HA 1H1AA 2XHKA 3BCWA 3TN91 4AVSA 3VHNA 4FOQA 3WG1A 1WLCA 3PVBB 2C0ZA 3W9AA 1AXYA 4AI3A 4NO4A 2VW1A 1QOTA 3JBG2 3VUOA 2AREA 1RMU2 2RJLA 2E6VA 4OUSA 2Q0AA 2RJKA 4KGQA 3ZFFA 1QJU3 2XKPA 1IKPA 1JHNA 1VBB3 1CJDA 2DYCA 1RINA 2G9FA 2LM3A 1TMF1 1D0HA 1UU5A 1CPNA 1QU0A 1SCSA 2WS91 3NWKA 1RUD2 3VBUA 2DCKA 2ZGKA 3LA2A 1H8TC 3PMEA 5KWRA 1T6GC 2QVSB 4YRDA 3WG4A 3S7EA 2GDFA 1H30A 2QDRA 1RUC2 3IPVB 4CDUB 1OA3A 1RHI1 1IGOA 1ASJ1 1FOD3 1WD3A 2DU0A 3J26N 3QCWA 2UU8A 3ES4A 2ZABA 1S1AA 4D7TA 3B7MA 1G9DA 3CJXA 4Q4X3 1J3QA 2GC1A 5JSRA 3THTA 3HWJA 1DZQA 3IDBB 1YIPA 4D69A 4LBMA 5EXOA 4PBOA 1GLHA 4XQWA 4AWDA 1PMIA 2DVGA 3WP4A 3L9JT 1I9RA 4IEYA 1UD1A 4A7KA 2UWAA 3D6EA 5GLVA 2ZGOA 1LOEA 1R1A1 2GNDA 4QPYA 3ECQA 5KHIA 4W6YA 2QUOA 1OA2A 4P9GA 2C5DA 4Q4W3 2ATFA 1ZBA2 2RS53 4XBLA 4BHPA 3H3UA 3WLUA 3CLPA 4O9EA 1PO21 3MIFA 2ZX2A 5ABJC 3MLKA 1BBT1 1RUF3 1TQ5A 4YNIA 1O3QA 5L7OB 4L2NA 4EN0A 3ST7A 1AR91 1EPWA 2XBO1 1QOSA 3GALA 5KHKA 2WA3A 1BEV3 2GAUA 3AK0A 3ZYRA 4KWKA 4WVMA 3VKMA 1LOFC 4AFMA 1NYWA 2XJTA 4MV2A 4LULA 4BM8A 4I0BA 3ZSKA 5C33A 1A6CA 1YYNA 5I0RA 4D3WA 3WT3A 1AJKA 4NN0A 1R083 3MI8A 3ZFFB 1CN1A 4YGCA 1HX6A 1MS8A 3FE5A 4RR3A 1SLBA 1PO13 3WD5A 1MEC1 4G4FA 1G6NA 1LGNA 3KT4A 4AGRA 4M3CE 1FT9A 2R071 4QPIC 3OF1A 2CTVA 1QJX3 1EV13 3E97A 4GKXA 2HKXA 1C4RA 1OQDA 3NV4A 4TWTA 3SNMA 5K0UC 4FT8A 1O4ZA 1X50A 4P14A 2D5FA 3H1YA 4PDWC 1MQTC 2SBAA 2D93A 4IEUA 1I3HA 4KG8A 2PHDA 1O5LA 2DVFA 5CU1A 4JAAA 1LEDA 2RM21 4LBLA 1PVC1 4K40A 1COV3 4IEOA 4PLMA 4ASLA 4C1WA 1YNAA 4Y24A 4Q27A 2P34A 4O9GA 1CQ9A 1X8MA 4LLFA 4XILA 3VKLA 4ATFA 5JAXA 3ATGA 5FREA 1QXPA 4DNYA 1YIFA 1ND2A 3GZUC 3NVCA 5DDJ3 5JOYA 3IIAA 4DMIA 4X8PA 4YGDA 2DFBA 3VBOC 1DGWX 1C8M1 4GMP3 5BNOB 1BCXA 1QHDA 2VH9A 2X5IC 1PNGA 4R9DA 4AFBA 4YG3A 3FMGA 2A6WA 1RUOA 3VGIA 2GNMA 4COZA 1TE1B 4IEVA 2VNRA 2WLQA 3VBHC 1Q8VA 4B7EA 1IZ3A 2A71A 1REEA 5CG9A 2R6QA 1RVF3 2GN7A 1QY4A 2R49A 3JBG1 4FO9A 1GZ9A 1OOPA 2WNUB 1S0DA 1RMU1 2Y0IA 3WP3A 5KBFA 2WFPA 4Y26A 2GC3A 2Q1ZB 4QU2A 1RUD3 1WA4A 4C0BA 4Q4V3 3R4SA 1JYCA 4QQLA 1O5UA 4QXKA 4Q8KA 2ETEA 1QKQA 3KQRA 4H3WA 4CEWC 2YYOA 5BYNA 1J59A 2GALA 2ZGPA 3EBRA 3H7YA 2D43A 5H9PA 1ZBE2 5J96B 2ENRA 3CJIB 5E16A 4XFAA 3E6DA 2ZX3A 4GH4A 1GYKA 5JZGB 2R1BA 4GALA 3MF9A 4D7SA 1J1LA 1REFA 1VBA1 4ES8A 1LHUA 4RR3B 1R1ZA 1PIV2 1NQJA 4E27A 4FOVA 5CFDC 2CGPA 2ZS6B 3UK9A 5DZGA 1IS6A 1VJ2A 2ES3A 1OMIA 5A33B 1U5ZA 3ROUA 4N53C 4XXPA 2D6MA 2FMYA 3I2DA 1TME2 5EYYA 2D3SA 1Z7S3 2IWGB 3DN7A 5CFCC 4WV8A 2DVDA 2P3IA 1QQP3 3QH7A 5HXVA 2HWB2 1VRH1 3RMYA 2BW8A 3HR9A 4AVVA 5GLZA 4K3UA 4CDWA 3AP9A 5FFOC 1CD3G 3UJOA 1A8MA 3GYDA 1U0AA 1N3QA 1ND2B 1ZBA1 2TNFA 5EWSA 1I6XA 1HXS2 3OD4A 5AVPA 4BPZA 1DQ5A 1FPN1 2Z79A 2P3JA 2DF7A 4NVPA 2OPKA 5JR7B 4YZ3A 4C90A 4S2HA 2Q5TA 3VZLA 3V0AB 2EXIA 1GNZA 3SH4A 1Y7BA 3KSCA 4ZKTB 1DU3D 1EAH2 1YXWA 1Y3TA 2E7TA 1GNHA 1AF9A 2YXSA 3USUA 3OBTA 3BOWA 4DXZA 1H8TA 3IN9A 2HWC1 3AFGA 2BNMA 1OOPB 4OUMA 2VNGA 4XFBA 2HEYF 5LK5A 2RS13 2AUYA 1XNCA 2DUOA 3U07A 2RMU2 3WCSA 1MS0A 5D8AC 4Y1VA 4Y1XA 3WXPA 4CEYC 1RIRA 3RDIA 3HT1A 3P3NA 3RS6A 2XWJB 3E5QA 4W65A 3M4FA 5HI0A 1ZZ6A 4GH4B 4XBQA 2Q8OA 3TNQA 3VKOA 4MGKE 1CX4A 4I02A 3WHTA 1CPMA 4FVVA 1RUNA 1CONA 1GZWA 2PHTA 2NMOA 1IS4A 3HAGA 5E1RA 1RUG3 4E2SA 4AHZA 1QNWA 2YY1A 2W0XA 2Z2SB 4B8EA 2R062 3AX4A 4G3YC 2ILMA 1RUJ2 1NY72 3N36A 3RQ0A 3HN1A 1FAYA 2AR6A 2X53S 2JKBA 4LNVA 4BMEA 5ABJA 5C8CC 1FXZA 4B7KA 3VDDA 2NPIA 3IT8A 2XKOA 3B00A 2V5YA 2XVGA 2Q1MA 3NV1A 1RUE1 2WQ4A 4X6QB 1H2MA 4GXLA 2LALA 3O7OA 4FBFA 1QWRA 4CDWB 2YHJA 4E2GA 4EWEA 3FLPA 2XVKA 1AYN2 1IOAA 2YV8A 3ZFEA 4AEDB 1V6KA 4XF4A 4GIQA 4E4ZA 3VBRC 2BPA2 1ZYBA 2CNAA 2VVDA 2HYKA 3KM5A 2E7AA 4XFCA 3WDXA 1DGLA 4KG0A 1AYM1 1ZREA 1UL9A 4XMAA 5L73A 4H7LA 1KS5A 1LHOA 2MEV3 2N7GA 2UYAA 4Z07A 3ZXAC 2OZ6A 4QGLA 3WW4A 1PGL2 1H2LA 2QKDA 3THPA 3W58A 2GH2A 1QDOA 3ZXEA 3N35A 1ZBE1 1G9CA 4ASMB 5JSOA 4A2UA 1NCRC 1O4TA 3IMNA 1NA1B 2C9AA 4PDWA 2Z42A 4PF5A 4YW2A 2IXHA 2XJUA 5T5LA 3RPQA 2LUWA 1NE4A 2A3YA 4JGZC 4JRAA 1N3OA 1PIV1 3ALQA 2PHFA 3AZYA 3AXEA 4KWLA 4RHV3 5FQ0A 3RI8A 3IWZA 4JDNA 1TME3 2HWD3 2O0OA 1HV1A 2Z69A 4XJUA 4AW7A 5FRAA 3AZXA 2XUMA 4YZ2A 2VMHA 2X8KA 4LBQA 1GZWB 2HWB3 1DHKB 4M0NA 4Y20A 3VBOA 5AC92 3D0SA 3TN92 5H9RA 1O3RA 1AX2A 2PLV1 2DVAA 4B3NA 4LEJA 3ZMOA 3ZSMA 4LO8A 3VBFC 1A3KA 4AG4A 1AXZA 5J37A 2ZGLA 2TBVA 1N3PA 4DY3A 1WBFA 1FMD3 3QLQA 4Y1YA 2OZJA 1PZ7A 3VZNA 3ZO0B 1QJY3 4M00A 5ABJB 3MIDA 1HXS1 2CAUA 2YUEA 3WQ1A 2IZWA 1VB4A 3WDYA 4K1ZA 3VDDB 3V0BA 1TMF2 3JQWA 3AKRA 3RYKA 3D0JA 1EAH1 1YWKA 4IV1C 2D6PA 4GB33 5C9AC 1CJPA 5K9YA 1L3JA 1O91A 2EVXA 2RMU3 3ZFEB 3MZHA 4EN6B 1RHI2 1ASJ2 1HW5A 4DY5A 1SACA 3AXDA 3KCYA 3RYPA 5CFDA 4YVSC 5T50A 2D44A 1B09A 1BVVA 2H0BA 1LGBA 2XPJA 4RS5C 1H1IA 2OYZA 1MACA 2A6XA 4KGGA 3Q9OA 3MEPA 1NCQA 3HQXA 1VBE3 2A5ZA 3AZZA 2WL1A 2BVVA 1CESA 2PHLA 4N7IA 1MR5A 5FOJB 4N53A 1R1A2 4M3CB 4PDWB 2ZGUA 4XMIA 3NV3A 3VBSC 5CFCA 5F6KA 2JE9A 5GLWA 5FQ0B 1H4HA 3TOJA 3USSA 3BU7A 4GKYA 5T5OA 3OGJA 2EAKA 2VGDA 3GBWA 2JG8A 1YCIA 2R061 2VOWA 1PO22 1RUJ1 1D4M1 5SV8A 4LBQB 1ZZCA 1IS5A 4GMP0 3VBOB 3DF0A 1SMVA 3L2YA 1MS4A 2ZA9A 1LTEA 2X29A 3TYJA 4MGIE 3QOPA 3ILNA 4DFSA 1KFXL 4COVA 1LB2A 1HRI3 2GU9A 1B35C 2EALA 3MLJA 3SISA 4FPJA 2WSUA 3KGLA 4L92A 1AYN1 1GANA 1AR61 4YG6A 1MEC2 1WLTA 5T52A 1RUI2 5JPNB 2V09A 5FPXA 3V0BB 4I0AA 4N7UA 4Q4Y2 5EJ3A 1SBDA 3B3QE 4KNCA 4CP0A 2ZHMA 2WIIB 5FCCA 2R072 3B69A 2FHRA 5F5QA 4YVWB 4CEYA 2B46X 3ZSJA 5BV6A 5A3LA 3JCIA 1WMFA 1XNDA 2ZACA 3MLLA 4FP3A 1PGL1 1BMV2 4WM8C 4AEKA 1PVXA 1URXA 3RZZA 5C4WC 4OI0A 4DOUA 5BNPC 3OPZA 3FHIB 3U11A 2TUNA 3AB0A 4D94A 3I7DA 1JTZX 3N7MA 3K48A 2KXLA 4LBQD 3U0ZA 3MIGA 3H3ZA 1H4GA 1MZEA 4OI2A 1VR3A 4JTOA 3QH6A 1NCQB 4PJYA 4P9IA 3RSJA 5IUQA 3TN93 5JMCA 3EO6A 3WCRA 1K5MC 1S0EA 2CWMA 2DUPA 1WW6A 4AE2A 3CL1A 4IV3B 5C8CA 1DGWA 3AP4A 2ZX1A 5AC91 5CFCB 2XJSA 1GZCA 4Z8BA 1V6IA 3ZIWA 4RFT0 4N9IA 1SFNA 1AR82 3LKJA 4AQSA 3GBFA 2JG8B 3ZXDA 1MVQA 4SBVA 1PK6C 2IXIA 4RD7A 5I93A 5FMOS 1TMF3 4XF9A 1JN2P 2V73A 4AHWA 1X8EA 1VBC2 2WS93 2B8MA 1AX0A 3VBRA 2PHRA 2WKKA 1RGSA 2D6KA 4UBGA 4CYDA 3FFZA 4IERA 1OLQA 1R091 3M3EA 1S0GA 4WM7A 4KL1A 1PM7A 2JENA 1RHI3 4ISQA 4Y5Z0 2EXHA 1ASJ3 4CDXA 3NKGA 4XE9A 5FLIA 5I0TA 2EIGA 4FPEA 5JIUA 1H9PA 1VBA2 1CAUA 1HLCA 3ZFGC 4XF3A 3WY6A 1G8WA 2UWCA 5BY5A 2ZMLA 5LK7B 2HWE2 1VP6A 1BKZA 2YZ4A 2P2KA 4AFCA 3N7JA 5LRSA 1OSGA 1NLSA 3S30A 1R1A3 1XYOA 5HCAA 3WUDA 4DINB 4FAGA 1HKDA 4Y4YA 4IEPA 3KZ4C 1UPSA 1XU2A 4L11A 3WX5A 1ZZ8A 4EV0A 5BPXA 4YM3A 3BTAA 4HK8A 4MVTA 3ZVXA 4LBOA 4GULA 2P17A 1PO23 1VRH2 3D5OA 5FBZA 3DUIA 5KC6A 1BBT3 3AKQA 1AR93 2XBO3 3M70A 2GN3A 3WW3A 4CP2A 1KS4A 3VBFA 4XETA 2B9UA 1M4WA 3TAYA 1WGPA 1FPN2 3JD72 4S2FA 1EPZA 2A6ZA 2YC0A 3GBGA 4WZFA 4AI1A 4BIFA 4QGMA 1UAIA 2XL7A 1FNZA 5FMOL 1ZRDA 4K21A 4OHXA 4XYXA 5C9AA 4IEWA 3RG0A 4R9BA 1MEC3 2HWC2 3SLIA 1W0PA 5CBLA 1GV9A 1QOOA 4TLFA 1KJLA 4MGZE 2A6YA 2R073 2DUQA 3VL8A 4ZU4A 5KXDA 1ZM1A 2ZHKA 3ZXGA 1RUI1 1Q8PA 3MIHA 3ZX7A 4WM7B 1XYNA 4YVSA 3H1WA 4MSVA 3DPRC 4Q4Y1 1ULEA 3B01A 4QQOA 4CDXB 3VBUB 2R16A 4RS5A 1OKQA 3UV9A 5KHJA 1MZ5A 3UKTA 2ZBJA 1YFXA 3I54A 4FPLA 4XJWA 2RM23 4FXKB 1PVC3 1CAWA 2IFRA 1CAUB 1QF3A 3FLTA 4XTPA 1QNYA 4IEQA 4HBNA 1BMV1 5HCBA 3R4DB 3OD0A 2HWF1 1HQWA 2ZGTA 4ONUA 5BUVA 5TSWA 4GQ7A 1HQLA 3VBSA 5HCFA 4AHXA 4KBBA 4DPNA 1QMJA 3WP5A 3ZSEA 1J3PA 1WBLA 2XLGA 2OUJA 1C8M3 4OVEA 2VUJA 4R4XA 3FLRA 1LGCA 4RL7A 4Y1ZA 3R4UA 5ACA1 1G9AA 5DUXA 4FPKA 2D40A 3AKPA 1YI9A 2RS32 4AQTA 3TWIA 3ME2A 5I0SA 4AEMA 1RUE2 3JBG3 1X36A 3L2HA 1YJLA 1RMU3 3I4IA 1JOJA 5CVRA 3GF6A 3GHMA 1OPOA 4N43C 4YYOA 3SCGA 1LODA 1AR81 2D7FA 4K20A 1ULDA 1B35A 4Q2FA 1O4YA 4QQHA 2P3KA 5J36A 4JCKA 1COV1 2NYYA 1HDKA 5CB7A 1V6LA 1WW4A 2MNGA 4HKLA 1VBC1 4MYEA 1S0CA 1AYM2 1ZVFA 3BOPA 4IEXA 2WZR1 4WVMB 4IEZA 5JVVA 4HVQA 1ZX5A 1BXHA 2DTWA 1VBA3 1RUC3 2EF6A 4KU8A 1LECA 4BLJA 1OA4A 2H6CA 3BODA 3TRSB 4AK3A 2WT1A 4OHYA 3VZMA 4CDQA 4WM8A 4LA2A 1Y9QA 1CAXA 2OA2A 4Q0PA 5C4WA 1NG0A 2XJQA 5BNPA 1H0BA 2EA7A 1LJ7A 2K2SA 2HWE1 1ULGA 2Y0OA 2K0GA 4YARA 4RS5B 3TB0A 1QJZA 4QPGC 2YPJA 1VAKA 1VBD1 1DYPA 3AZWA 1CGPA 1CAWB 2JG9C 4KH9A 2ZAAA 4Q0QA 4RGAA 1VRH3 3ZPYA 5GZEA 1K5MA 3AP6A 3RJRA 4BE3A 4MXWA 1KRIA 1OFSA 2WNVC 3GZTB 3VBSB 2NLRA 4XBNA 3V56A 1DQ1A 1ZBA3 2D97A 2PLV2 4DZGA 3NJZA 5JDBA 4MX3A 5JI9A 1FPN3 2ZZQA 4LLOA 1POV1 3QD6A 5KXEA 3VHPA 1RUH2 1JH5A 4UW3A 1WLWA 2VY0A 3POSA 1G9FA 2YGLA 1OPMA 1ENQA 3SITA 4FP2A 1PK6A 3ZXKA 3FX3A 3NL1A 1CR7A 3DL3A 1W6NA 3MIEA 1SQ4A 3JD71 4PCRA 4AFDA 3NV2A 4HSJA 1UPIA 2OUHA 1QDCA 1KITA 1V9U1 4AQ6A 4AVBA 1ZRRA 4WBBA 5FAXA 3D8CA 5L36A 1ZZ9A 2HWC3 5GLUA 1C5IA 2WFF2 5B2GB 4FCAA 5JWPA 1XE8A 1AR72 4NOTA 1S55A 3MW4A 2VMIA 3M7AA 4HPKA 2ZGNA 4PBPA 2RR12 2WJSA 1NZCA 3VN4A 3DGTA 3FBYA 4ORFA 1UF2C 3EXUA 4J1XA 1DGRN 4ISRA 2UY8A 1PZ8A 2ZKLA 5FDBA 2I2SA 2W08A 3ZXFA 2ZMNA 1IS3A 3IDEA 4YFWA 4GA9A 1SDWA 1DQ4A 4AI0A 5JLVA 3WV6A 3EQEA 2W68A 4CDQB 4WM8B 4CDUC 5E8AA 3MW3A 1CAXB 2ZHLA 4XF0A 3HIFA 2B45X 3H7JA 1JUIA 2BNOA 2BBVA 5I8SA 4XIOA 1XNBA 4TSVA 3LA7A 2GZWA 1S0JA 1X7NA 1Q43A 1EY2A 3IM0A 2D3PA 2JJ6A 4MXVA 3N4MA 3NO8A 2DCZA 2DCTA 1MS1A 3VKNA 4M01A 2XWBB 3R6SA 1D4M2 5H9QA 1LEMA 1PGW1 3AFKA 1RUE3 3AZVA 1K5MB 5I91A 2GMMA 4FTBA 1UKRA 4MXWB 1Q56A 1AZDA 2IXJA 2RS31 5DG1A 4BLIA 2ZGSA 3KT1A 4L8QA 1LOFA 4DS0A 2XJRA 3H1MA 5IT6A 4D7YA 3A0NA 5AFEA 4RA0A 1AYM3 4M0HA 1AR62 2QZ2A 1JW6A 1LU2A 5L7OC 3PJYA 4EWAA 4JVAA 2ZKNA 3VL9A 1ZBE3 1HRV2 2ZCWA 1H9WA 3DPRA 1KXGA 4QPIA 1ALYA 3USUB 3KLSA 4HPKB 1H8TB 5F6LB 2BGCA 2PAKA 1PIV3 1ZNPA 2XGXA 1X82A 1QH6A 5K0UA 1Q5OA 2B42B 1H2KA 1MQTA 2XH6A 4HLTA 4YG0A 1I1EA 2YMZA 1DQ6A 4R9AA 4XIKA 1N1YA 4DRVA 1PGSA 3H8UA 3QBQA 1F9KA 1PNFA 5F9TA 3AM2A 4AVAA 2JXAA 3G6JB 2QNKA 2OIIA 2O1QA 4LUKA 4N90A 1CAVA 3MPBA 2PLV3 3PVEA 3T2TA 2O8QA 4QD2A 4A7ZA 2FMDA 5FO7B 3BPZA 1YUDA 4HN0A 4OHWA 2WQZC 3GZAA 1FNYA 1J58A 4E2QA 2X5IA 4YM1A 1J3RA 1D0GA 3DKWA 1W6PA 1AL22 1HXS3 4XEZA 4CP1A 1CIWA 2KM2A 3VBHA 2IC1A 1DZTA 3ZXLA 5F1RA 1RUH1 1BK1A 3OY8A 1C1LA 5C8WA 1HV0A 1YJKA 1UZZA 1EAH3 3SMHA 5DUUA 4HK9A 3ZN6A 3VKFC 5BNOC 3AP7A 1R092 3ZDSA 5JOWA 3B02A 1HQNA 1REDA 4I3GA 2G9GA 4AGVA 1ONAA 1ENSA 2UWBA 2WFF1 4JRLA 5J48A 5J09A 2XLAA 1AR71 2WA4A 4HT1T 4R9CA 4CEWA 1GQHA 2WNEA 4NHKA 4V1PA 2JD4A 1XRUA 2WNUC 4YW1A 4B29A 5CAZA 2RR11 3JZVA 4IXLA 1YRZA 2ZX4A 1DQ0A 3JU9A 4I0WB 3VLBB 2GSYA 3FC0A 4YZ4A 1ZZ7A 3DPRB 4PIYA 1QJU2 2R041 1AJOA 4QPIB 3JQXA 3JUUA 4QPGA 3CJIC 4PIXA 4Z92B 5K0UB 3E6CC 5JZGC 1MS3A 3RYRA 2XJPA 3AMNA 1J1TA 2UURA 2XL9A 4JQRA 1MQTB 4I09A 4RR3C 5JOXA 2JECA 3VZJA 4BMBA 2R063 5BNQA 2VQAA 1Q8QA 4F8AA 2VOXA 5KC5A 2I74A 1RUJ3 1TEIA 1D4M3 4LHLA 2EXJA 1UIKA 4FPGA 4IQPA 5JSPA 5IK5A 3IDCB 4BQ1A 1ULCA 1S0IA 4UW4A 1XE7A 2HJIA 3VZKA 4Q4X2 2H6BA 1V6JA 3POYA 4LO5B 4R8HA 4HMZA 4YM2A 4XJ8A 1RL3A 1Z78A 2R0FA 4Y20B 5T3NA 4OULA 3KS7A 1OQ1A 1U5YA 4Z82A 5DG2A 1VALA 2D3RA 2X5IB 3AJZA 3UKNA 4Q0VA 2VNOA 2QZ3A 4KU7A 1AYN3 5GALA 2VW2A 1AR63 3VBHB 4RGGA 1WW7A 1NLRA 3OY8B 4H55A 1ND2C 2OVUA 3NAPC 1WCSA 2WC2A 4K1YA 1V70A 3LOIA 3ZN6B 4W6WA 3AP5A 1GSLA 3ETQA 2RS52 1QH7A 2EAAA 2YDEA 4U36A 1UU6A 4FXGB 3LA3A 5D8AA 3ZYGA 1MS9A 4EN9B 3INAA 4NWWA 4TYSA 4CEWB 1HRV1 2ARXA 3MFCA 4OZXA 1BEV2 2CV6A 5BNNC 2NN8A 2PAMA 4E4SA 3LZZA 2VOVA 2ARBA 4JC1A 1D2QA 1WW5A 2HWF2 2PFWA 4AFAA 4JDOA 2D5HA 4PLOA 5CFDB 3AYCA 1LCLA 5EFUA 2I07B 5FPZA 4PQ9A 4TZDA 1PO12 4QPGB 3N7LA 5AC93 4GH4C 2Y38A 2ZHNA 3MICA 1W39A 5ACA2 2CAVA 5DUVA 3AYAA 5AVAA 4N53B 4JGYC 1EV12 4LO6B 3ES1A 4DQAA 4XJ9A 1N1VA 2GMEA 2K9ZA 4EJRA 3M8LA 3AKSA 4JDMA 3PTYA 4Q0SA 3ZXJA 3K51A 3OJBA 1AL21 5IK7A 4HFSA 4HL0A 1O3TA 2LTNA 3H0OA 5EV7A 5CNAA 3J4UH 1OFNA 1R093 4FPYA 3J8F1 1COV2 3ZN4A 1YHFA 3ZYPA 4Z2WA 1ZRCA 4UW5A 2WZR2 2IFWA 4OLLA 4I3PA 3WUCA 1ULFA 5DDJ2 4PIZA 4YM0A 1QXJA 5AFBA 4F83A 4BOWA 1XNKA 1W6OA 3FZ3A 5BXXA 4CDWC 1WD4A 4X8NA 4AYUA 4HVRA 5EYXA 2BUKA 1Y43B 1LOAA 1VAVA 4AEDC 3PVOA 3BALA 3NKTA 1KJRA 3WDWA 3H50A 5GZFA 1Q8OA 1QGLA 3PLQA 3T1LA 1NCRA 1RVF2 1NQDA 2QFEA 5CG8A 1LOGA 5D8AB 4JGZA 3TNPB 3IKWA 1VAMA 4GWNA 4OHZA 2FBEA 1G7YA 4CEYB 2JX9A 1VBD2 5GJ6A 1QJU1 4Q4V2 4FPFA 3KMHA 2JICA 3VZOA 3LAGA 1VBB1 3PNAA 4OI4A 1BQPA 1LHWA 1CVNA 4MH0E 4HKWA 2RHPA 4KQ7A 1FI2A 4QQPA 1NA1C 2NP0A 4A7YA 5IK4A 5K8SA 3ELNA 2XJVA 4FAHA 2WSVA 1DLLA 4J6GA 4WZCA 2JDZA 3M3IA 5I8TA 3GHNA 3HBZA 4P9LA 5E88A 1FOD1 1BZWA 4QM9A 1NXD1 3ENRA 4XTMA 1BJQA 4CTEA 3WHUA 4Q4X1 1O7FA 3RI9A 4BH9A 1V9U2 4Y22A 2P37A 5C8CB 4XW3A 4SLIA 4OI1A 2A6VA 3I59A 5BNOA 2BVBA 3NW4A 4F3JA 4YW5A 5CA6A 4YW4A 3C2UA 4AXOA 1N47A 3ZIXA 1WCKA 1VIWB 1OI6A 3SXWA 1M06G 1Z7S2 4IV1A 1N1TA 1SLCA 5J98B 3RRDA 4R52A 1H8VA 1RUI3 1O3SA 3RJ2X 3QACA 1DYKA 1QQP2 1SFYA 2DURA 3LWCA 4XJZA 4Q4Y3 3SCFA 3WDUA 1DQ2A 2WNUA 2ZMKA 1A78A 2SLIA 3AMHA 5I0UA 3EHKA 3VBRB 3VDDC 2Q4SA 2FZ1A 4WVZA 4Q4W1 2WINB 2E9QA 1WUVA 2RS51 2YROA 2HEVF 3PVNA 2A75A 2F6BA 1W6OB 4R4ZA 2ZOEB 3WZ1A 2ZPXA 1RUF1 5DZEA 4XHBA 1F31A 2HWF3 3KCCA 4G9SB 3RWNA 3ZFEC 4RQPC 3CJIA 4DB5A 1BEV1 1NOVA 1SLLA 1KQRA 2Q30A 3KD4A 5JZGA 2PHXA 4UXAA 2DU1A 1FX5A 1NCRB 2Z5WA 3M3OA 1OQEA 3LB9A 4MUVA 4HVOA 4NHLA 1MVEA