4OUUB

Anti-mt1-mmp monoclonal antibody
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
217
structure length
210
Chain Sequence
EVKLVESGGGLVKPGGSLKLSCAASGFIFSNYAMSWVRQTPEKRLEWVATISGGGRNIYSLDSVKGRFTFFRDNARNTLYLQMSSLRSEDTAMYFCSRENYGSSFTYWGQGTLVTVSSAKTTPPSVYPLAPSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords anti_MT1-MMP Heavy chain
publication title Inhibition mechanism of membrane metalloprotease by an exosite-swiveling conformational antibody.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase
total genus 43
structure length 210
sequence length 217
chains with identical sequence H
ec nomenclature
pdb deposition date 2014-02-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ouuB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ouuB01
2AJUH 2EE9A 1UENA 3HUJF 5ANMB 3V79C 3OKLB 1KJVA 4OAWA 1CDIA 3DO3A 5MEOA 2ZSVB 3HNSL 4KDVA 4X5LA 2ZG2A 2C3WA 3IJSA 3X11A 4OKVB 1QFOA 3GSVB 5FEBA 5H35B 1ZSDB 5C2BL 4G43B 5FECA 4Q9RH 4XWGH 3E2HC 1FYTA 2DWDB 3OJDB 3VFVA 1XIWB 3QXUA 3V4UH 5KSBB 3R06B 2IAMA 3STBA 1RULH 4OLVL 2FGZA 1MOEA 5GSVB 3C2AL 2ADIB 3UBXG 4J8RB 3C8HA 2HP4A 2Z4QB 5IK3B 4KI5C 5T3ZE 2D2OA 3UTSD 2NY5H 4MB4A 3TZVC 4MA3A 3RU8L 5EU6A 4ZSOB 3WIIH 3LZFL 3K3QA 3MMEB 4RAVA 3GSWB 4I13B 4PGBA 1SJEA 1CFVH 4KAQL 3KPOB 3GSNA 5FHBH 1EUTA 2X4OB 1CBVH 1INQB 5HDLA 2FX9L 1OAYL 4EBQL 4CW1B 2Z31D 5DD0H 3GMOB 2VQ1B 2HLAA 3MV8A 4HEME 3TBSB 3KPPA 1FZJA 1Z5LB 1MUJB 1AR1D 5IMKB 1YEDA 5C0FA 5FO9A 4D9LH 4OD1L 2PTTB 1G6VK 5DR5H 4WEBL 2MPAH 3VXNA 4XMKH 1HEZB 3N85H 5GXBB 3E0GA 3HCVA 4D9QE 2G60H 1BOGA 1Q9LB 4LMQE 3U7WL 3KPQA 1S7XA 3WFCL 1Y0LA 4JFDD 3DGCR 4LLMA 4U7KA 2CLVA 1YNKH 3BFOA 4HBQA 1FL5A 4N1HB 1IKFH 1BD2E 1LD9B 3MV7D 3RTQB 3WDJA 1MCOH 1QRKA 1F6LL 1JNLL 2GJZA 1WK0A 3D3VE 3OV6A 2O26U 3JWDL 3NIFF 4MJ6A 3MLWH 4H20L 4NO0D 5I8OL 5A2LH 5IGXH 2AXGA 3SE8H 4QRPD 2R1XB 5DYOA 1BBJA 1H3XA 3GBLA 4P5TB 1DP0A 2NR6C 3KYMB 4M1GH 1A9EA 4LCWE 1KV3A 4Y19A 5DJYA 1EA9C 5DLML 3A67L 5FFLA 3GSXB 4GMTH 1JF5A 2F5AL 1HKFA 1MJ8L 1NC4A 5TE4L 1YEEL 4ZS7L 4ZPVA 4PJ5D 2OI9B 5I8CB 2QSCL 1AD9B 4YWGH 2YD3A 1QTYT 2GK0B 2P5EE 4M1DL 4YQXL 4FS0A 4ZUWA 1ZLUH 4Q97A 1OARL 3RVTD 4G8EB 1LGVA 2DQCH 5CEYA 1AGEB 3W39B 2AXJA 1OM3H 3WO3B 1HSAA 2JIXD 4J4PA 3QJHB 2OS7A 3LH2H 1Z9SA 3H8NA 2EDQA 3P9LA 4EI5A 3EO0B 4G8GD 5CS7A 2P45B 2OXHA 1JK8A 4CDGC 1S7RA 5F8QC 5SWSD 5F6HJ 4NGHH 4BYHA 1E6OL 1Q9WA 4LEXL 3RDTD 1YY9C 3DV4A 4L9DA 1CFBA 3TNNB 4OLXL 1FLRL 2A9NL 3W2DL 2X9XA 4F9PC 3KDMA 1ACYL 3TIEA 2YPLB 5DEFB 1DLHA 1A1NA 1QFHA 4GMSL 4LLUB 5EN2A 1A2YA 4HJGB 1XT5A 4MNGB 4JR9L 1ZMYA 3EJYD 3BPNB 2DBLL 3DSFH 4O5LH 5DRNA 4QRUB 1HHHB 2NXYC 1VEPA 1G9NH 1JF1A 4JREC 1RI8A 5JW4Q 5GPRA 1J1OH 2IAMC 3PHOA 1QOKA 1CE1L 1ZT4B 3VJ6B 4TUKL 2BJMH 5MERB 3R8QA 4JO1L 2EIZA 1I1AB 5H8DA 1F02I 1A64A 4LAQL 5DD1H 3V5DA 4M7LL 2J4WL 3FQWB 4L3CA 3FFDB 5C3TA 1CGVA 1YEKH 4I0PA 4WFFD 1PZUB 3QB7C 4LOUC 2ITCA 4J3TA 1HHJA 2X2YA 4PJCA 1RK0A 1NQBA 4YC2B 3RWHB 5GGUA 1IGJA 1MHPH 3WJLA 5EZOL 5AAMA 3RVVD 1EEYB 2OP4H 1T5XB 4YXLH 3VFNA 3MGOA 5D2LB 1E4WH 3MRRB 4JQIL 4Y4HD 3JSSA 1LO0H 4QHUA 1GCFA 4LSSH 1I9JL 4G9FB 1QBMH 1SEQH 3U1SL 5BVJB 1F4XH 3IS0X 3CFDB 3C08L 1JGDA 1JPTL 2D7NA 3TBWB 1NGXB 1RJYA 2VLJA 4X4XB 4DN4L 1LP9B 3V5HA 5HXMA 5J13B 1JI1A 3HI5H 4MDIB 2JELL 5C08D 4FQ1L 1GAFH 5DFTA 2P8LA 2HT4C 2DJUA 3HE6D 3ZE1F 3IRPX 3ULVL 3ZDZE 1KLGB 3T0AA 3GHBL 1FGNH 1ZT7A 3DXAE 3STZA 4HKJB 4KPHH 1PZ5B 5HVHB 3VE0A 5DHXB 3SDDB 5C86A 3AM8A 5C0RH 2F54A 2OL3B 1ZVSB 4LDLB 1DN0A 3GJFK 3DROB 3GJFA 1KGCD 4M6ML 3PWLA 3M17B 3SJVD 1YECH 1FL6A 4M5ZL 4C56E 1OSPH 2CGRH 3FMGH 2QKIB 1QRNE 5D7KD 3SY0A 3K2UL 5E2TH 1WWBX 3QIUB 4TVPE 4EI5C 1YMMA 3DVFA 4JFYA 3V6OE 2E7LA 2JK5A 4JFEE 4TULH 1AKJD 4YDLC 1LVEA 1EAPA 1WJ3A 3LKSA 5DA0B 1JCKA 4GBXD 4JVPA 1J8HB 5MENB 2CK2A 2DQJL 4NNYA 4ZS6C 1ZGLM 2MOVA 1NKRA 5SWZB 5DUBA 1ED3A 4U1GC 4HC1H 1I8LA 2KQMA 5A16B 3LY6A 2WW8A 4V2BA 2P5WB 1NANI 5CKAA 1BFVL 3UP1A 2BOBB 5D96C 1QO3B 2EXWC 2W0FA 3GFUA 4TSCL 5FIEA 3S5LB 4NSKA 5EO0B 2E8YA 1RZKC 2XKSA 5GHWL 4KGLA 4CKVX 1XF3A 2GAZB 5KTEL 1J7VR 1IRAY 1VEOA 4KGJA 4LASH 1EGJH 4TUOB 1Z9OA 3HAEG 4OCYH 2QHRL 4R8WH 1MHEA 1EJOL 1HILA 3BH8A 5HHME 5E6ID 4IOSD 3VXPA 1EBPA 3QEHB 4WFHE 4WDIB 5CP7A 2HJKB 3QUXD 4MXVE 3RWFA 1PW3A 1UB5A 4ACPA 2WZPD 1AGCA 3B6SB 3VXSE 4OGAC 3KPLA 4YXKL 3SDXA 3MRNA 4XNUL 1WF5A 4H1LB 2HWZL 2ED8A 4QXTB 4J3XA 5IB3B 5F96H 1U8KB 5ISZA 1BFOA 3G6DL 5I1HH 3GKWH 4FFVC 3WJLC 2YUVA 3UJJL 3MJ8B 4LKXB 3ZKXC 3QDMB 2DJ4A 4LLQA 5I6XC 1FO0L 5KS9B 1MFBH 3CU1A 3VD9A 1RZFL 1A6AB 1AGBB 3H3PH 3LSOA 3OMZA 3KYOB 3KG5A 3HUJE 4RCAA 2JE8A 4HQQL 4CRPA 4ODVH 4ZUUB 1TVHB 1BBDH 1UM5H 1F2QA 3EO1B 5J11B 1F58L 2V7HB 2X6MA 1DQML 4NRXA 5IIEB 1FNEB 4FFZH 1N5YL 4WO4A 2ZUQC 2P7TA 5EOQL 1I8IA 1WFTA 5JQ6H 2BFVH 2ICWA 4TNVK 5DRZA 4NZRL 2YEZA 3OJVC 5F72S 2QQKL 4WFGE 3K8KA 4FQXC 3T04D 3ES6A 4RRPG 4TRPH 5D1QB 4PY8I 1K6QH 2WWMD 3E3QE 4GRWF 2NX5D 3O4OB 4PYHA 4XP9H 3P11H 5ACZA 4X9BA 1LE5B 1A9BA 3MUHL 1FG2A 3ZL4L 2A6IB 5EDXA 3KWWA 4GRMB 3FT3A 3DRTB 4PIRF 3A6OA 5CUSL 2XG5A 3QFDA 5JW4R 3K81A 4R4BB 2X10A 4JM2D 1BIIA 3KJ4C 5LGJA 1LE9A 1H0DB 1LEGA 1KJ2A 1XCQB 4N0CC 2MKLC 5JXEA 5IT2L 4P23D 4APQC 2PNDA 3HMXA 1RY7B 3UBXA 3SKJH 3EBAA 1G9MH 4PRPE 2WNGA 1E28B 4HZLA 4NQDB 4KMTL 4QTIH 1OT1A 1RHFA 1NLDL 1A7QL 5IHUH 3VXRE 3S5LG 2XYCA 3N0PB 4ELMB 1M7IB 4Q0XL 2BNUB 3NZ8B 3S37L 4KFZC 1TITA 5GZOD 1YPZB 2VR5A 5FYKH 2R9HC 5IWLA 3O4LB 1MVUA 4MAYA 4H0IA 1YEIL 1QR1B 3D3VA 1MI5B 4X9HA 4PS4L 5ERWA 1I7TA 3ROLA 5HGHA 5IQ9B 4ZFFA 3I9GL 5E5MA 4ODXB 2I5YL 4GAYA 1JJUA 4FTVE 2A6DB 3MFFB 3N06B 3EIFA 1FSKC 4XVTL 4XH2A 5HHVH 3QXVA 4M48L 4OCXL 5DVNA 3B9EA 3MBEB 2VZTA 5DJCB 5ID0B 2FNBA 2FEDC 2Q7YA 4LSRH 3BZDA 4NQXA 3ARVA 1CYGA 2DD8H 1J10A 3HI1A 1MWAA 4JO2L 3X3GH 4M4PA 2ESVE 4YDVB 4HS3B 1FIGH 2X4UB 1RHHA 3WS3A 3EGSA 1NGWA 2IPUG 4MNHB 3QUZD 5FA3B 1FFRA 4OZ4A 4NOFA 5C0GB 4JN2A 4OLUL 2NY4D 1HINH 4Q7DA 3NFNB 5C6TH 4IRJD 2NY3C 1EXUB 1CZ8H 3ARDB 3F7PC 5C0AE 2HVJA 5IMMB 3LKOA 4E41B 4JHAL 2F58H 4NUGH 5F1NA 3TJEH 3T0ED 3LRGA 4H25A 4WO4C 5F7HA 4I9WE 3TA3D 1MCPL 1Q1JL 1NUDA 2I60L 5T5FL 1B6DA 1ZTXL 2NCMA 5C6WH 3KPSB 5IB1A 4M6OH 1MRFH 3NOIA 2OK0H 4GRLA 4F7TA 2ZKHH 2AS5M 4K94H 4CNIB 4XAWH 2VABB 4ODHL 5CJQH 1AQKL 4KTDH 1UXSA 3JUYA 3IU4H 2PYEB 1P4IH 3RA7H 3AC0A 3EYFA 4OCWH 5FB8B 4MS8D 3FO2B 5DK3A 4BFGA 2E7BA 5DMKB 3O2WH 4UDUA 5EU4B 5L0QC 4EUPB 4HUMB 2G9HA 5EOTB 1NEZA 1PX4A 2E3VA 4Y5VB 5JPNB 2AV1B 1MAKA 4MLIA 1NCWH 4DUXA 2EYTA 5DJZA 3BGMB 5B8CB 4AM0B 4DKAA 4WFED 4LLAA 4QY8B 4Y2DD 1OPGL 3UTQB 4O00A 1T80A 3T4AB 1IM3B 3INUH 1KIQA 3QEUA 4PV8B 5CEZH 1NGYB 1DCLA 4IRZL 4F3FB 1A7PH 2OQJB 4Z95L 5CZXC 4JY6B 3WXWH 1BFSA 3HC0B 5LGHH 1KG0A 1HH9B 3I2CL 3BZEB 5SX4H 3CXDH 2NNAA 4MCYA 4U33A 4J6RL 4U1SA 5ETUA 1DBAH 5IMOA 3VW3L 3CVIL 4XI5D 1F97A 3WV0A 1HHIA 1Y6KR 1CE6B 2EXYC 3BPLC 3FOMB 5IOPA 2HLFC 3VXUE 4JKKA 4L4TD 1CXFA 4YX2L 1A14H 1VADB 5DJXB 1VACA 1FFNA 4FP8L 4E9LA 3NACH 4MAYC 5EWIL 2DBJA 2X9YA 4U1KB 3C5JB 2HFFA 4N90D 4PJHF 3WS6C 1H3WM 4QCIB 4YNYB 3ZE1E 5F7DB 2AJZB 2H2PD 2B7DT 2A83A 5D2NE 2AABH 5DC0A 5K59F 1MREL 2BK8A 1CXHA 3LQAL 4ZNEE 3DXAA 1JBJA 2WQ8A 3X3FH 1F8TH 3EUUA 1KT2B 2HTLC 4BSJA 3QCUL 4M9OA 1LNUB 2X9WA 2APFA 4DGIL 3QFJE 1GZPB 2GCYA 3MR9B 1CL7L 3KLSA 2OSLB 3M8OL 1ES0B 4PP1C 3OAYK 2MMXA 1F11B 1S8DA 1ZHNA 3BP4A 1S7QA 2JCCB 3IVKB 5D70L 4LRIA 2G5BA 4LSPH 1QRNA 1OF2A 5HHNA 3V7AG 1RUPL 4O2EB 4XVSL 2KPNA 4K9EH 3D0VA 1I9RH 2J5LB 1TVBA 4PTUB 3P77B 4XCCH 1NMCC 4OV5A 1F2XK 1IAOB 3GK8L 3GMNB 4I3SH 1C7SA 1NJ9A 5CMAB 2AJYL 4KH2A 4Z9KB 5GJSH 5JIKA 3RY6A 4JFEA 4L4VE 4CMMA 5HD8C 4HPOH 2Y07H 2RAMA 2DQDL 4MAUH 3UPCA 1T1ZB 4Z7VB 3RKPA 3LD8C 1K4DA 1P1ZA 2LAAA 2NY6B 5GS0C 5C7XL 4LGSB 4YHZL 3KPRB 2UWEB 5J89A 4G6AD 2YD9A 3DWTA 5LQBL 5DD6B 5DJDB 4LSUL 1HHKB 3QIWA 3OF6A 3DUUA 3ULSB 2YXMA 4TQEH 5TE6L 3E8UL 4HIIB 1FNLA 5D7LD 3U9UA 2N7AA 4NO3A 2XACC 3ZE0F 1CGTA 4J3OC 5AAWA 2XWBA 4XZUA 2HAZA 1X5GA 3I6GA 3JWOL 4JRYA 4M7JH 2I9TA 4N8VA 4IOIB 4QXGL 4XNQA 2LTQB 3DMMB 3K80A 2ID5A 5DK2A 3TN0D 1I7ZA 4DOHE 3SDCB 3MV9E 2YPVL 5C09E 1XIWC 4XX1G 1AO7B 4YAQB 2VZ3A 2W92A 2WINB 1TLKA 3AS1A 4O58H 4PP2B 3V52L 1CFTB 2BCKB 3VDCA 2GUOB 3RNKB 3HPJB 3BP7A 5FYJL 2X1WL 1JGUL 3VXSA 1NC2B 2EDDA 1FORH 2Y5TB 3GM0A 1BJ1H 3D1MC 5BO1H 4YHOL 3A6BH 5I19L 5FYKD 4DZBA 3FT2B 4UIKH 4KK9C 1C5CL 3NA9H 1IGYB 3TWCH 4KQ4L 3HAEA 1J11A 1EFXB 4LSVH 2C4FU 1Z6JT 1U36A 1LO5B 3MJ6A 5KVDH 4R96B 1T21A 2BNQB 5IKCB 1C08B 3HUJA 3NCEB 4LPYA 2K7PA 5IVZB 3S88H 5IVXE 4UOW1 3D2UD 3GSUB 4X98A 1S78C 2AJUL 3L3HA 5HYSA 5DS8B 4M00A 3S96A 3JV0A 4P2QD 4JQXA 1W72B 2KUTA 1E4JA 4JFQB 5E8EB 4HF5L 1IGFH 4R2GC 4PRHE 3T1FB 3BVNA 3RTQC 5LXGL 3EOBB 3U46B 3MROB 4Q9RL 3G5YB 4XWGL 5DMYA 2YA1A 3AUVA 3GJFH 4GRWE 3V4UL 3MRMB 3QWRA 4PJFF 2XWTB 3QUYB 4DGYH 2NXZD 4N8PA 2NY5L 1JNNH 1DLFH 3BN9D 1DVFD 3UYRH 3WIIL 3QEQE 1TPXC 2X89A 4DEPB 4NN7B 3DPBA 1I8KB 3DECA 1CFVL 5C0BE 2ZCHH 4NQVA 5INCA 1CBVL 5GGTH 1EHNA 1NAMA 1TTGA 3VXQB 2Y5EA 2GFBB 3W9DB 5BXFA 5DD0L 2N4IA 4LF3B 3IB4A 1NDMA 4LHUG 1OB1A 4RRPA 3P30H 2UVEA 1X5FA 4M02A 2CUIA 4XCYB 2PW2A 3ULVF 4PG9A 5C0CE 2BDNH 2Y9RT 4G6MH 4D9LL 1AGDA 4C54A 4KV5F 1F3DH 5DR5L 2MPAL 3FO1B 4ZO6A 4XMLL 4XMKL 5CSBA 1T0NB 3RVXC 3VXRA 3N85L 1A1OA 5DK0B 4U1JB 2XWJB 1K8DB 2DQFB 2XG4A 3BDYH 5IV2A 1U8PB 1YNKL 4QOKE 1T0PB 4YEFA 5J9PA 2J8UB 2KDGA 3IFPA 4PRBA 3VMPA 1UZ8B 5K9KA 1MCOL 2EDRA 1RV6X 2DQEL 4GG6F 3E1F1 1MJJA 5D5MB 4F2MA 1PAMA 3RGVB 4HIJB 2HTKC 5HDOA 1VGEH 3SE8L 5CBAB 1MCWW 1QYGL 1SYSA 4PB9H 3QDAA 4LVEA 1Q9KA 2AK1H 4M1GL 5CEZD 1FVCB 4H5SA 4AEHH 1JV5B 4LCCA 1LHZA 5FOBB 4JDVB 1N59B 4JKWA 3G08B 4AENB 1KTKE 3RWJB 4HWBH 3DYMA 4F9LC 3DX6B 1I1AC 4S1DD 3IDIB 4I48A 4PR5A 4DGVH 4HAGA 1DUYB 2ESVA 1UB6A 1FZOB 3MRDB 3P9WB 5F1OB 3WUWA 4RIRB 1JPGB 1PSKH 2DQCL 2O5YH 3GRWA 2ARJB 2HJFB 3IKCB 1OM3L 9CGTA 2VZVA 7CGTA 3EFFA 3FTGB 1HQRB 5DT1H 5IF0A 3MACH 1TJIL 4YR6B 4YC2C 4G7YH 1B0RA 1KPUA 5JDSA 3IDUA 4LVOB 4JZJA 1BGXH 4OD2B 4R3SA 3W9EA 5C8JA 5TF1H 3K46A 5F6IC 3IKKA 3P0YH 5E5UB 1WC7A 4M6AA 4W6YB 4FZEH 3DX7B 1MCHA 1I7RA 2N1KA 4JQXC 3LN5A 4IIQA 5EH1A 1KCKA 2BNRA 3S37X 5DVLA 5KSVA 3DSFL 3HC4L 4O5LL 5F7UA 4NKDB 5F9DC 3ULUC 2DMBA 1J0KA 3MFGB 1G9NL 4PJ9D 1LWRA 5J13C 1B2WH 2VIRB 3ME0A 4I77H 3B9KA 4WI4A 4RFNB 2MKWA 4ZPTA 1CD0A 3BPOC 3IFLL 2DF3A 3H9YA 1JZ3A 3KR3H 3IRZA 4NZJA 2BJML 3BRFA 1NUGA 4Z7NF 2J88H 2FL5B 1N7ML 2XY2A 4KJYA 5DD1L 4N0YH 3SDDC 2QEJA 1YEKL 2C3GA 1ONQB 1XGUB 1CFNB 1FNFA 2PR4L 2HKHH 1RZGA 1R6VA 4OZHE 2NY2B 3AGVA 2CKBH 3B2UC 3O9WA 1MHPL 5D93C 5T1LA 3SKOB 2VLRB 2OP4L 5DJ6A 4YXLL 4YJZL 3B9VA 1E4WL 3QH3A 3QIUC 1IAIM 3VXOB 3RHWF 1IEAA 1LO0L 1DEEA 4LSSL 4AG4H 3H9ZA 2QR0B 1F4XL 4X9FA 3MRPB 5CEXB 1CXLA 5D6DA 3SGEI 3SQBA 2ICWJ 3QZWG 1YQVH 3HI6H 3RGHA 3HRZA 4OZGB 4MNQA 4FG6D 3U30C 4M4RA 4OI9A 3QDJE 3S36H 3FQNA 4RGMB 1GAFL 5K59E 5TGBB 1W72L 1A5FH 3PWNB 2BMKA 4MHHG 5D2NA 5L88H 3SGDI 2FX8H 4KUCF 1R3KB 4NO5A 4ZNEA 3BEWA 3LMJH 2AQ2A 3EHBC 5BJTB 3UJIH 5F7EH 4BFIB 1FGNL 1G6RB 4Z5RA 3RZCD 2PO6D 4WWKA 1ZHBB 2UUDK 1KTDA 1KN4H 3DO7B 2XI9A 3FOLB 3ZTJH 3VWKB 4PJDE 2LV4A 2WQRA 2NY0C 2YZ8A 5KBNC 4P46D 3HRPA 1AH1A 1VFAB 5D9SB 1GOFA 3OB0H 2ZG3A 4A6YH 4Z7UE 3X14B 4ZAKB 5F9JB 4XPTH 3D25B 1HWHB 3GGWA 4ORZC 3DRQB 1KENL 5C07B 5CILH 4U6TA 4NZUH 5T3XH 1OSPL 2CGRL 3FMGL 2MHAA 3H9SE 4P3CH 5E2TL 2IFFH 2WBJA 4XXDB 2XPGA 3VGEA 3WNKA 4QRQB 4N5EC 4PJ8D 1MELA 3RIFK 1T5WB 4KRPB 5DHVB 4LVHC 4TULL 3T3PF 3T77B 5E70A 5J3HC 4EJ1C 3FB8B 2W9DH 5KZCD 3AXLA 1D5IH 4YDIH 4HUUA 4OLYH 2GW5A 3S4SG 3REWB 1CL7I 1I3GH 4HMEA 5EUOB 4PGEA 5IUSA 2F53D 4X99B 2EYRA 1OOAA 3WDIA 5J11C 4IIQC 4HC1L 4XVJL 1E4XH 1I4FA 3U0TA 2IF7A 4G6JH 2AI0H 4NFDA 3QPQD 5CP3A 2P24B 2V7NA 2JJUA 4PREB 4CN1A 2ZUTA 2RB8A 1D9KA 3LIZH 3D39B 1PKOA 1TZIA 5I73B 3MV9A 3BEVB 4Y1AD 4XP1H 5C09A 4LASL 1EGJL 2JTDA 1ZS8B 4OCYL 5D1QC 2EKSB 4R8WL 2IH3B 1QP1A 1JGEB 3LN4A 3ROOA 2MQ3A 1HXMB 3IDYC 5GZNC 1SJVA 1F42A 4WW1A 1T6WA 3VGAB 2ZUUA 5GSRB 5I71C 5DDHA 1IC4H 3L9RB 4M43H 3RWGB 2P1YA 4Y4FA 5ESQB 2YA2A 4NYLB 2E9WA 3DJ9A 1DANT 2X42A 1CK0H 5D1XD 1IFHL 1X4YA 4NNXB 5F96L 1XMWA 1U95A 2FHBA 4Z7WF 5I1HL 2VLKD 3GKWL 4R0LA 3TO4A 4GW1A 1TTUA 1HDMA 3VDBA 1WCQA 1WFOA 3UTTB 3A0OA 3Q6GH 4L8SB 5IBUB 3RWDA 3RX8A 2DLTA 3CZFA 5DRXA 3MLTA 1VGKA 3UTZA 5E00B 3VFRA 3QO1B 1UM5L 3ARFA 4BM7A 5MEPA 4ZDHA 1ZLSH 2BC4B 3HG1E 1FAIH 1AQDB 1EPFA 3BZ4B 5FK9A 4ENED 4PJ7B 2CDEA 5JIHA 4XC1H 1BX2A 5EBLB 3BIKB 3TPUA 1C5DA 1EEUA 1KXQE 3B5HA 3P0GB 4Z77A 3K2MC 4L1HA 4PJFE 4PB0H 2RFXB 1K6QL 5KSAD 3E6FB 1ZLWK 2XN9E 3QEGH 1G7HB 1U92A 3S35L 4RZCB 3C8KB 5HPMA 1QSFB 5ENWA 1YJDC 3P11L 1DUZB 4NQSA 4NRYA 1WSST 2CLZA 3QEQA 1U0QA 1WCBB 2QTEA 3FO9B 1R3JB 4L8CA 5ANME 3MBEC 5F3HA 2IQ9H 1KBGH 1RD6A 4X5XA 4U1IA 1S7UA 1QEWA 3ULVE 2VE6A 5GISH 4BZ1H 4YPGA 3QSKB 2V5YA 2X4RA 3D18B 4NBYB 5C0CA 2AV7B 3SKJL 4DN3H 4YFEA 1G9ML 1U91B 2K7QA 4CL7A 5KSBE 2X4PA 3RWCA 4U3HA 5GGVY 5A43C 1GIGH 1RZ8B 4MX7B 5EFIB 5IHUL 3UXFA 2ZCKH 4B50A 1IMHC 1A4JB 1AGFA 3QCTL 5C0JB 1XF2B 4QNPF 4QOKA 2W0KA 4LHUA 4LVNC 3C5ZB 3ZTNH 2C3VB 4A2MA 3BP5A 3ARGA 1UJ3A 2CIIB 2KH2B 4JZNB 4EN3C 1BECA 4EDWH 2BXYA 3R4DA 4H26A 1D9KC 2R0ZH 1T03H 1J5OH 4RGNC 2SEBA 3TF7C 5DJ2A 1JHTB 4BH8B 5KJRH 2CKNA 2BSTB 4P2RB 1BD2D 4X7EC 1KIRA 1P5UA 5DD3L 4L9LA 5HI5C 5HHVL 5CGYD 3T09A 3F5WB 4G8FA 2VDNL 5K9QI 4FQHB 3LPFA 5HDBF 1G6RL 1T3FA 1AE6H 3KS0H 2J8OA 3F8UB 4LSRL 2FX7H 2DQIL 4WUUB 1SY6L 1BIHA 2DD8L 3SCMD 3MRCB 4AH2B 4JRXD 4Y5VC 5EIVA 4LCWD 1KPRA 4HZAA 4EVNB 5B8CC 1FIGL 2HT3C 4HUKB 4WV1A 1CU4H 4F7EB 3DETC 3SDAB 3K1DA 1KB5H 1XR8A 2IBZY 2ATPA 1R3LA 5FM5O 1CQYA 1M71B 4K7PH 4PTTA 3QUKA 2P5ED 4YGAB 5ADPL 5J12B 1DQLH 4S1RH 2ZG1A 1HINL 3PIQB 3RUGB 4P49A 2V2XA 1XGPA 4C83B 4TSAL 1A0QH 1CZ8L 1W0WA 7FABH 4D8PA 4RFOH 4X7SL 1YYLL 5BRZA 4ZXBB 2F58L 4HJ0C 3TJEL 3NCBB 5L2JA 2FZ3A 3IJYA 5EBWB 2EH7L 4LRNH 4YFLI 3MRHB 4Z0XB 4YGVA 5TF0A 5FUZH 3S9DB 3OR6B 2R0KH 3QQ4A 1MRFL 4PRNA 1AC6A 3L3GB 4PRAB 2OK0L 3GMQB 2ZKHL 3VXMB 5AYUH 1F00I 4K94L 5HI3D 2APVA 3K74B 4HUNB 4XAWL 2NY1C 5T3XD 4KTDL 3HE7B 3IU4L 3U0PB 1P4IL 4Z7NE 1L9NA 1TCMA 2C1OA 5D7IF 1ZA3B 2BY1A 3RA7L 4OCWL 4XC3H 5L9DH 2H32B 3CPLA 1OGAB 3MUGA 3O2WL 3MRGB 2OR9L 4MJ5B 3ILQD 5IM7B 3C6LA 1NCWL 4LBEA 3PHSA 1QLFA 2WWKO 5FOJA 4ZFZA 2FR4A 4JPVH 2WUCH 4KXZI 5CSZA 1ERNA 5FO8B 1HKLH 3G6JB 1I75A 3INUL 5CWSA 5CEZL 1FBIH 3MNZB 3QI9D 2DI9A 4UU9B 3WXWL 5INDB 5LGHL 2HKFL 3IU3B 4L3ED 4TPRH 3TVMA 1CDJA 1T66D 2J5LC 4AEIH 4DK6A 4FZ8H 1VENA 1JRHH 1HXYA 1FZMA 3LDBC 5HGAB 3HZMB 5J6GB 3FB7A 4HUXB 4XBPB 5I1AA 2NTFB 5L8JB 5GIRA 3CFCH 1UT9A 3KYNA 1JPST 4PJHA 4WVRA 1A14L 3BH9B 3Q5YA 4OZIF 3UAJC 4IHOA 4R4NC 3NACL 5C70A 3QDJA 4P9HC 5I18H 1JWSA 4NJAH 4XRCA 3FFCA 2CR3A 2R4SH 2I25N 1RJZB 5AZ2H 2PW1A 1MFAH 1ZOXA 2AABL 3P4OA 4UQ2A 5EG6C 1WEJH 2O5XH 3MLZH 2EYSA 2A73A 4X5WB 2AXFA 4HT1L 2GY7B 1EV2E 2LTQC 1FLTX 3AREA 5F1SA 3D0LA 4QHNB 3X3FL 4L9LC 4S0SD 1VSCA 3ARBB 3FAXA 3CFEA 4CBPA 3GDBA 4JG0L 3QZWA 5I76B 5IW3A 3UZEA 3T2PA 3F62A 4XP6H 4CADA 1NMBL 1IM9B 3FB5A 5GGRB 4JFOA 2XTJE 5F8RC 5B38G 5HYQA 1WAAF 1RZIA 3VG9B 2X4NA 3SN6N 3H9SA 1CG9B 4LSPL 1OP3H 4AIXA 1U8NB 2V2WA 4O2FB 4WENB 4WV1C 5KN5B 5EULV 3MZGB 4K9EL 1I9RL 1W0VA 4P2OD 4I3SL 2A0LC 5GJSL 2HA1A 3U9PL 4K3EH 1U8OB 1MCBA 4HPOL 3WNPA 4MAUL 1KTRL 4DVRH 3ILPB 1ZGLB 4JCMA 4C56D 1KEGL 5F89B 1NCTA 5GS1A 2ZOKA 5ESVB 3RL2B 3FQUA 3NN8A 4Y4KA 1HYRC 4TQEL 4HAFA 2DKUA 3G5ZB 2P8MA 1NFIA 4N5UA 5DZNA 1IKNA 5ITBH 4YFLF 1F90H 3UTSE 3FQRA 4MYWB 3HNVH 3DURB 3IXAA 4M7JL 3DVNB 2PXYB 4V1DD 2YUWA 1W0YT 4RNRA 1OAUH 3PWUB 3U4EA 3QQ9D 4MQXC 4NBXB 3I75A 4JG1H 5GRJH 1CICB 5FDWA 3S4SA 3KLDA 3QIWD 4PJAB 4KK6D 3BO8B 3AY4C 4WNQB 1BZ7B 1TNNA 4JM2F 4ISVB 4AIZA 5T1MB 3MNWB 4P0DA 2B0SH 3AAZB 5BV7C 4D3CH 2HN7B 3T8XB 5MENE 4H8WC 2CDGB 2YD5A 3I02A 4JLRA 4NN7C 1FORL 1KUMA 4JGMA 4ORGB 5BO1L 2BHYA 3A6BL 1Z2KA 2P5WE 3ZT7A 2CIKA 4UIKL 3SKMB 3NA9L 2R2HA 3U7YL 1PG7H 3TWCL 4N9OB 2AK4D 4WFHD 4JY4A 4FXKA 4XNZB 3QULB 1RUQH 1T2QH 4LSVL 5C0EB 3I6KB 2WIMA 3V6ZB 4JQVC 2YBRA 1J0JA 5B3NA 1QZ1A 1ZVYA 1XGQA 3ALXA 4HK0A 1Q94B 3S88L 2V5MA 3HR5A 3O3BB 4P4KA 3ZDXF 1MFDH 5E9DB 2MWCA 3HG1A 1NCUA 4B5EA 2E7MA 4GW5A 1VESA 2YUXA 3O8XA 3CUPA 1MAMH 2UUDH 4F15B 1I1YA 4AEFA 4P2CG 1WVZA 5HHOB 2WK2A 1PY4A 3BW9A 5JXAH 4PJFA 2FLRT 1R5VB 4PJ5E 3VWJB 1SJHA 4HKBA 1K8IB 1T4KB 4W4OA 5JTWA 1QA9B 4Y16D 3RGVC 3VRLF 1CT8A 5IQ7H 1INEH 4DGYL 1YUHB 3CVHB 3QDME 1QPPA 4CGTA 4QF1A 3GMMA 4BK5A 1DLFL 1KCLA 3UYRL 2IG2H 1UACH 1CGYA 2X7LB 4WFGD 1MF2H 5B4MD 4LAJH 4G8GE 5GGTL 4JFFD 5EC2A 4PLOB 4Z8FH 4HK3J 3GSVA 3QXDB 2OTUA 2GY5A 3EZ8A 3PJSB 1ZSDA 3S8WA 2CXGA 3P30L 4K8RC 4CN6A 1F4WH 1BQUA 3WCYA 4KROB 2F8OA 3G5XB 4Z78A 5KSBA 4YE4H 4RISH 4G5ZL 2GT9A 1JNHB 5E4EB 2YR3A 3WFDH 1N2RA 5J56B 4M6NH 3WEXA 5I1DA 4OF7A 3RY4A 4NDMB 3P4MB 4Y88A 5BS0B 3LS4H 5ALBL 4LVOC 2WLZA 5IROA 4LLDA 3QWOB 3TYFA 2M2DA 4JPWH 1NCCL 3F7YB 1FRGH 3BDYL 4DUWA 1FV1A 2B4CC 1INQA 1X4ZA 5HJ3A 4GG6A 4FQLH 4PRPD 5E99H 5JW5A 4U1MB 1G7QB 1DE4B 1NBZA 1IKNC 3KLHD 2DOCA 4G9DB 1WT5A 1KC5H 4HLZH 3PF2A 4TNWF 3BIAX 3E6HA 4OLWH 1Z5LA 3VCLB 1VGEL 5IMKA 3IAQA 4KZDH 3WHXB 4NJ9H 1C5BH 4PB9L 2C3HA 2AK1L 1ZE3C 4GS7B 3RWIB 5ICZB 2FJGB 4P3DA 1HEZA 4N0UB 1UYWH 5HDBE 4FFWD 4WRLA 5DD5H 2D03H 1KIUA 4HWBL 1S7SA 1VA9A 3MJ9H 3VH8B 3W82A 4ELME 2GJ6B 3WLBB 2FLBT 1DDHB 3NFSH 4GXUM 3RP1A 4FTVD 4BSVB 1DQJB 4DGVL 3O4LE 1FGVH 2AJXH 2XOTA 5LKNA 2O5YL 2IALB 1MY5A 4X6CF 1U3HB 1NDGB 4RA0C 5JOFA 1II4E 3GMPB 3WE6B 1ZANL 5DT1L 5ICYA 3QA3B 3BWUC 3MACL 1P7QA 4JE4B 1R0AH 2NY2C 4G7YL 5J1AB 5CD3A 1KJMB 4NHCH 1G7IA 3TH3T 4F57L 3BXNA 4LEOB 1BGXL 1JFQL 5FYJE 1OQXA 4KJWD 2ILLA 5IEHB 4I1NB 1U3ZA 3FONB 5TF1L 4KWUA 1J0YA 4M93B 3P0YL 1T1XA 4P4KC 5I8CA 5KANG 1U8HA 4FZEL 3IDJA 3U2SB 1KNOA 1M6OA 5BW7C 5HYJD 3O8XC 3WL9A 4P2YA 4F8QA 4I2XE 2A9MH 3Q6FB 4G8EA 3TZVD 3KLAA 4CVZB 3TBYB 2ERJB 1A6TA 1FO0A 3LV3A 3THML 3DGGA 1B2WL 5I30H 2VXQH 4I77L 4PV9A 1FJ1B 2EH8H 1JPFB 4TSBH 5C0AD 1EMTH 1I8MB 5BQ7B 1ORQA 4W4OC 3GZKA 1EO8H 4JDZB 3KR3L 1RZKH 3LKNA 4PBVC 3C60B 3SJVE 4I9WD 5EIIA 5F3BB 2O5ZH 2YA0A 4OTXL 1IAKB 2DJSA 4X6EA 1OVZA 3OKKA 4N0YL 4Z0BH 2GTZB 5L2KA 5IMLB 1S9YA 3ZE2F 3T65A 5IG7B 1R5IA 3B9KD 4X6DB 3RWEA 4ZAKC 5L8KB 4JZOB 1X5IA 2UYLA 2YKLH 3D85D 2NMSA 2HKHL 3EYOB 3IDNB 4IRSD 4EDXB 3KPNB 3PE9A 1IARB 5IB2A 3CX5K 1J1PL 3OKEA 4NQEB 3PGCB 5HHQA 2QQLH 1OL0A 2LAGB 2PYEE 5TQ2H 1JPSL 4AT6B 4ZQKB 5C1MB 4U31A 3MO1B 1HQ4A 3N1PC 2VDOH 4P99A 5AG8A 4AG4L 4KRPC 3NH7H 5IROC 3RX5A 4AQ1B 2GIYA 4XB8A 4LDOB 1N5AB 1YQVL 3HI6L 4NT6A 1SQ2N 3O9WD 4M1CC 3BI9X 4LU5H 3RKDC 3OG6B 3S36L 3VH8G 1UVQA 5A3IC 4K3GA 5DURB 4NUJB 2I26N 5IR1A 1G7PB 3VXUD 4DKDC 3LMJL 5D1ZB 5I75B 5F7EL 4QRSB 5HYIA 1WWAX 2HT2C 5I73C 4HWEH 1MLBA 1KN4L 3TFKC 2Z35A 2A1WH 3GIVB 2DYPA 2L7UA 4OFIA 4XTRC 2LFGA 4NPYB 1N26A 2AQ3A 1FCCA 1LK2B 4QRRB 2CRMA 4F33A 4OFVA 4WIQA 2HH0L 5I1EL 4LIQL 2IANA 5CILL 1JHKL 4NZUL 5T3XL 1CD9B 3FN0H 5DO2C 3HKFA 5E8NB 1V5JA 1T1WA 4H88H 5EBGA 3PNWA 1RUKH 2IFFL 4BSWA 2BZDA 4G42B 1VKXA 1A1MB 3ZDYE 3QFJD 3QIBB 1KLGA 1JP5A 4I0KA 1KB9K 3FKUS 2NW3A 3V6FA 2W9DL 1D5IL 4GKSB 4YDIL 4OLYL 2EO1A 3T0VA 1I3GL 5T1KB 3DROA 2YZ1A 2WBJD 5E1AB 1H5BB 4OGXH 3B5GA 1P7KB 5IFJA 3UTSA 1B4RA 1E4XL 3MRKB 2NX5E 4G6JL 2AI0L 4L4VD 2BSRB 3HNSH 3MRFB 2VDPL 3LQMA 1Z0MA 4WTXA 3LIZL 5DQJA 5C2BH 2GSIA 5DHYA 3WSQL 3EO9H 4L8DB 4XP1L 4J12A 4LOUD 4LPCA 2Z31A 1WUNT 3O6FD 1QSEB 3C2AH 1NCDH 3FZUD 1AD0A 1LEKB 2PTVA 4O4YH 1TJHL 5TE7H 5E0QA 4GG8A 4HGWA 4Z7VE 5AWNH 5MENA 1QUNA 4U6XA 3G5VA 4MZ2A 1K4CB 2WANA 1P53A 2UWEE 1X4XA 1T1YB 2ED7A 2YRZA 4M43L 4CU6A 4KAQH 4BZ2H 3LEVH 3O3DB 2AEQH 4Q2ZB 5DC9B 2ZOLB 5JNYB 3MV9D 1LO4L 1CK0L 4Z7WA 1OD9A 5C09D 4RMTA 4KK5C 5DVKA 4M7KL 2FBJH 4JFDA 1XGRA 4MD4A 4E42A 4TUJA 1XGYL 2LVCA 3WIHH 3KYAA 4QHMA 3PDOA 5DFVD 4PJBB 3Q6GL 4LNRA 3GJEB 1CQKA 4HIHB 3V7MA 2VITA 3B8YA 3ZDXE 1FN4B 4NO0A 2GKIA 5IVNA 1K5NA 2DQGH 2HJKA 2HT4D 2V5RA 5EUKB 1RIVH 3MRIA 2ZSWA 1ZLSL 4Y5XB 3U7WH 4Z7OF 1JUFA 1FAIL 3PL6C 3T2NH 3WFCH 4QHKI 4PY8J 4PJGF 1T7YA 4XC1L 3C5ZC 4YHYB 2NZIA 1Y6NR 1IEBB 4QXTA 3VA6A 4PJ5A 1NUFA 5CKGA 5JO5B 3HFMH 3G9AB 3CC5A 4H20H 5M7QA 4PB0L 3JTSB 3CSYB 4E0RB 1A22B 2X4TB 4GUPA 4I3RH 1Y18A 4LKXA 5DQ9A 4ELKA 3QDMA 4PGCB 3ARFD 4YK4C 5EU3A 1LMKA 1C16A 5HI4C 1OTTC 3UROR 1U8IA 4DTGH 1SJXA 1RMFL 3V95A 3CXHJ 2IQAA 1A6VH 2JIXA 4WW2B 4PRHD 2D0HA 5ITFB 4N9GA 1GVIA 1S5HB 3CDGA 3VD3A 4G8GA 5HY9B 5J8OA 3S6CA 2QSCH 2BVYA 4U1LA 1KBGL 3TCLB 2BVPA 4HKZB 1JTPA 4ZO7A 5GISL 4BZ1L 4U2YA 1EAJA 3IFOA 3RPIB 3RDTA 1R5WA 4HCRL 4ZS6D 5CJOH 5AUMB 1X5AA 4DN3L 3VXTA 4X6BA 1LILA 5C0BD 3OHXB 4Q9QH 3SDAC 3T0EE 5ICXB 3X12B 5BZWB 3P0VL 1CFSA 3ALPA 5LG1A 2R8SH 1G7MA 2ZCKL 1J05B 2EXWD 1A6UH 5I0ZA 3IDMA 5J12C 5BCAA 4FQPA 5IBLC 3OKNA 5F7NC 4CMHB 4ZO8A 5E94A 1YNTA 4L8BB 3RI5K 3ZTNL 5C0CD 2DKMA 3CDFA 5F88A 4OLXH 5T5NG 2O61B 3QCVH 1FLRH 3VFPA 2APTA 3QUMH 2P8PB 3TJHC 5I17A 4EDWL 3MCLH 4GMSH 5BZDA 3BRDA 1HH6B 4MJIB 4OFKA 2DBLH 3QPXL 1J5OL 2H9GB 1ZWIB 2WWKT 1U8QB 5KJRL 3PQYB 2Z92A 2QQQA 1Q0XL 4OGAD 1XF1A 1CGSH 4QRTB 4GLRH 1H3GA 4QOKD 5KG9B 1CLYH 2CDFA 5CCKH 4G8IA 3HE7C 1D6EB 1B3JA 4TUKH 4ELMA 2BNUA 2BOCB 3IXTB 2FIKA 1AR1C 1EBAA 2H26B 4Y5YB 1CLZL 1EFQA 5HVFB 2GSGA 4Q6IC 1TIUA 3O4LA 4OZFA 3T4YB 4Y4HA 1J1XH 6FABH 1G9EA 2D7PA 4PBWD 2J8UE 2YSSA 4LQFH 2H8PB 2X09A 1CU4L 3DBXA 2CMRH 1KB5L 4ODXA 1GGIL 5D5ME 1KLUB 4K7PL 2YC1A 4IDJH 4L4TE 2GITA 1HI6A 4DVBB 3L3OA 3SE9H 5IESH 4I18A 2BRQA 5FAAA 5K93A 5IJKA 3V9FA 1DQLL 5C08A 1P9MA 4IOFC 3QBTB 4Y8DC 4JQIH 5GRXG 3CNKA 4FXGB 1A0QL 1FFQA 2Y6SD 3HE6A 5E95B 3MLRH 3VG0H 4HK3N 3ARYA 4OAWB 3F7VA 3C08H 5MEOB 1DTUA 5GS0H 2G2RA 4JFPA 3IJSB 4I2XA 5EU7C 4LRNL 3X11B 4DN4H 4D9RE 3J7HA 5FUZL 2NXYB 4R7DA 2X4UA 1MPAH 3ARUA 5FECB 4NC1C 5CIPA 2Q3ZA 4UDTA 1FYTB 3VFVB 4P5KA 5AYUL 5D7IA 1MLCA 2IAMB 5JIPA 3MLSH 4AYFA 2EDNA 3SJVA 3RVTC 5IHBA 4ZOCA 2BY2A 4XC3L 4MA3B 5EU6B 3GHBH 5L9DL 4N0CD 2D9QB 4J1UA 5FF6A 5HSFA 4APQD 4RAVB 2B1HH 3ZE2E 1SJEB 2MCG1 4LCIH 3GSNB 1JWMA 1J12A 3MCG1 4XP5H 1Q72H 1AKJA 3AS2A 2WUCL 1ZHLA 3S3PA 1S7TA 4M6MH 2UY7A 2HLAB 5FA4A 3MV8B 1HKLL 2R2BA 4OM1H 3CH1A 1FZJB 3RDTC 3VG9C 5ADOL 3NBNA 4CNIA 1FBIL 1YEDB 5C0FB 5FO9B 3WD5H 3GB7A 3VXNB 1X5HA 4AEIL 4MA7H 2F5BL 1NKOA 4FZ8L 3EJYC 5FB8A 1JRHL 3HCVB 3FO2A 4F7CA 4KKAD 5JOPD 4OZIA 4OQ1A 3KPQB 1S7XB 4JPIA 1Y0LB 3CFCL 1QBLH 4HJJH 2CLVB 2AJ3B 1S9KC 1KXVC 4X6FA 2AV1A 1FL5B 1TZHA 3PV7A 2DQJH 3KHQA 4F7MA 4TN9A 3CSBA 4WU5A 2GJZB 3TVMD 2X44D 4NJAL 4MJ6B 5E6IA 1NCAH 2R4SL 3T4AA 3QUXA 4PV8A 2VKWA 1BFVH 3UX9B 2AXGB 1MFCL 5AZ2L 4RDQF 5DYOB 2FEDD 1MFAL 1BBJB 2Q3AA 3PABA 4B41A 2PXYC 2O5XL 1A9EB 5GHWH 4Y19B 4IMKC 5DJYB 1XCTA 2VLLA 4K7FA 3MPCA 1BQHG 3D48R 4LSDA 5I0DA 1NC4B 3RJDA 4GXVH 2QHRH 3B83A 4M8QA 4ZPVB 5F93C 1EJOH 3ECBA 5H2BB 1MIEH 4XP6L 4UOJA 1WAAA 5FYKU 4ZUWB 4WHTA 1VADA 2VR9A 4N0FB 1NEUA 4Y4HC 1KXTB 4MWFA 5D7JD 2FD6H 3G6AA 5CEYB 1EZVX 1HSAB 2NY3D 4QCIA 4EIZC 1NCBH 3P9LB 4EI5B 2YWYA 2HWZH 3M1BA 2VSCA 3ZO0A 1MAJA 4AIOA 3D9AH 3G6DH 1YMHA 4XNZC 1JK8B 1UKQA 1S7RB 4JPKL 4K3EL 4YDLB 3UJJH 4ZUTB 4DVRL 1KT2A 3PWPD 1RZFH 4HWUA 1H3TA 2AEIT 3WFHB 4YDJA 2GHWB 4F58H 2YPKA 1ES0A 3KDMB 4U1GB 1DLHB 1A1NB 3HZKA 5EN2B 1A2YB 2CH8A 4X4YA 2NX5A 3IVKA 5ITBL 4TOYL 4LCUA 2F8VA 1N5YH 5DRNB 3I50H 5D96B 1UADC 4NP4L 3HNVL 2Z8RA 1JF1B 3CIQA 5A40E 2WMPA 1OAUL 3JTTA 3PHOB 3S36X 4TNVF 2VOTA 1LDPH 4ETYA 3KAAA 5CLWA 4GW4A 2EIZB 4HUVB 4P23A 3V5DB 1I1CA 4L3CB 1OAZH 1K2DA 5CZXD 3BMWA 5EUOE 3LN9A 2HVKA 3ZL4H 4FQQA 3LB6D 4I0PB 5E2VH 1E4XI 1PGRB 2ITCB 5F6HI 4IEFB 1J8KA 1HHJB 1J18A 2ICES 4PJCB 2C26A 1RK0B 4GBXC 1PG7L 5GGUB 1IGJB 5IT2H 2FCBA 3LEXA 2NY5C 43C9A 1F6AA 1GXEA 1T2QL 1RUAH 1I9IL 4RSVA 3VFNB 3ZKXB 3BAEL 4KUZH 5I6XB 3GBMH 4KROC 1L6ZA 4QHUB 5L7XH 4XPGH 1NLDH 3BQUD 1A7QH 1JGDB 1MFDL 2H2SC 3MA9H 4X7TA 5CJ8A 1ETZA 5F70A 1RJYB 2VLJB 5EZJA 4PJGE 1S9VA 2E6JA 4YHNB 3V5HB 3HLAA 3L5IA 1MAML 1X5LA 3UMTA 5CEZE 5JHLH 3HPLA 2BERA 1WBYA 1LO2L 5GRYA 2HTLD 2YRPA 2VAAA 5JXAL 2P8LB 2K1MA 5TQ0H 1G7LA 1BF2A 3QUXC 1FAKT 3FO0L 4J7RA 1ORSA 4HWZA 2P49B 4XPFL 3ULUH 4PP1D 3H3BC 5EORH 5AZEH 2I5YH 1ZT7B 5IQ7L 1INEL 3STZB 1T83A 1U2CA 5IVZA 3VE0B 3PDDA 2IG2L 1UACL 2Z93A 2X5PA 2F54B 1CTOA 1DN0B 3QUZA 3ZHDA 3WN5A 3PWLB 4PJIF 4N1EA 2W0PA 5J57B 5HD8D 1TZGH 1FL6B 2XN9D 4Z8FL 4UT7H 4KJPC 2BRRL 3RL1A 1MNUL 2OL3H 1N0XH 4JO2H 5GS0D 1UKTA 4LLWA 4LPVA 1F4WL 1INDH 1GHFH 1YMMB 2APWA 3D69B 4OIIL 1W2KT 4YE4L 1U3HC 25C8L 4RISL 4HEPG 5KAQG 3T0EA 4O51A 2JK5B 4HX1A 3TA3A 1SYVA 3WFDL 1IAIL 1EAPB 5A2KH 4M6NL 3LKSB 4X4ME 4QO1A 1ROWA 2QADD 1SVCP 2KQNA 1P69B 5C9JB 4JPWL 3AU1A 2VO5A 4NNYB 4B53A 1FRGL 2WWMC 1ITCA 5DUBB 1ED3B 3BIBX 4M93C 5E99L 1XIWD 5IFHH 1I85A 3CFJA 3RVWD 5EZLA 3BYYA 4F7PA 2EDOA 5FV1L 3LPGA 1CFQA 4NSKB 3DSNA 4OLWL 2Q86A 2ERJC 1XF3B 1S3KH 1FSKB 4NJ9L 2EZ0D 3A6CL 5MI0B 4HV8A 4JM2C 3FO1A 2EE2A 1MHEB 2W1NA 1HILB 3BH8B 5GGQL 3K4ZA 2MCPL 3BESR 3BJ91 3VXPB 2B1AH 4P23C 2OJZH 2R29H 5CP7B 4UIMA 1U8JA 1C12A 1KELH 2XWJA 4U1JA 2NW2B 3VFSA 3MJ9L 1UB5B 3PGFL 4HC1A 4KKCD 3RNQA 2DQFA 2EE6A 1AGCB 2FO4B 3ZKNC 3NPZB 2F9BT 4JKPH 3TEUA 3KPLB 2J8UA 3NFPA 4X6CA 3BE1L 3SDXB 5C6PB 3SE4C 1FGVL 3MRNB 2AJXL 4Y0GA 5E2JA 1N6UA 2R4RH 4HUWA 5CBEA 4KRNA 1EGJA 3V0VA 2XQYK 5ISZB 3BKCH 4PD4K 4L4TA 2XRAH 1G0YR 1KB9J 4IRZH 1KTLB 5JMOC 1FVCA 4NHCL 4H1LH 1LEIA 3LSOB 3I2CH 1UQSA 1ZA6A 4JANA 1A6WH 3RTQD 1T04A 3X17A 3BWAA 2IGFH 1K3IA 4OSUL 2VH5H 3CVIH 2BVEA 3S97C 4LL9A 4PLJC 4NRXB 3GEWB 5EA0L 1GL4B 4WO4B 4G80A 2P7TB 4NN6B 3MRDA 2A9ML 3JV4A 1AHWA 1JPGA 2ICWB 4P5TD 4RIRA 3S7GA 4BQCA 5DRZB 5DWUL 5AYQA 4HG4K 2YEZB 4XB7A 3MUZ1 2EDFA 5I30L 3P9MA 2VXQL 4XNYL 3EJJX 3HR6A 4GAFB 2EH8L 3ES6B 1A7BA 2AGJH 1EMTL 2YUZA 1EO8L 4RQQA 1MREH 1RZKL 5EO9B 3B2VH 1A3LH 3LQAH 3S34L 5CD5C 1I3UA 5ACZB 1JYNA 3T3ME 3WMSA 1NGPH 1A9BB 1X3DA 2O5ZL 3ZDZF 5HYFA 5L0QB 1FG2B 2F19L 3KWWB 3K4DA 4Z0BL 3FT3B 2FHCA 3QFDB 3QP3A 3WN5C 1QSVA 4U3XA 1BOYA 6CGTA 1BIIB 4ZTPH 1LE9B 1LEGB 3IJHB 3M8OH 5T33H 1KJ2B 4NKDA 4IRJC 3QR2A 5D70H 4K3JH 1CD1A 3UBXB 3VXME 4XVSH 4L3AA 1XGTA 2F53E 3BDBA 4HZLB 4WCYH 5D7LA 4S2SA 5M95B 2QQLL 1CXIA 1X6LA 2AJYH 4MMZC 1BREA 5LCVH 5TQ2L 3QIBC 2VDOL 2FB4H 4K7PX 3EZJB 3NH7L 3BPLB 2HTKD 2V9QA 1X7QA 2FSEA 3TN0A 3PV6B 1MVUB 4MAYB 4Y1AE 2OM5A 3MQIA 2CO7B 3D3VB 4LU5L 4XT1C 3QHZH 3E8UH 4MS8C 2YHGA 3MXWH 1SMAA 1I7TB 1H5BC 5ERWB 3ROLB 5HGHB 4ZFFB 1WZLA 2DLFL 1FC1A 1OTUC 3O41A 5E5MB 3QNYA 2C1PB 5E5RB 3HN3A 2NLJA 1I1AD 3W11C 1CTNA 2ZNXA 1QQDA 3DVGA 4UNUA 4QHLA 1DJSA 3MRLA 4KTEL 1JRHI 3MOAH 4NZDA 5FGSA 4XH2B 4Y2DC 1BWWA 2A1WL 1ZEAH 3N1QC 1IGIH 4NM8H 1D5ZA 3HC3H 3JV6A 1HIMH 4YO0A 5T1DH 4D0CA 1FE8H 5DI8A 1QLRA 5ACMA 2Q7YB 2VLKE 4W81A 4NQXB 1WWWX 5FYJH 3QNXA 3CH8A 3HI1B 2VYRE 3FCTA 5J06A 1MWAB 1EHLH 4C4KO 2XV6B 3H6JA 1RHHB 3FN0L 4M3KB 4XI5C 3WS3B 1AY1H 3D2UA 3EGSB 1NGWB 3I6LD 3OWEA 4YHOH 1RUKL 4WU7A 3NIGF 4G9FD 4NM4H 5JA9A 1C5CH 4P2QA 1BQHA 4BFIA 1G6RA 1RUML 4NRZA 3UO1H 2R56H 1ZHBA 3ULUD 1ND0B 1WBXB 2HVJB 2H2PC 3LKOB 1U42A 2OZ4H 5H94A 4OGXL 4Y5XC 1AHWC 5D8JL 1DVFA 4UZGA 5IB1B 1CVSC 1JTTA 2IADB 4HF5H 4U6YA 4GRLB 4F7TB 5LXGH 4YHYC 1NAKL 3SDDD 2DS4A 3EO9L 1UXSB 1M7DA 1FCGA 3EOAA 2K3TA 3EYFB 5KVFH 4J3UA 1MSPA 4ODBD 5FKAA 1NCDL 4O4YL 3NCYS 1AP2A 5TE7L 2ZUSA 5CHNA 5AWNL 2G9HB 5EUOA 1NEZB 3P4NA 1E4KC 3OGCA 4QLRA 4WW2C 3VRIA 2EYTB 3LRSA 2CSPA 3QIUD 3V8CA 5ABDE 4BZ2L 3LEVL 2AEQL 2BVUA 2AVGA 2VWEC 1BPVA 5DJ8B 2EO9A 1T0MB 4OQTH 1B88A 3CLFH 4JEGB 3QEUB 1Q38A 1KIQB 4PREA 4EUPH 1MFNA 3OAZK 3MUJA 4G6AC 2FBJL 4OV6F 3L3DB 3O3AA 2HRPH 3RIAF 3DTXB 1KG0B 3WIHL 1J8HD 5MEND 2NNAB 2ATKA 4MCYB 3TV3L 1JYVA 1GOGA 4JAMA 2CUHA 2EC9U 4U1SB 2D7MA 5ETUB 5SWZD 5IMOB 3Q48A 2A6JA 1WWCA 3BP6A 4PJAE 4XMLH 1HHIB 2DQGL 5JW4N 2P5WD 5IOPB 1JWUA 2JJVA 4PJGA 1RIVL 4LARH 4LKCA 5GSRA 1X5XA 1XH3A 3TN0C 1VACB 3ELAT 3T2NL 2DKSA 5ESQA 4CMHC 4GJTB 3DYOA 2N56A 4R2GB 2HFFB 2XKNA 2XZZA 1P6FA 2I9LA 3DLQR 2ORBL 2A83B 2DQEH 3HFML 4IM8A 4X8JA 2EEAA 4I3RL 3DXAB 4TTDD 3EDKA 4FFYH 4GQ9H 1TETL 1QYGH 2C3XA 4JRXE 3N1GC 4DTGL 5JLZA 4DCQA 1O7VA 1A6VL 1TPXB 2ADGA 1S9XA 4PJIE 3TBTA 4XXCA 2ZWLT 2GCYB 4N5ED 3BKJH 1NBVL 4M8VA 2VSDA 4NQCE 1S8DB 1ZHNB 3BP4B 1S7QB 3H7BA 3L5WA 4WEUD 2G5BB 4Y5YC 5FYLL 3BIKA 3BD3A 1QRNB 3QDMD 4RFEA 1OF2B 43CAB 1P4LA 5EU5A 1TVBB 4OV5B 2J8HA 4JJ5A 5CJOL 3T2OA 1NJ9B 4Q9QL 3ET9F 4JFEB 3HMXL 4CMMB 3C8KA 5GRUH 1TJIH 2H1PH 3RZWA 1UM6H 1PG7X 1DUZA 1YNLL 2R8SL 5HHPA 4UINL 1NPUA 3MGAA 1A6UL 4C55A 1K4DB 1P1ZB 4PJ9A 1UH3A 3QDGB 1A02N 1R3JA 4LIQE 1GGYA 3MYJA 3DUUB 5T3XE 3U9UB 2DQHL 2DMKA 2NXZC 3QCVL 1TENA 3NCMA 4XZUB 3QUML 5D1QD 3W81A 1BHGA 3I6GB 3BN9C 2DRUA 3MCLL 3PXJA 1DVFC 4S1SH 1MCJA 4JRYB 1NEZG 2I9TB 4N8VB 5GZND 2JB6B 4HPYH 3HC4H 5E7BA 4P9HH 4JB9H 4KXZH 5DK2B 1I7ZB 2CD0A 5A1AA 1HZHH 1IAII 1CGSL 1CLYL 3R0NA 1M7XA 4XWOC 5HHMB 3IFLH 1S7WB 5IFAL 5CCKL 4WTWA 1F3RB 1KCUH 3O45B 2W9LA 3BP7B 4Q9CA 1T89A 1I7UB 4UT9H 4I4WB 4NN5B 1N7MH 3VXSB 1PX3A 4HSQA 1H15A 4JFXA 3MJ7A 4U0RC 4L3EE 1DBKH 1J1XL 3O0RH 6FABL 4R26H 4RA3A 4LQFL 1H3VA 4NQDD 4DZBB 1WV7T 1H8OA 1UH4A 3MX0A 2PR4H 2CMRL 3HAEB 4F80A 1UCBH 2A77H 4H0GA 4IDJL 2QJDA 2BSTA 4KKLC 3SE9L 5IESL 1UWEH 1QHPA 1T21B 1DN2A 3HUJB 4KHXL 5I2IB 3O4LD 3FQTA 3RVUC 2GQHA 5DZLA 1A6ZB 1MCQA 4X98B 5F6IB 2XA8H 3L3HB 5HYSB 3MLRL 2Q87A 3VG0L 3QNZB 2IC2A 1TQCC 4ZG1A 3OKMA 2GJ6E 1D3CA 3O6KH 4UB0H 4G6FB 5GS0L 1IC7H 1MCRA 1QVOA 3RZCA 5D7SH 2PO6A 2I07A 1ZXQA 3BVNB 4EVNA 1MPAL 1MHHA 3DUSA 5FYJD 4P46A 2CLRA 4XCNA 3HS0A 5BMFH 3MBED 1W72H 3BPOB 3MLSL 5CJXA 4GQPH 1FVDA 2ZUYA 3PIQA 3L1OH 2H3NA 5CINL 1NUNB 2B1HL 4X80H 3AB0C 3VGGA 1J0IA 4LCIL 3VGHA 1X44A 3FAWA 4NQVB 5LGKA 5INCB 4ZXBA 1S5IL 1NAMB 4PJ8A 4PFEA 4XP5L 5CJ5A 4P59L 4CU7A 1Q72L 5BXFB 4K23H 5BV7H 1NDMB 4KHTH 3T08A 2BXZA 1OB1B 5F71A 3OKOA 1KENH 3ZKQD 4OM1L 1NMAH 4OCSH 3VXMA 2PW2B 4PG9B 5D93B 2F53A 1I1FA 4J4PC 3WD5L 1AGDB 1BZ9A 3ARDD 1CR9H 1I3VA 3U0PA 4E41D 4MA7L 3VXRB 1HOCA 3UPAA 3GMLA 4N8VG 1A1OB 1BZQK 3AS3A 4CN4A 3PDGA 4PJXF 5B39G 5GGTA 3O81A 1HNGA 1TCRB 3B8SA 3MRGA 1D5XA 4PJ9C 5E08H 2VXUL 3C9NA 4ODWA 3R0MA 4V1DE 1XZ0A 4Z76A 3KPSD 1QBLL 3BD5A 4HJJL 5IV2B 3RIFF 2DM7A 4Y1AA 5J9PB 5GRZA 2X70A 3IFPB 1MIML 4PRBB 3QQNA 5K9KB 3U30B 1NH6A 3L3JB 4HH8A 3LPWA 4X6DE 2PYED 2XTLA 4XVJH 1NCAL 3QXTA 1MJJB 3HTLX 4NHUA 1ULVA 5EC1A 1SYSB 4NBZB 1Q9KB 5C3LD 5MEQB 4NQEE 1QFWM 1T2JA 3DVIA 1JZ2A 4LCCB 3LEYH 2HT3D 5D1XA 2NY0B 4U3CA 4GXVL 4Z6AT 4HUXA 4BFEA 4G7VH 3DETD 4MMXC 2W65A 3UDWA 1MIEL 2VLKA 2AK4E 1NGQH 2FO1A 5TDNA 2D4DA 2DLEA 4ZUSA 4I48B 4PR5B 1GJIA 2ESVB 4LNVA 1UB6B 3WUWB 3JUZA 2FD6L 2FGWH 4I0PC 5HYSG 2R2EA 3EFFB 3NIGE 5ALCH 2DB8A 1NCBL 1N8ZA 5IF0B 1U9KA 2XFXA 2VDRL 3CK0H 1IFHH 4K3DL 1NGZB 3D9AL 1B0RB 4K8RH 1KPUB 4HWBA 5JDSB 4JDTL 4GAGH 5FUCC 4LVHB 4FG6C 4JZJB 2D7QA 5F9WC 1M05A 3MLVL 3MRJA 3ARBA 4WI9A 3W9EB 5C8JB 4ONHB 1PYWA 5I76A 1L0QA 1WC7B 3WFEL 4F58L 5KSAA 4QRRE 1I7RB 2VTFA 3MCKA 3U36B 3LN5B 5IVXF 4IIQB 1BLNA 4P4RA 4UI2A 2BNRB 1WITA 2NPLX 5KSVB 1PJ9A 3I50L 1CG9A 1U8NA 3P73A 4WI5A 2LE9A 4P46C 3I3DA 3VFOA 3VFUA 5JDJA 4HKXA 1LDPL 1MY7A 4JFFE 4UT6H 1U8OA 1FDLL 3S35H 2AEPH 3IDYB 4KJYB 5F89A 1UWXK 5HGDA 1UXWA 2VISA 5ESVA 1BVKA 1OAZL 3UTOA 5I71B 3AM8C 4M7ZC 1IGML 5DMIH 4RAHA 4O2CA 5E2VL 2VQUA 3ARXA 2ADFH 4KQ3H 3KPTA 1RZGB 3N1FC 3UPRA 2BVOA 4KY1H 2H41A 5T1LB 4UNVA 1JMXA 2V9TA 1GZQA 1OHQA 1RUAL 5DJ6B 2NY6D 4KUZL 3QH3B 3GBML 3KPRD 3UAJD 3O3EA 4R4ND 1IEAB 2RCSL 1DEEB 5L7XL 2HMID 3QPQC 4UMGA 2E7LC 4XPGL 2C4FT 4OKDA 5D72L 4HXBH 4R97C 5T1MA 3AAZA 3MA9L 1OP9A 3QCTH 5FCUH 2V5TA 3ZYOA 3U4BH 3HRZB 4OF3A 4MNQB 1REIA 3DMMD 1BD2A 2CKBA 5JHLL 1IT9H 1FL3A 3FQNB 4WI3A 3SDCD 2YS4A 1I8LC 1IAMA 3ARWA 3CMGA 4KK8D 1AO7D 1FFPA 2BMKB 3MRQA 3ARTA 5D2NB 3QWQB 5TQ0L 4Y7MA 4NO5B 3ULUL 3DV6A 4FOMA 5EORL 3WUWG 5AZEL 3SCMA 4JRXA 4NKOA 4Z5RB 2J7LA 5GJTH 4WWKB 4PJBE 1KTDB 4LCWA 1NC2D 4O9HH 5E8PA 1LO3H 1IGCH 1U3JA 5DJ0A 5MI0C 5K9OA 5DD3H 1OAQH 4PJIA 4PY7A 1KPVB 2VDNH 4ODUA 3RAJH 2ED9A 1TFHA 3Q5OA 1IQWL 4QYOB 1G6RH 4NQCA 3GGWB 2P5EA 4HLJA 5BOPA 1TZGL 1EFXD 1HYSD 2OXGA 1OAKH 5SV3A 3NABH 2DQIH 4UT7L 1SY6H 2ICCA 1P6AB 3V2AR 2MHAB 2XXMB 5EOCH 2OL3L 1N0XL 2BNQD 1INDL 1R5VA 2NTSP 4FMFA 1GHFL 4KVNL 1K8IA 2Q6WA 15C8L 3OZ9H 4LPXA 2GK2A 3OB0K 1Z3GH 3MLXH 5HYJE 1WFNA 1N3NB 3TT1H 4KI5E 4A6YA 1ZHKB 4HUUB 5ADPH 5CZKA 3WYRA 1SMOA 5F97E 2X7LA 4PGEB 3GSRA 5GS2H 2MTPA 2EYRB 4LVNB 4TSAH 5KSAC 5I9QC 1YY8A 1KCSH 4X7SH 5DHVH 1YYLH 2YD4A 3U0TB 5IFHL 4EN3B 3WFBH 2PETA 2V7NB 2EH7H 3QUYD 4JY5L 1D9KB 4NN6C 4PGZA 1BQSA 4RGNB 2R15A 1TZIB 4DOHB 1S3KL 1MFEL 3MV9B 4JO3H 4UQ3A 3UBXI 1JNHA 5B22A 2YMXH 1V7MH 5DSCA 3LN4B 2XICA 3ROOB 4PRIE 4NDMA 3P4MA 2B1AL 2OJZL 2R29L 3OAZH 1KELL 3O2VH 4WW1B 3ETBF 1O7SA 1MCDA 3QI9A 2MJWA 5DDHB 5JW3H 4L3EA 4JKPL 2OR9H 4M3JA 4Y4FB 2XZCH 4UILH 1DE4A 4ZYKB 3WO4B 2R4RL 4RMSA 4Y89A 5D4QA 3BKCL 4PGDA 1U95B 3VCLA 5JXEC 4R0LB 3TO4B 4GW1B 2XRAL 2E6QA 1HDMB 1JN6A 4GLRI 4OFYD 4M62H 3MA7B 4PPTA 3RWDB 1RZ7H 4OZHF 2HKFH 4JFHD 1MH5A 3CZFB 1A6WL 3H0TB 5DRXB 3UZVB 3MLTB 1VGKB 1NFDF 2IGFL 3VFRB 2VH5L 4XNXH 1HHGA 4ZDHB 3WLBA 5MP6H 1DDHA 4DFHA 5FK9B 3RGVD 4W6XB 2CDEB 1BX2B 3TPUB 1XR9A 1C5DB 5DEGA 5IWLC 5CGYC 4Z77B 4YDKH 4GRWB 2NY1B 3L95A 2AGJL 4U6HA 4C4KT 1U92B 4K55A 1V3LA 5HPMB 3SCMC 5ENWB 1KJMA 4YIQA 5IP4A 3B2VL 1A3LL 4NQSB 4NRYB 3QEQB 4HT1H 4D9RD 4UOW0 5IEHA 1NGPL 2AKRA 1SM3H 1CIUA 4HS8L 4L8CB 4P2OA 3WHE1 4JG0H 5F3HB 3OXSA 3PP4H 4NO2A 4PJDF 1RQ5A 1RK1A 1EO7A 1CF8H 1NMBH 4ZTPL 3IF1A 4X5XB 4U05A 3Q6FA 5T33L 4U1IB 4Z7UF 5KVMC 1S7UB 1QEWB 2VE6B 4C56A 4YPGB 2X4RB 4B0MM 4K3JL 4NKQB 4NFCA 3OTTA 4MXQD 4WCYL 1WTGT 2VKXA 2X4PB 2WIIA 1AXSB 3RWCB 4PJXE 4WGWB 3K8MA 3V6OA 5JA8B 5LCVL 3LDBB 3U9PH 3TM6A 3ORJA 1VFBA 4V1DA 1AGFB 2FB4L 3IT8D 1IAKA 1R3HA 4MQTB 2NZ9D 3X13A 5IVOA 3IFNH 2GTZA 4QOKB 1KEGH 4LHJB 2VL4A 4LHUB 3QQ3A 2EDKA 3GM8A 1CGXA 1FNGA 3BP5B 3ARGB 1UJ3B 3FB6A 4X6DA 2BSSA 4HLZG 4DK3A 3QHZL 3MXWL 3DIFA 5HVWA 4LLYB 2R1YA 4LP5A 1ZAGA 2SEBB 5DJ2B 4D0DA 3ILQC 1RJCA 4KRLB 5DJAB 2RHEA 4GRLC 1PKQE 2IPKA 3BHBA 1IVLA 3PGCA 4HULB 4PJEF 5B39A 5SWQA 3MOAL 1KIRB 1UZ6F 3O2DH 4L9LB 5B21A 1WTLA 4G8FB 4OB5H 3IETA 4ZQKA 2HFGH 1RVFH 1ZEAL 3T0XA 1SEBA 1JYXA 1IGIL 4NM8L 3HC3L 1HIML 5T1DL 2AK4A 1FE8L 1MJ7H 1YJDL 4KKBD 3QI9C 2WLYA 4Q74A 1BJMA 1BWMA 1MRDL 4FRWA 4XPHH 2DTML 2NY2D 3ZLQC 5BVPH 1ZLVK 4R7NA 1EHLL 3EW3B 2VLRD 2IBBA 1KPRB 4JGJA 2VDLL 3MYZA 4WV1B 1AY1L 1XR8B 3CMOH 2ATPB 1R3LB 3LQZA 4NM4L 2E27H 4AMKH 3U7YH 4PTTB 3TIDA 3QUKB 4FMKA 3JVGA 4KVCH 3QO0A 4KDTA 3UO1L 2R56L 1EVTC 2FWOA 2V2XB 1XGPB 1EIBA 5DXWA 3UTPE 1ADQH 4D8PB 1IZKA 4RMQA 5I8EA 5BRZB 1EH9A 2OZ4L 1J0HA 2FYYA 1MRCH 4Y16A 1A4KA 4OI7A 2FZ3B 2E8ZA 3IJYB 2FRGP 4WY7H 4CVXB 5C0IA 1KB5A 5I1CL 4YGVB 4UNTA 1J88A 1NBQA 3QQ4B 3BKMH 1P84K 4PRNB 5FXCH 2P42B 5DUPH 5J0BA 3U6RB 3TH4T 4G3YH 3H9HA 3K4AA 4G42A 3VWKD 1ACZA 2UV3A 4GSDH 4JFFA 2A74A 2B20A 3SQOH 2C1OB 1VEMA 4ZAKD 5KVFL 4NQUA 1YZZA 2N7BA 3GHEL 4GKSA 3MUGB 5E4IA 2BP3A 5C07D 3NAAH 3RJQB 4CVWA 4PRDA 5BV7B 3C6LB 5GGSA 3VI3E 4MB3A 2AEWA 4LBEB 3NMEA 3NPSC 5E1AA 3GSOB 1QLFB 4FQ2L 4ZFZB 4QXWA 2H32H 4YBLC 3MRKA 5DUML 5GS2D 2PYFB 5CSZB 3RIAK 4OQTL 1KIPA 3CLFL 2M8XA 5CWSB 4KRPD 1AI1L 3GMRA 4LRIC 3DX9A 1UM4H 2C7UA 4BKLA 2R23A 2HRPL 4L8DA 4PRPA 4J3WA 2J6EH 2B5IC 3HZVB 3TNMA 4UTAH 1BJ1J 3V6OC 3RY6C 4G5ZH 1HXYB 5H37G 5C92A 3FB7B 3CX2A 3EAKA 5I1AB 5KSBF 1DQDH 5GIRB 2JJTA 1EZVY 3KYNB 1K4CA 3O11A 5ALBH 4LARL 4PJHB 4UAOB 2YK1H 1NCCH 3KXFB 4IHOB 3D39D 2BX5A 3QDJB 4M7LT 4YHIA 2HT2D 3QIWC 4KK6C 1JWSB 4XRCB 3FFCB 1HCFX 3SOBH 3LVEA 3WKNA 4PJCE 1PQZA 2PW1B 2CRZA 3P4OB 4UQ2B 5SV4A 2ICEA 3K1KC 2EYSB 2A73B 2AJSH 1D5MA 2AXFB 1JI2A 2XKUA 4P5MB 4FTVA 4PJBA 1OGTA 4FFYL 2W60A 4GQ9L 3AREB 1P4BL 3STLA 3D0LB 5I1JH 2LU3A 1CVRA 2D31A 3CFEB 2FECL 3QZWB 4JJHA 5FKPB 4HFUL 1GPOH 1YEGH 4P57B 4CADB 4NKMA 1VFMA 4ONGL 3FB5B 3GUTA 4JFOB 3BKJL 2VLJE 3SKNB 2A6KA 5HYQB 2J3SA 3O6LH 4NN5C 2V2TB 5MHSE 1RZIB 2X4NB 3H9SB 2CJUH 3UTTD 2W9EH 4XVUC 1CDYA 3ZYJA 3ABZA 1E0OB 4MVBC 1W0VB 1GOHA 1NL0H 3JTSA 4WHYH 3UC0H 1RIHL 1ZANH 3REVA 5HYJA 5IJVA 4XCFH 5GRUL 2H1PL 1UM6L 3TZVA 2IH1A 5EPMA 2DLHA 5GS1B 5I1IL 1RJLA 4ODTL 4F57H 1JFQH 3FQUB 1BF8A 4JFZH 5C0AA 1OP3K 3MLUH 3NN8B 4Y4KB 3MRBA 1F3DJ 3WKMH 1D5BA 5E8OA 4NNPH 3TGXA 2P8MB 1NFIB 3TCLA 3DARA 1AIFA 2QSVA 1UWXH 4S1SL 2CQVA 3IXAB 2EEBA 1A7RH 5IB4B 4QT5A 1YN7B 1QSFD 4HPYL 1OTSD 3RPIA 1BAFL 2DLIA 4RNRB 4P9HL 4JB9L 1EEZA 4OI8A 3F6LA 1EUUA 4HFWA 4ZMAT 3THMH 3U4EB 1YMME 2X41A 5B4MC 32C2A 1HZHL 2DIJA 4LCYB 5FM5M 3S4SB 3IYLW 1RURL 5BZWA 4PRIA 3UZQA 3E3QC 1WZ1L 4JVWA 3D85A 4UBDD 2X4QA 4IRSA 4L5FH 4RAUA 4MZ3A 4AIZB 1KCUL 5EO1A 4YHPA 3CD4A 4F37F 3K7UA 1GC1C 4UT9L 4OTXH 3VFMA 4YBQC 3I02B 4NWTH 4JLRB 1DBKL 3F58L 3O0RL 4X0KA 4R26L 4DAGH 3B9AA 3NZHL 5HGGS 3HB3C 2R2HB 5E2WL 5JOPE 4FXKB 2VNCA 1UCBL 4NC0B 5DGQA 2A77L 2YBRB 4UUJA 5EZIL 1A3QA 1J1PH 1XGQB 1UWEL 1QACA 3AROA 4QRTA 1NLBH 2X1QA 3QRGL 3RFZC 4HK0B 1IE5A 1NFDE 1DEDA 4MQ7A 3C5ZD 1FZKA 2DQUH 4HHAA 3HR5B 3KPMA 4P4KB 5KW9H 1FVEA 5TDOA 2XA8L 1JPSH 2Z8SA 2JJTC 3HG1B 2BOCA 4DZ8A 2QSTA 3VXUA 4C58B 3CJJA 2D7TH 4GW5B 1KEMH 3O6KL 3O8XB 4UB0L 3CUPB 3T4YA 1IC7L 5D7SL 1I1YB 1OTTD 5I1LA 1T20A 3L3KA 4P2RD 4FFWC 2H8PA 3BW9B 1V8HA 3IDXH 3EYVA 1EK3A 1FFOA 4PJFB 3L3IA 3OL2A 5BMFL 4XHJD 2JKXA 2A38A 1CT8B 2Y25A 3L6FA 4YHML 2H6PA 1TJGH 4QF1B 4W68A 3GMMB 3NCFB 5JHDB 1KJ3H 4UTBH 4WUUD 3L1OL 4QTHB 1DBBH 4X80L 4GKZA 4LCCC 2D4FA 3CFIC 4TTGA 5D2LF 2CK0H 4J2XA 3FHAA 1FNHA 3QXAA 1HSBA 4F9PA 3QFJA 5ECJE 2VAJA 4HXAH 3SDAD 3CVHH 5EC2B 2COQA 2QADB 5I66A 4K23L 5BV7L 4KHTL 2OTUB 2HH0H 2LABA 4H8WL 4KJWC 5I1EH 4LIQH 2EDEA 1JHKH 1NMAL 1X9QA 3PWPE 4OCSL 3IGAA 2WUBH 5IBLD 1LP9F 4XNMA 3ULUF 4Z78B 2PN5A 2ARJQ 1CR9L 1MCSA 2GT9B 4PJXA 3NCJH 1N2RB 4ZXBD 3TJHD 3PUCA 3WEXB 5I1DB 2IBZX 4L4VA 1Y6MR 1U2HA 2HG5A 2JJWA 4NKIH 5J4MA 2RJMA 5JPMA 1U93A 4JZJC 5E08L 4LLDB 3TYFB 4FHBD 1FV1B 5FYLE 5HJ3B 4GG6B 3U4AA 2Q8BH 3VXMD 5JW5B 2X4SA 4BJLA 1NBZB 5DC4B 2KKQA 3O6FA 4FQIH 1YEFL 3HE7D 4YUEH 3E6HB 3LAFA 3BOVA 4PJEE 3VMNA 1OQOA 3W0WE 4ZO9A 1PKQA 2VDPH 1Q0YH 5LVEA 1L0YA 1OGAD 1UZ6E 1O5DT 3B9KC 3WSQH 3RBGA 2EDLA 4LPTA 5ESAA 4P3DB 1J87A 4S10A 3IDGA 3Q3GA 4LK4A 3LEYL 4RBPK 4IRSC 3UYOD 1S7SB 4G7VL 2XY1A 3MXVH 5FUOH 1TJHH 2AJ3A 1NGQL 8FABA 1XF4A 3LKQA 5EBMA 4LLVA 3FQXA 2R69H 3ARRA 4LQ1A 5DRWA 4IOFD 4NZTH 2FGWL 5FO7A 3CLEH 1RIUH 3VFTA 3JXAA 2A2QT 2E9JA 4XBGA 2W59A 5ALCL 5JOFB 1LO4H 2IJ0C 5ICYB 3CK0L 2LQRA 1P7QB 4CDHA 1T7VA 4U2ZA 4M7KH 1DZBA 4K8RL 3GNMH 3MJ9A 3O9WC 4GAGL 5CD3B 5TDPA 1XGYH 1G7IB 3BXNB 4IBLT 1T1XB 2XQBH 5IVXA 1U8HB 4HIEA 1T22A 5H2BA 3IDJB 4M5YL 3TESA 4OF0A 1KNOB 1M6OB 4MJ4A 3WL9B 3OSKA 4N0FA 5D6DC 5ID1A 3BSZH 1IQDA 1QFUL 3PP3K 1WISA 1UWGH 3KLAB 3OPZH 2B4CL 1A6TB 4PRHA 1P2CA 1FO0B 3LV3B 3DGGB 3LKRA 2WP3O 1F3JA 1YDPB 4PV9B 3ARBD 2VDQL 2EDJA 2F74B 4Y8AA 4LFHD 4K7PY 1ORQB 4U1NA 4XCEA 5D2NC 12E8H 4URTB 3MZTA 1R3IH 1FG9C 1U41A 3LKNB 1IM9D 4UT6L 2UZIH 4ZUTA 2J12B 1JZ5A 4MJ2A 5EIIB 2AEPL 4X6EB 3L5HA 3HNTH 3OKKB 4WWKC 5F1IA 1P7HL 1RMFH 3SGJA 4I5BA 3WFHA 4RGOH 3U7AA 5L2KB 3IS1X 1S9YB 5KS9F 5C0BA 3T65B 4EOWH 5DMIL 1R5IB 2ITDB 5E2UH 3N1MC 2R1WA 2ADJA 3RWEB 3CFKB 4IS6A 2ADFL 2UYLB 4KQ3L 2EDHA 5GGSY 4IMLA 2Z91A 5IB2B 4KY1L 3FT4B 2Q76A 3OKEB 3OXRA 3RPKA 4XGZB 5K9JH 3BZFA 3EJZC 4HCRH 4X7FC 2DWEA 2WBJC 3KNBA 5HHQB 1JHLH 35C8H 3ZYZA 1HQ4B 4HUVA 3P0VH 4HXBL 2BVTA 3MGTA 3BN3B 3EOTH 3SGKA 4ZSOE 2PXYD 5FCUL 3PL6B 4NT6B 5F7MC 3U4BL 4MD5B 3O6FC 1IT9L 5TFSH 3FZUC 1CICD 1UVQB 1NBYA 2VXSH 3QHTC 4OT1H 5IR1B 1AJ7H 1I3RA 3MTRA 2LU7A 3RI5F 2D7OA 4Y2OA 5IBTH 4DKFH 2G75A 4OUUA 3QPXH 1ZLVH 4D0BA 4YK4B 5GJTL 1YYML 1MLBB 4O9HL 5IW6A 2Z35B 1DQQA 1LO3L 1IGCL 1Q0XH 2DYPB 3C5SA 1OAQL 3RAJL 2XTJB 4F33B 4YHNA 4TVSa 5DFVC 2DL9A 2VZSA 1FNAA 4XPBH 2IANB 1S7VA 1CLZH 1OAKL 2VUYA 4ELMF 3NABL 3SO3C 4U7MA 4U49A 4Y4FC 5EOCL 1T1WB 2BVQA 3QDHA 5AD0A 3G04A 1YPZF 3OR7B 3PNWB 4BSWB 1X5YA 4FQXA 4WJ5A 3WO4C 1VKXB 3VGDA 4F8TA 5E9DD 3OZ9L 1GGIH 1BJ8A 4EXKA 4EXPX 3L7FB 4R0LC 1Z3GL 3MLXL 3TO4C 4K2UL 3TT1L 2FECI 2NW3B 3V6FB 4NQCD 2BY0A 5B38B 1XEDA 3PGDA 4JKMA 5I1KH 5HHOD 4CJ1A 5DQDH 1KCSL 2DM2A 1FP5A 3ARFC 3VWJD 5IFJB 3UTSB 3WFBL 3CGTA 3Q1SH 3T0WA 2YD8A 1X6NA 4APQA 2GJJA 5DQJB 3U0WL 2GSIB 5DHYB 3D69A 2OJEA 2YD2A 4JO3L 5DD5L 3SO5A 4PG2A 2Z31B 4FABL 5LWYH 2JB5H 1BVLA 2YMXL 5I8KH 1V7ML 5HDQH 1AD0B 4JRWA 2FJFA 3EYSL 1ODAA 2EDWA 4GG8B 2HJLA 3O2VL 4HGWB 5I16A 3SGJC 5C9JA 4U6XB 3K0WA 1U58A 3G5VB 1YC7A 3QDGE 5JW3L 2YD1A 4Q6IB 4MD0A 3VD7A 4KROD 2XZCL 4UILL 4NFBA 1BFTA 4Z7WB 4HMCA 2R0LH 3DI3B 2YPLE 3TBVA 4JGUA 3EYQC 4JRYE 4J3VA 3GSQA 4JFDB 2H2SD 4MNGE 3VDAA 1XGRB 4MD4B 4E42B 5BS0D 3BD4A 2CO6B 4OZHA 3KS0J 4TUJB 2ZNWA 4QGYA 4QHMB 3MV7B 3F12A 1G0DA 3PDOB 5ADOH 4M62L 3MODL 4LNRB 2Y06H 1NFDA 3BKYL 1RZ7L 2VITB 3WUZA 2B39A 3I85A 3VFWA 4NO0B 2F5BH 3NA4A 1K5NB 2KBGA 2NW2A 3V5KA 4XNXL 5AG9A 3MRIB 3U79A 4QRPB 1IJ9A 2ZSWB 3SGKC 2MSPA 4POZD 3OX8A 2FO4A 5MP6L 3ALWA 1JUFB 3ESVF 1P84J 3ISWA 3Q2CA 4EZMA 1KFAH 4XBEH 1CXKA 1S9WA 2VXTH 3HZYA 4M61A 4HIXH 4MCZA 4QWWC 2JF1A 2X1XR 3WIHA 3ARGC 1UJ3C 3CCHA 4PJ5B 3D5OF 2RGSA 4YDKL 3I84A 3CC5B 3LCYA 5KSUA 2HFEA 4GUPB 1Y18B 1KTLA 5DQ9B 4ELKB 1MFCH 5EU3B 2GJ6D 1C16B 5D7JA 1U8IB 4KJPD 2IQAB 2JIXB 3TP4A 5D2LE 3VRJA 1SM3L 1G7JA 4N9GB 4PJDA 1TVDA 1WIUA 2XNAA 3I6LE 3JBG7 3CDGB 2BHZA 4G8GB 2RIKA 1U3HD 4G9FE 4Z7UA 2NYYD 3PP4L 3NTCL 4U1LB 1CF8L 5SWSB 2BVPB 3KYKL 1RZJC 3MSPA 1LP9E 2VLME 5TH2B 3PWPA 3ULUE 3IFOB 3RDTB 1R5WB 2Y6SC 3FRUA 5IW1A 1UGNA 3VXTB 4X6BB 5JORB 3BT2H 1B0GA 2WBKA 4ERSH 1MHCA 2FDBP 5EO9A 1CFSB