4OUUB

Anti-mt1-mmp monoclonal antibody
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
217
structure length
210
Chain Sequence
EVKLVESGGGLVKPGGSLKLSCAASGFIFSNYAMSWVRQTPEKRLEWVATISGGGRNIYSLDSVKGRFTFFRDNARNTLYLQMSSLRSEDTAMYFCSRENYGSSFTYWGQGTLVTVSSAKTTPPSVYPLAPSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords anti_MT1-MMP Heavy chain
publication title Inhibition mechanism of membrane metalloprotease by an exosite-swiveling conformational antibody.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase
total genus 43
structure length 210
sequence length 217
chains with identical sequence H
ec nomenclature
pdb deposition date 2014-02-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ouuB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ouuB01
4S2SA 1EJOH 1BJ1J 2CK0H 2G75A 1MCLA 2MCPH 3RPIB 3S35X 1T22A 1G7PB 5IOPA 3GIZL 2XZZA 2YMXH 4L8CB 3EJYC 1RUQH 1NBVH 4PJ5E 1K4DA 4Y1AA 1RHHA 1VACB 2XACC 4Y5YC 5C0CD 4OZIF 2AJSL 4UTBL 2DI8A 1NGQL 3BN9C 2YA2A 1CGWA 3LHPL 3QDJA 3VI3E 3WIHL 4J1UB 3O6LH 4FZEH 2GITB 2QQLH 2EDHA 2R0ZL 1OF2B 1WITA 3U4EA 2L4OA 2ADGB 2CUIA 4F8TA 4QXUL 4ZUVA 3HA0A 4JANB 4RAVB 2ED8A 5HJ3A 2X4PA 4H5SB 4KVNH 1T03L 1P53A 5BZWA 3KXFE 1IGTB 1AXIB 1P1ZB 2MMXA 3V4VH 15C8L 1G6RL 5TH2B 3AVEA 4D0BB 4JGJA 1WEJH 2QQNH 3OKDA 1FZJB 3BE1L 1BX2B 3BIAX 3PWJB 5C07B 2JKXA 3SJVD 4PS4L 1KN2L 1EK3A 3OQ3B 3RQ3A 1R5IA 4JKMA 5A16A 3BESR 1A9BA 3DTXA 4Z7OF 3OMZA 2YEZA 5T5NF 1KLGB 2D9QB 3WUWG 1KEMH 4WI6A 5KSUB 3CFEB 2BK8A 3EYOB 1T1XB 4EI5C 5ISZE 2CLZA 4KAQH 4FQXA 3GI9H 4DTGL 3ROOA 4R26L 3PNWB 2IBZY 1G7HA 1U8OB 2R2BB 5C0AA 1FRGL 2D9CA 1UB6B 3LY6A 4P4KA 4WFFD 4U7SA 5CGMA 4MNGB 4NKOB 4JFEA 4MLSA 1X5JA 4NO2B 3GDBA 3SDCB 3ZTNL 4BELD 1JV5B 5EIIB 1BOYA 5CD5C 4LSTH 3WSQH 5D7LA 1N7ML 1Q9LA 2AS5M 1IC5L 1MFAL 3Q48A 1UKQA 3F58L 1HNFA 1YJDL 3BVNA 3NA9H 1PD6A 2HFFA 3OHXB 3OJVC 3QDJD 5JPMB 4LVOC 5CBAA 3IDJB 5EORH 4KUZL 4P9HL 1X5XA 3F12B 1AGBB 4HWZA 4FABH 3KJ6H 4WHDA 4LASL 1R5WA 5KG9B 4PREA 1LO2L 3OF6A 2Q8BL 5HGAA 3S4SG 4PYGA 3DBXA 4NNPH 4LK4A 3MOAH 4BKLA 3SDDB 4HPYL 4OV5A 3VH8G 3WXVL 2QKIB 2XN9A 4XP5H 3CLEH 3ULVH 1KEGL 4O51A 1FVEA 3BPCA 5I18L 4NDMB 2PTTB 4U6YA 4PJAA 5JZ7D 4F9PC 4S1RH 5B21A 1IGML 5D7JB 2IQAB 1QSFA 3S88H 2GSIA 1T5WA 3OKMB 4OBSA 1DVFB 3BGAA 3H3BC 2DQFB 4NKQB 5JW5B 3Q0HA 1BZ9A 2OXHA 2JF1A 1IM9D 4YUEH 2M1KA 3RRQA 4FZ8H 3EO1B 3FN9A 4R96B 4YZFE 2BXYA 1MPAL 3A6BL 4XVUD 2O93L 4FQJH 1U8QB 1S9VA 2W0FA 1FL5A 5J4MA 1Q72H 4ZUUA 4OV6F 3QUXB 4RCAA 4JEGB 4HAGA 3RIFK 2Q20A 1PG7W 2UWEB 4KXZH 4QOKD 5ICXB 4MJIA 4WVRA 3HLAA 3U2SA 5JOFB 4MD0A 1BBDH 4Y16A 3UPCA 4QKXB 2IPTL 1U8PA 4M1GL 5DFVC 4L3AA 5TDOA 2AJVL 3OF6D 1FIGH 1QR1A 4PGEB 4FFWD 4HS3A 4ISVB 3VWKD 3QI9D 1UWEL 4KDTC 3IT8D 5I6XB 5L6YH 5DK0B 2Y1VA 3OKNB 1E4KC 4G7YH 4M5ZL 1XIWD 3GHEH 3FRPA 5EBLA 5M94B 1XCQA 2ATPB 3TT1L 3JWNC 3MGOB 4JG0L 3LKOB 1IC7H 5T3ZL 1RULH 1JHLH 1QSFD 1P4LB 2FWOA 3HC3L 5INCB 4ESKA 2XV6B 1XMWA 4JFFE 3EOBB 3LH2L 4K94H 1YNTA 1RK0B 2CKBH 5EZIL 2XQBH 3UEZA 5ENWA 1IGJB 1MCHA 1E6JL 4EUPH 3FQRB 3BZ4B 4PJIF 5GRJH 4RNRB 1PKQA 2JELH 5J0BA 1J11A 1NEZB 3CH1A 3FFDA 2BVEA 4LKXB 3HTLX 2FEDC 3D39A 1NDMA 1PQZA 1VFBA 5DRZB 5C7XH 1UGNA 1AE6H 2MFNA 4KC3B 4PJFA 2VQ1B 4U1IA 3O11B 1ZA3A 3WDJA 4PJBB 5FOBA 3HNTH 2GT9B 4L5FH 4LEXL 2FEEL 1G7QB 5IR1B 3FOMB 1KC5L 3BZEA 1FFOB 5CJXC 4Z0BH 4L4VA 4EI5B 2D31B 3Q1SH 2F5AL 1F6FB 2NZ9C 3ZHDA 4Y16D 3BPNB 1WZ1H 3EYUH 1VFOA 5IG7A 2PW1B 1NUFA 3VDCA 3TV3H 2V7NA 3K3QA 3ULVF 3TO4C 3HS0B 1F58H 4PV8A 4I3RL 43C9B 1KTKE 3FQUA 4EXPX 4FTVA 4V1DE 3IAPA 4WEUD 4YR6B 5FGCE 4LHUB 4BFEA 1U92A 1WAAF 3WKML 3D85A 1XF3A 3MREA 5JOPD 3MRDB 4JM4H 1CT8B 4N9GA 1F4XL 4OIAA 1EV2E 1NMAH 4CMHC 3I9GL 3ARGB 5DLMH 4JZNA 4KROC 3DPBA 3HMXA 4J12A 5CSBA 3QUZD 1U3YA 3TBWA 3L3HA 1RZKL 1YQ2A 4LVOB 3U4AA 4GXVH 4PR5B 1S7RB 2V5RA 1HQ4A 1LEGB 2Y9RT 4OCRL 4D9QD 5I1JH 1NCUA 3HG1E 1M71A 4EN3A 3S37X 4HG4K 3LDBC 2BY2A 5HI5D 1NQBA 2VB5A 1QLEH 1Q1JL 2CXKA 3D39D 5DMKA 2SEBB 1BQSA 1YEKH 2H26A 1CU4H 2MSPA 4MQTB 4JDTL 2DQHL 4HUWB 4DUVA 3EHBC 4M03A 4OCWL 5D8JH 5BW7C 1SJHA 4EDWL 4TOYL 3REWB 3H0TB 1Q9OA 2I24N 4NZTL 5IFHL 1H0DB 2IH1A 3MLUL 5GRVL 4KH2A 4PUBH 1QFPA 2V7HB 5FDWB 3MV8B 3PGCB 4LSQL 2OK0L 2I60H 1D5IH 4U1NA 2W65B 4R4FH 3IETA 5B4MC 4OGXL 1NLDL 4L3ED 5FO8B 4QGTA 1LP9B 4HWEL 1KPVA 3A67H 2A0LD 2Z9TA 4W4OC 3FO2A 4G7VH 4W6XB 5F1NB 1H3PH 1ZHNB 3R0NA 3VMNA 3O3AA 2W9DL 4HV8A 5D4QA 2NZIA 3IFNL 2V5SA 5CSZA 1BIIB 4FTVD 1I4FB 3HPLA 2HFGH 4WHTB 3M17A 1G0YR 1FPTL 3OV6A 3D85D 1MHPL 3HNSL 8FABB 5L88H 2ZG1A 3TVMD 3B3IA 4FOMA 4W4NA 2EE6A 4G6AD 2NLJA 1I9JL 3QDAA 1NCAL 2H3NB 1AR1C 1NSNL 4XPHL 4ENED 1BMGA 4NUGH 3VRJB 4X7TB 1KCVH 2UZYB 4KQ4L 3CCHA 3CSYB 5DURB 4NUJA 4H20H 1ADQL 1U95A 3MLWL 4S1SH 4RQQA 2GSGA 5EZLA 1YN6A 3L3GA 4K55A 2CDGB 2YK1H 3C6SB 5C0BB 3RGVA 3VD4A 5CBEA 2WWKT 1RJLA 4AIOA 4JM2A 4MZ2A 4B50A 1CXLA 3HMWL 5I17A 4HS8L 1KCKA 3RWHB 2X4RB 1CL7H 4JN2A 1DQJA 1KXTB 2VZSA 2ZCHL 3VFUB 4N68A 5FO9A 2VDML 5JXAL 3NGBC 4K3EL 5CP7B 4LEOA 5AUMB 3WNOA 2O26U 4GFTB 4HWUA 4JHAL 2VE6A 3LEXB 2DDQH 1N6UA 4DKEH 4LLVA 1JWMA 1AHWA 4XPGL 2VIRA 1UYWH 5I30L 2ZKHL 1X5KA 1A6AB 3MOBH 1XEDA 1HSAA 5HHOA 2J8OA 5A2IH 5TDPA 5IK3A 3FFCB 3CIQA 2HH0L 4JLRB 5KN5A 4QRUB 3C9NB 4U1GC 1A7OH 3F8UB 1I75A 3VCLA 3S97C 2EIZB 4P4RB 5I2IB 4UU9A 1C1EL 2FYYA 5A1AA 2ZG2A 2IBGA 3PIQB 4D9LH 1A7QL 1OQOA 2PYFA 3BKML 2IANB 3FMGL 1CDCA 4Y89A 1DL7H 4N8CH 4HBQA 3U0WL 4JRXA 2E7CA 2AJ3A 4NWTH 1TJHL 4X80H 3UTSD 4LQ1A 1ZLWH 4OZHB 3CMOL 5D71H 5IUSA 3K8LA 4RAUA 2J4WL 3MUZ1 4UDUB 3CZJA 1MIEL 4CMHB 5BVPL 3P4OA 1MCWW 2KH2B 3U1SL 3WHXA 4N8VB 4WGWB 4YQXH 5JZ7C 4L8DA 4OF6A 1S5IL 3EYFA 1I7RB 4YHOL 2VZ1A 5KS9B 4ZG1A 3X3FL 2RFXB 2D7MA 2XRAL 1H5BC 3LDBB 2V2WA 2W9LA 5EU7C 3K0WA 4TNWK 4BH8A 1Z6JT 3HAEA 3KNBA 1BHGA 2EDTA 3SDAA 3U4BH 5I66B 2ITDA 3ZDYE 4XI5D 3EDJA 2IF7A 3MUJA 4MNQE 4O9HL 5HVGB 1JNHB 4XMPL 5GJSH 4WHYG 5I1EH 1A7BA 4X6DE 3PQYA 5DWUH 1RUPH 3FAWA 4NZUH 3TM6A 5JOEA 3MRPB 4XVUC 3IXTB 5F1KC 4EDXA 5IGXL 3B9KA 4GAYB 4QGYA 1RU9L 3SE9L 1NL0H 3TBVA 1C16A 1UB5A 4MCYB 5FYLD 1OAQL 1JZ4A 5E8PA 5B3JF 2JCCB 5AWNL 5FKPA 1OP3K 3F7PC 1HXYB 3DVGA 4X6CA 2YBRA 2BNUA 4UBDD 1TZGL 5BRZA 1IBGH 4E5XB 5IFJA 1KIRA 1SJEB 4IOIA 3VDBA 3MLYH 4ZSOB 5SWQA 4M3KB 1A7NH 1KUMA 4F37F 1A1MA 3BWUC 3R4DA 2BVUA 2P46B 1G9MC 4FFWC 4WHCA 3RUGF 5SWZE 3VFMB 3VWKC 1QFWI 3QI9C 5LVEA 4PGDA 1PG7X 3W81A 2BOBB 1YDPA 2P8LB 1HHJB 4QT5A 4XMLH 1XIWC 3P9WB 2AEPH 4RGNE 4NZJA 3IDMA 3PGDB 4UB0H 4Z78B 3DLQR 5C0CB 3BWAB 1RUAH 4P2OA 5EC2A 2BVYA 5C6PB 3J8F7 2F9BT 4OZIE 1V8HA 5I19H 4WI5A 3G5XA 2FH6A 2IG2H 1NDGA 3VFRB 3V8OA 1I8KA 4KRPD 1I3RA 1NCDL 2A9NH 2VITB 4YHYC 1CGVA 5GSVA 4U1SA 2X4NB 5DQDL 3TBYB 5D6CA 2DRUA 4IRSD 3F7YB 4NRZB 1J0HA 1HH9B 2B1AH 5FYJE 2P7TB 1XF2A 2J7LA 3TCLB 5DEFB 3O3EA 1JPGA 4HIIB 3PQYD 3FQXB 3SJVB 5DC4B 5IHZB 3ECBB 1JHTB 3TFKD 4LKCB 4O2FB 4HIJB 4KTEL 4UMGA 3VGGA 1NC2A 3LIZH 4ACPA 5I16B 5ILTH 1B6DA 1FYTE 3NGBB 1JPST 3DX7A 4NKMA 4Z7OE 1T7YA 1V5JA 1S7WA 5IB1B 4Y16C 4Q74A 2VZVA 1RZJL 5JW3L 2GTZA 5E5MB 3KYMB 2EYRA 3CDGA 2QQKH 3QEQA 3RTQA 3UZQA 4FRWA 4S2SB 5CGYD 2G75B 5GRVK 1T22B 3MLPA 1MJUH 5IOPB 4LIQE 2BNQA 5J12C 2VDOL 2XG5A 3MRRA 1SVCP 4NHCL 2R0KH 3OKYA 1SY6H 1H3WM 2ZUXA 1K4DB 4Y1AB 2P5WE 1EFXD 1RHHB 1DQMH 3OAUH 4WNQB 3EYSH 4PB9L 4QHKI 1MLCA 4P2OD 1YC7A 3HC0A 2PYEE 3QDJB 5EU6D 3QUZC 3H8NA 4O58L 1KT2A 1OQXA 3ES6A 3IU3A 3IDNB 3BSZH 3U4EB 4NKIL 1MFEL 2MPAH 3MRIA 1EMTH 4ZUVB 1FGVL 2FR4A 5HJ3B 5DRWA 3B83A 1DANT 2X4PB 2AI0H 4S1QH 1ZVHA 1CDIA 5HI5C 4U1HA 5DD6A 1MHHA 5BZWB 2AW2A 4QRRD 1MCCA 4PJXE 2GK2A 4WWKD 2HFTA 3R8QA 4K7PY 3GI8H 5C08A 3OKDB 4QLRA 5GS1C 5ELIA 1BIHA 4NQED 1MOEA 3QIBA 1UG9A 5DK2B 4ZS6C 5A16B 1DBAL 2PXYA 5HD8D 2NCMA 1A9BB 3DTXB 5KVFH 3M45A 4CN6A 2YEZB 3G5ZA 4N90D 4NJAH 3RL1B 1BZ7A 4R7DA 4DW2L 4DGIH 2VSDA 4K3HA 4FQXB 4UUJA 5EU4A 1NGXA 1P5VA 4POZD 3MNWA 2R0LH 5GQBA 4LSUH 4IS6A 4PJ8D 3M1BB 3ROOB 1DUYB 1CYGA 1QFWL 4NP4H 5C0AB 2J1KA 3RTQD 2B5IB 4LPXA 2A0LC 5MP6H 1KG0A 4P4KB 2ESVA 3JVGA 3D5OF 5D2LA 1AXTL 2NW3A 4JFEB 1RZ7L 1AO7A 2R4SH 4YX2L 3C8HA 1TCRA 1P84J 3EUUA 3I75A 3MJ8A 4ZPTA 2BNQD 3MBEA 4JB9H 1YUHA 5D7LB 3SGDI 1TTGA 2EDEA 2F5BL 1FNSH 5SV3A 1E28A 2E27H 3D3VD 5IMKA 5DA0B 1Q9LB 4JFHD 3TVMC 1A3LL 3MV7E 2VLMD 1QHPA 3BVNB 2HFFB 4Z7VB 2G9HA 4G6AC 5CBAB 2ORBH 1A5FL 4WFED 5GGRA 1GGYA 1HIML 2UWEF 2E7MA 4ENEC 4YHKL 1R5WB 4PREB 1RURL 4QHLA 5F7DA 4HC1A 1OAXL 3DBXB 4M7LL 4FFVD 3RNKA 3FO9B 4JFDE 4XMKH 4BKLB 4HBCH 3SOBL 4OV5B 2X2YA 2ZUQB 3G04A 1XIWB 1RZ8A 5BS0A 3QIBD 5CEZL 1WVZA 1J8KA 4O51B 1FVEB 3BPCB 3THML 4U6YB 2OR9H 1QRKA 4PGCB 3CVHA 2GYSA 3UX9B 4DKFL 1QSFB 1UWXK 2FIKA 4NFBA 2Y5TA 5GGTH 2GSIB 1T5WB 1PSKH 4G3YH 4U05A 1T5XA 2YC1B 3DXAA 1HYSD 1U42A 1PZUB 3ZKQD 5FOJA 2DQJH 6FABH 4LVHC 5F6IC 4YHYB 1YEHH 4PJGF 2EEDA 2Y6SD 3W0WA 4EIZC 1MEXL 1R3JA 3C2SA 5ACZA 4OD2A 2R0WH 2HVJA 4X4ME 5EU5A 4YDIH 3UJJL 2PETA 4GW4A 4PP1D 5EB9A 5IHBA 2N56A 4KGLA 1S9VB 1CF8H 2W0FB 4ZUUB 1BJ1H 3T0ED 1J1OL 1FNAA 4Z7NF 3NFNA 3FQWA 2XTLA 4H88H 4PLJD 3UC0H 3TNNA 4PJBF 4JVPA 1TJIH 1I3VA 2VLRA 2OJEA 4RFOL 3HLAB 4RMSA 1GHFH 2CMRH 3OXSA 4XWGL 4Y16B 1XF5A 2X4TA 4YK4B 4ZXBA 5FO7A 1EAPA 1U8PB 4R97C 5H8DA 3QIWA 5TDOB 3GMLA 3QQ4A 1QR1B 4W70A 1MFBL 4HS3B 3DUSA 7FABH 5FA4A 1UXSA 4LMQI 1YPZF 4YXHL 2B20A 4DGYL 3DNKA 2E6JA 5J12B 2HRLA 5KVDL 4GSDL 4YHIA 4JFQA 3RWCA 1OSPH 2W91A 4PPTA 5EOCL 5BS0D 4N5ED 1G7JB 2QL1A 5EBLB 1FIEA 4PD4K 2YD1A 1XCQB 5FXCH 3SY0A 2K1MA 2FWOB 4O5LH 3MRFB 2VR5A 3JUZA 1MAKA 1YNTB 2FBJH 5I1KL 3UYRL 3ARYA 4Y19A 4XX1G 4J4PD 2NY7H 4MQXD 1J0ZA 3GEWB 4M7ZC 3AS2A 3W0WD 4KQ3L 1PKQB 3U46A 3ZT5A 5DDHA 3CH1B 3FFDB 3H9HA 3D39B 1B90A 1PQZB 1VFBB 4XI5C 1F3RB 5HDBF 5GS1B 4U1IB 4PJFB 2AV7A 1EPFA 4RMWA 1JPFA 4F33A 5FOBB 5TQ0H 4M6NL 3B2VL 3BZEB 1MRFH 1N6QL 4TVPE 4L4VB 4DOHB 1WFOA 1INDL 1JP5A 1DQTA 1OD9A 4NQCA 1MCBA 3REVB 4HF5L 5K59F 1JYXA 3NN8A 1YECL 4URTB 4ZXBD 4UBDC 3HI6L 2DB8A 5FYKL 3GMOA 4KMQA 1MREL 5ABDE 1VA9A 4YBQD 3VGEA 1BQHG 1J0IA 4PV8B 4OZ4B 4KI5D 4OFDA 1X5HA 3GMMA 5IROC 3FQUB 4FTVB 3NZHH 2A6JA 1I9RH 4HLJA 4GAJH 4UIMA 5TPWH 1U92B 4TPRH 3BOVA 3D85B 1FGNL 1ERNA 5FAAA 3MREB 4XNXL 2BMKA 3TVMB 3JWOL 4KHXL 3LKSA 4JZNB 4Z0XA 3TBWB 3L3HB 2CO6B 5ISZA 3LMJH 1KCRH 2CIIA 2ZP0T 1HQ4B 4TULL 4Y4FA 1DEEA 5CIPH 1M71B 4EN3B 4Y19D 4X6FA 1HHKA 5DHVA 4X4YB 3RBSA 4KRPC 4UIKH 1NGZA 4XB8A 3L3DB 1M7DA 2C3GA 2AXHA 3P11H 3QAZB 2NX5D 5DMKB 5K9OB 1N5AB 2H26B 4IRSC 1FDLH 5JMRA 4NGHH 2AABL 3U7WL 5KSVA 1SJHB 4L4TA 1Q9OB 4G42A 4U7KA 3B43A 4M02A 4OLUL 4U1JA 5I74C 2LQRA 3VD5A 1MF2H 1ZLSL 1YEFL 3O45A 2ZSVA 3IETB 4JFPA 4NCDA 1KPVB 1BFSA 1LO0H 2GFBB 3FO2B 1HK6A 3A6CH 3P2TA 4HKXA 2B0SH 3O3AB 4ALAH 4HV8B 1DN0A 1LO3H 5CSZB 2P5EE 3BKYL 3P4NA 3PXJA 5B38A 3HPLB 5CGYC 2AXGA 4O2EB 3FAXA 3M17B 1T7WA 3L5JA 5C2BL 1YEEH 4TSAL 3CFKA 3P0VH 1GH7A 3TZVA 1EERB 2L7UA 1A9EA 4P3DA 1PGRB 3INUH 5ADPL 1A8JH 1OSZA 1KPUA 5E2TL 2NLJB 1L7TH 1WTGT 4P2OC 3BMVA 4RGMC 1I8LA 4XZUA 1IC4H 3ZTJH 4HXBL 3HE7A 4Y4FD 4MA7L 4R97B 4HQQH 5IVXF 3IU4L 3CCHB 4NUJB 4BFBD 4XNYL 4RQQB 4RMTA 3HZKA 2GSGB 5EZLB 1S9XA 4ODSH 3QDMA 4OGYH 4U6VH 2XKSA 1YN6B 2O5YH 3L3GB 2VDQH 3RGVB 2PN5A 5GIRA 5CBEB 1RJLB 2I25N 4GBXA 4WWKC 4JM2B 4L4TD 1KENH 5I17B 2UYLA 1DP0A 4DUXA 1D5MA 4JN2B 1DQJB 2GTWA 4PGBA 5HD8C 4PJCF 2IFFH 2AJUH 3QYCA 1EGJA 2XXMB 5HHME 2GJ6D 4LEOB 2ILLA 5IQ7L 3V4UH 1CK0L 4POZC 4G9DA 4PJ8C 4JFXA 2Y25A 3KR3H 4M7ZB 2EECA 3SKJH 2XYCA 5KS9F 2VE6B 2OJZL 1X44A 5EO9A 3RTQC 2UZIH 3O4OB 4LLVB 1JWMB 4L9LA 1AHWB 2VR9A 3LPFA 2VIRB 4RIRA 5GISH 4OD1L 2V2XA 1QFOA 3VFGH 3WDIA 3CMGA 3ZYJA 3G5VA 2D0HA 2O5XH 4WV1A 2AKRB 5E9DA 1ZVSA 2NY0C 1HSAB 1YYMH 5TDPB 2V17L 3ILQC 5IK3B 2QADD 3VFNA 5KN5B 3CFCH 3J7HA 2A77L 3QFDA 5IW3A 3VCLB 5F7HA 4U4BA 1F90L 4WUUA 1P7KA 4F7CA 2FYYB 1MY7A 3LEVH 3PHQA 5A40E 1K2DB 5TE4H 4YBLC 3PWNA 5C0RL 5F1OB 1ZHLA 4JRXB 4JZJA 5I15L 1J88A 1ONQA 4IJ3C 3UTTD 2AJ3B 2YXFA 5KW9H 3WFEL 3M07A 3U30C 2DLGA 3DSFH 4FFVC 1ZGLM 4EQ2A 3V0VA 5T3ZD 3NFSL 3RI5F 4R90L 3D69A 4MAUH 4WI2A 3DVFA 3QIBC 3P4OB 3T4AA 2BSSB 1U8MA 3NAAH 3WHXB 3E3QC 4D9RE 5LQBH 3EAKA 4L8DB 4RRPG 1BEYL 4MXVF 3ARWA 3EYFB 3GSVA 2HT3C 1A0QH 1AY1H 1Z3GL 4Z95H 4JRYD 2LVEA 5C0EA 1HYSC 2V2WB 1ETZA 4RDQG 4KRPB 4BH8B 5C70A 3HAEB 3KNBB 3SDAB 3D87B 3S7GA 2HJLA 2Y6SC 3WMSA 2ITDB 2V6HA 1U58B 3SKNA 5GRUH 3G08A 2ADFH 3RZCA 3K1KC 5EDXA 3P30H 1KGCE 4HUVA 1H3UA 5E9DD 2FX7L 1IKFH 4NZRL 3PQYB 2VUYA 4PP1C 4WCYL 3M8OL 2A74A 3IDYC 4EDXB 4LAQH 3TBVB 1NAML 4PRPA 2CUMA 1C16B 1UB5B 4WUUD 3T0EC 1G9MH 3WO4B 3BKCL 5E8PB 2Z8VC 5FKPB 3HI5L 1QBBA 2NY5C 4PLJC 3DVGB 2FO4B 4X6CB 1PLGL 2YBRB 2BNUB 5BRZB 1CLCA 5C07E 5D1XA 3SDXF 5IFJB 4MAYA 1I8MA 5DJ6A 1RZIA 4ONHA 1JZ5A 4HCRH 5MERA 3MRKA 2JB5H 3MBXH 4P49A 1WT5C 1E4JA 1AFVH 3LKQA 4PGDB 1QRNA 4XPAH 1YDPB 1CCZA 4XCCL 4QT5B 3MV01 4ONFH 5D5MA 1GZQA 4RFNC 1TQCC 2CR6A 4N5EC 3T3PF 3IDMB 3FL7A 4MNGE 4ZTOL 3D0LA 1JZ6A 3D2UA 5EOTA 1JPSH 4M7KH 2F8OA 1HDMA 2FH8A 3BKJL 4P2OB 5EC2B 4RGMB 3T04D 5EU6B 1N59A 1DFBH 1ZOXA 3JTTA 2BVOA 3KVQA 4CVZA 2DN7A 1CD8A 2VXSH 3BO8A 3G5XB 5ESAA 3RJDA 5E99H 5DYOA 4M8VA 4HJGA 3IKKA 1I8KB 1KCLA 1I3RB 2CRZA 1P7QD 4J4PC 4MQXC 4G80A 4C56A 9CGTA 4U1SB 4KTDL 4JO2L 4LSVH 3O8XD 4WRLA 3ZHKA 1MCKA 1NFIA 3MODL 4FFYL 4NFCA 4WW2A 4Q0XH 4DKDC 2BFVL 1RUMH 3O3EB 5F93C 1JPGB 1XF4A 4OUUA 1VEPA 3RY6A 2NY6D 3UBXI 1U0QA 1U8NA 2D7QA 4NQEB 5E8NA 3X3GL 4Y5XA 4PRPD 1AQKL 5F7KC 5JLZB 3ARSA 3O2DH 1Y6MR 2DQUL 4GUPA 1DR9A 4ZPVA 1MCFA 3BDBA 2APWA 4FHBD 3DX7B 1BP3B 5LCVH 5IMMA 2EXYD 1R0AL 4UZGA 3N1PC 2HN7A 1C5BH 4PJ8B 5LAXA 5I1LA 2GTZB 3G6JA 1BPVA 2EYRB 1B9ZA 3CDGB 3RTQB 3LRHA 5TE7H 4TUJA 1KFAH 4YBQC 2XKNA 4K8RD 5FUZH 3MLZL 4KI5C 3VWJA 1TQBC 5ICZA 1YQVL 1I1AA 3QCTH 2BNQB 3QUMA 1PYWA 3MRRB 4KHTH 4D94A 4BZ2L 4OJFH 4OT1H 2DMKA 5I1IH 1MLCB 2R8SH 2F74B 4HXAL 1DBMH 3HC0B 3KPLA 4M48L 5L2JA 2OQJA 1QFUL 3ES6B 3OWEA 2NY2D 3IU3B 4ZO9A 2V9TA 3MRIB 4Z7VF 1OT2A 5HI4D 4XP1H 2FR4B 4IJ3B 5DRWB 2PR4L 3TYFA 1KACB 2UWEE 4U1HB 4OTXH 3U30B 4X7EC 5DD6B 1MHHB 2GK0A 4HK0B 3OPZL 5E7BA 1QNZL 5HBBA 1DQLL 3CLFL 5F9WB 2BHYA 5HPOA 4MZ3A 2NY3B 1GAFL 4PRIA 3K7UA 3ZSTA 3FRUA 5C08B 3QIBB 4JQVA 3ALXA 1INEH 2ADIB 4A2LA 2PXYB 1OCWL 3G5YA 1BECA 3G5ZB 1KCUL 1HQRA 2WNGA 4O02H 4R7DB 5DUPH 1UEYA 5GHWL 4GKNA 2DIJA 2DKUA 3WFCL 5KSBB 4NQVA 1M1SA 4LOUD 5EU4B 1NGXB 3K8KA 4IS6B 3NCMA 2B4CC 4RWHA 3HE6A 1F4WL 1BFVH 4MA8H 3TP4A 3IDXH 1KG0B 2ESVB 5D2LB 3WE6A 2NW3B 2Y06H 4OFPA 1AO7B 3BW9A 2ZOKA 3HMXH 1TCRB 3PDGA 5CSGA 3VWJD 3I75B 4ZPTB 1I1AD 1P6FA 3X14A 3MBEB 3O4LA 2PO6A 1P9MC 3VD9A 1YUHB 1NBYB 2YS4A 3WDHA 5AG9A 2F53A 1E28B 1YJDC 5GGVY 5IMKB 4X0KA 1T21A 2FATL 5CJQH 4WI9A 2UUDH 4WDIB 2VZTA 5D7SH 4GAGL 1T0PB 3OR6A 5DD1L 2AEQL 2ZPKH 4ONGL 3BPLB 5L8KB 3BIKA 5KVEL 1FE8L 2EIDA 5GGRB 3WFHA 2RB8A 5IV2B 4PJBE 4U2ZA 1VFAA 5I8OL 2DQIH 1V7MH 3ZDXF 1HWGB 1DDHA 4QHLB 4TVSa 5F7DB 2DD8H 2EE2A 4OI8A 1E4XL 5JHLL 2V2TA 1EO8H 4WHYH 1HCVA 5HY9A 4I18A 1KBGH 3C5ZD 4IMKA 5D7KE 1RK1A 1PEZA 2D7TL 1FHGA 3BD4A 1T1WA 5MHSD 1CICD 3G04B 4ERSH 1SM3H 1AQDB 1BAFL 1RZ8B 5BS0B 4BSWA 2CR3A 4MSWA 1D5ZA 2P1YA 4NJ9H 1ODAA 2HLFD 4OF5A 3CVHB 1EHAA 1BBJB 2FIKB 3I6LD 3MLTA 4PFEA 2IADA 2DM3A 1TFHA 1JTOA 3BH9A 4JKKA 4PY8J 1T5XB 4G43A 1IGFL 4E42A 3PDOA 4OI9A 3EFFA 4M7JL 4GQ9H 1KJ3L 4HFUH 1OGTA 3W0WB 5JPNA 1OW0A 1N5YH 1S9YA 4RWYH 3D25A 3O3BA 1KN4H 1XR8A 2O61A 4OD2B 4G5ZL 2HVJB 5EU5B 4NOFA 4GW4B 4HPOH 3RA7H 5IWLC 1CBVL 4Y4KA 1JNNH 2HKFH 5HDBE 3RWGA 2QADC 2MKLC 3MRQB 3CFJA 4ZFOL 5EUKA 3NFNB 4UV7H 1P5UA 4PJFF 3FQWB 4DVRL 5DZLA 4H8WL 3TNNB 3S36H 3NCEB 2OJEB 4P5TD 1I8LC 5IHUL 3GZKA 4U3CA 5MI0C 3FHAA 3OXSB 4IEFB 4NQXA 1XF5B 2X4TB 4ZXBB 2VDLL 5FO7B 3S6CA 3FQNA 3QIWB 1UWGH 2Q86A 1OP5K 3GMLB 3QQ4B 1D6VL 1T7VA 3U48A 1OTUD 3DUSB 5FA4B 2G60L 3QXVA 1UZ6E 4FP8L 2CUHA 3O9WD 5TGBA 1LP9E 3V0WL 4JFQB 3RWCB 1JTPA 3ULSA 1DQDH 1J5OL 3PV7A 5F7YC 2OI9C 1JN6A 2EKJA 4WFGE 3SY0B 2CDEA 1IT9L 1R3KA 3QUML 1CFSA 4JAMA 3WJJA 1UZ8A 1JWUA 4HJJL 1FC1A 3I50H 4P99A 1MCPH 2Z35A 2FZ3A 4D3CH 2B8OT 4ODXA 4Y19B 1T66D 3AROA 4M5YL 1J0JA 4XRCB 4M1DH 3RAJL 3U46B 4GKSA 5DDHB 5FYLH 2OP4H 3W9EB 5TQ2L 3V4PH 1A6TA 4U7MA 1RIUH 1JGUH 1MWAL 5DC9B 3EOAA 4WV1C 1QO3B 4Y4KD 1JPFB 2YWZA 5DT1H 3QEGH 5EZOH 4F33B 3SQOL 1CR9H 1YMMD 5SWSA 1KIUA 5ECJE 5F8QC 3T0BA 2H2PC 3QZWG 4HK3J 2O5ZH 1ZWIA 5C0BE 4NQCB 5DHXB 2GY7B 2W92A 3IXAA 5D70L 4B7IA 1UACH 1U8KA 3LZFH 3NN8B 3IB4A 1BJ8A 3GMOB 1CLYL 4GO6B 2E9BA 2K7PA 2XA8L 3G9AB 2XT1B 3WL9A 3GMMB 3S36X 4L1DA 4UINH 4KK6C 3RKDD 4Q9RH 3LPGA 2GI7A 3TWCL 4UIMB 3VGFA 3MCLL 4HGWB 1N0LA 4PP2A 1MY5A 3B9EA 3GRWA 2BMKB 5GZND 2YA1A 5L7XH 2YRLA 2VZOA 2AK4A 1RZKC 2W60A 3LKSB 4Z0XB 2DQGH 3GSNA 2IPUK 5EULV 2NTFB 3QPXL 2CIIB 12E8L 1T83C 3ZKMD 4F7MA 4Y4FB 2XICA 1DEEB 1FN4A 3FFCE 4PG9A 2ZJSH 3S5LG 5C86A 4X6FB 1HHKB 5BO1L 1ZANL 1I7TB 2EDJA 3VXNA 1NGZB 5C3TA 1M4KA 1UM6H 1KJ2A 1A2YA 5CGTA 4ZAKA 4ZNCD 1QQDA 4LQFL 2X1XR 4OM0L 3G6AA 1J0YA 4GKOA 3O8XC 4IM8A 2IANE 3I6KA 4KY1L 4OLXH 4UQ3A 4YFLF 1WWCA 5KSVB 5IT2H 5KJRH 4L4TB 4G42B 2VMFA 4C58B 2UY7A 1GGCL 2NY6C 2FBOJ 4NT6A 5SWSD 5BMFH 4YXKL 3MV7A 4U1JB 1IGIH 3ZYIA 3KPOA 5JA9A 2EO9A 1V3JA 4OZHE 2QBWA 3O45B 1FZOA 2ZSVB 4PD4J 4JFPB 1KJVA 2EXYC 4MVBC 4QRPD 4YDJA 5DSCA 3VFOB 3CU1A 4N8PA 1RY7B 1W72A 4DFHA 4GG8A 1F3JA 5F7MC 3CK0L 5ITBH 4N5UA 3CJJA 2OZ4A 1LEIA 3IYLW 2XKUA 5E2WH 1DN0B 5KS9E 3P4NB 5KAQG 5B38B 4K8RC 4YWGH 4DQOH 1N8ZA 4QTIH 3U36A 4L9DA 1VEOA 5IBTL 3CFKB 1MJ8H 2DQEL 3TZVB 4K9EL 4KK8D 1A9EB 4CADA 4P3DB 3HI1A 3BRDA 1MIML 4IHOA 2QADB 4ODVH 4PLKD 2YD5A 1KPUB 5L8JB 3Q5YA 5HYJA 1LK2A 1QBLH 3FJTA 5F7UA 5I76A 2DQCH 4FQLH 4XZUB 1WZLA 3HE7B 4OKVA 5E2UH 2NY2C 1OVZA 4OKDA 3P0YL 2VISA 3QO1A 4YDLC 5HI4C 3ZKXC 4NQUA 4JGUA 3L7FA 1U36A 2JCCE 3HZKB 4KKBC 5BCAA 1S9XB 4ZAKD 3QDMB 4MWFA 4UT6L 1L0YA 5KVGH 3HUJA 1W0WB 2YOCA 2APVA 4PJIA 3ARUA 4QYOB 3PF2A 3CC5A 5GIRB 5B3NA 4OZFG 1ZGLP 4GBXB 1K4CA 4ZSOE 5L2KA 4Y5VA 1GC1C 5EA0L 5EWIH 3RVUD 2UYLB 4MA3A 35C8H 1D5MB 4GMSL 5FYJL 4PGBB 5HDQH 1SHMA 1BD2A 4OLVL 5FGSA 4U3HA 4OB5L 3ARXA 3HC4L 3BRFA 1OARH 4LOUC 3N1FC 1HINL 3V5DA 5CEXA 4G9DB 5HGHA 5C0CE 1YYLL 3ETBF 4G6KH 3DRQA 4Q9QH 2KPNA 3ALWA 3L1OH 5BQ7A 5EO9B 4MXWH 2OR7A 1DCLA 3OJ2C 2R69L 1NCNA 4L9LB 4G8EA 5E0QA 4RIRB 4PJEA 2V2XB 2DQDH 3G5VB 3O2WL 3VWJC 4WV1B 5E9DB 1I1AC 1ZVSB 3MRCA 4NBZB 4WUKL 3RX5A 5CZVL 2EDXA 1GGBL 3C6LA 3NIGE 3QFDB 1WAAA 4CNIA 4P2RA 4K71B 4WUUB 4HEPG 1W0VA 4LIQL 5HYJD 1EHLH 4ZO8A 2MQCA 4F7CB 1TTFA 3PHQB 3UYOD 4C4KO 5HVFB 5ALBH 2Z8RA 4G8IA 1G9NL 3SJVE 3T4YA 4AEIH 3O81A 2C3HA 4YDVA 3PWNB 4NC1E 2D7NA 1ZHLB 4X6CF 5HSFA 4JKPL 3VFSA 1QUNA 1YNLL 2X1WL 1ONQB 3MRBB 4JZJB 3U6RA 5ESQA 1J1PH 1U3HD 5GGQL 3C5ZC 3V0VB 1TMCB 4OLWH 3KLAA 2Z91B 3D69B 1CICC 3QXDB 4WFFE 5D1ZA 4JO1H 1U8MB 1I9IH 3MRGA 5T3XD 3ESUF 2HLFC 1JGEA 5IEHA 4JDVB 3BEVA 3GSVB 3GRWL 4NZDA 1TVBB 3OKKA 4HD9A 4Y1AE 3WNLA 3C08H 3ZHLA 1TDQA 4ETYA 1ETZB 4JO4H 4R9HA 5MENA 1QBML 4LLQA 5KANI 3ME0A 5BXFA 3AY4C 5B8CA 1P7QB 2HJLB 1ZLUH 2Q6WA 3HR5A 4IRZH 4U31A 3QDJE 3F7QA 3H7LA 4AM0B 3FO0H 3SKNB 3G08B 1QSEA 3RZCB 4MNHA 5CJOL 2NY5H 4ZTPL 4HUVB 4EOWH 1EJOL 1TENA 2CK0L 3IFOA 2MCPL 5TDNA 4MGXA 5CEYB 3C6LD 1NJ9A 4HZAA 1E27A 2YXMA 2A74B 3U0TA 1F11A 1JNJA 2YMXL 4PRHD 4P2RD 4PRPB 2OX5A 1RUQL 1NBVL 1G0DA 2L0DA 1DUZA 4HC1H 2CKBA 2YD8A 1PFCA 4PYHA 4EUPA 3ARDA 5D1XB 1MCQA 5DO2D 4P5TC 1FORH 1I8MB 1PX3A 4PJHF 5FIEA 1AGDA 1RZIB 5DJ6B 3O6LL 4FZEL 4ONHB 4YXLH 4MYWB 2QQLL 2X9YA 2ZSWA 3NACH 5F1SA 5MERB 3MRKB 4KXZI 4BK5A 1OTUC 4AL8H 1NKRA 3CVHH 4UILH 3VG0H 3LKQB 1KPRA 3UROR 4KVNL 5TF0A 4QY8A 2VWEE 3O9WC 4GRLC 1ZA6B 5C0AE 2GW5A 3V4VL 5E6YA 2CO7B 5D5MB 1Q0YH 2VERN 1EXUA 3D0LB 3ARED 3D2UB 1WEJL 2QQNL 4JFEE 5EOTB 1F00I 3GJFK 4J3UA 1QTYT 1DQQA 4PIRF 5T1MA 5DJYB 1TNNA 1N59B 3JTTB 2BVOB 5IB3A 4KJYA 5D7LE 4CVZB 1MHEA 5ESAB 1DSFH 3L9RA 4HWBA 3OJMB 5DYOB 4HJGB 3C2AH 3ZKXB 4YDLB 3O0RH 3V5KA 4KAQL 3D0VB 3LKNA 3GI9L 1T66C 5FCSH 4G80B 4C56B 4Z7VE 1KCSH 3GJEB 3VFTA 1LDSA 1QSED 4KKNA 3QFJA 1NFIB 1YNKH 1J8HA 5DD3H 4N0CD 4QHKJ 1XF4B 4OUUB 2IALA 2A6DA 4YFEA 1U8NB 5E6ID 4LSTL 4Y4KC 4Y5XB 5E8NB 4XCFH 3WSQL 5C0JA 2GAZA 4LCYA 3ROLA 4Z8FH 1DZBA 1KIQA 4GUPB 3MXWH 4LFHD 1DBJH 4K2UH 3EYQD 4OFYA 5DEGA 4XCYA 2XN9E 1F5WA 3NA9L 2HN7B 2H8PB 4LCIH 5LAXB 5HYSG 5I1LB 3EDEA 3PUCA 5KSBF 3KS0J 3QJHA 3G6JB 4FQIH 5EORL 1LNUA 1QSFE 2R1XA 3JWDC 4M93B 2APTA 4TUJB 4FABL 3KJ6L 3KYOA 5T1KA 4LNVA 3SE8H 3ZKND 5I75B 2E7LA 1N4XH 1CWVA 3VWJB 4EVNA 5ICZB 3DHMA 1I1AB 4ZYKA 4KJPD 4DK6A 1A3QA 1PYWB 4B0MM 1CG9A 4NNPL 5EOCJ 3UZEA 3MOAL 4X5XB 1YA5A 4NQDD 5GZNC 3PP3H 2VKWA 3AS0A 4XP5L 2VXQH 3CLEL 3G9VA 5IBUG 3ULVL 1MQKH 1EAJA 5GRYA 4OCMC 3KPLB 3VXRA 5L2JB 2OQJB 2NPLX 1KN2H 2H1PH 4S1RL 3S88L 4YAQA 1JMXA 3ZKMC 1NCTA 4LF3A 1QEWA 3TYFB 1A6WH 1X4XA 4Q6IA 1M7XA 4RFEB 5EU3A 2GK0B 4MJIE 4YUEL 3TCXA 3VD7A 2FHCA 3C5ZB 1PKOA 4PRIB 3FRUB 5B22A 4FZ8L 2B4CH 1QYGH 3MRLA 2DKMA 2XPGA 3RWDA 3GSXA 3G5YB 1U3ZA 4KK5D 1HQRB 1JBJA 5IIEB 4G6MH 3GUTA 4FQJL 4JQIH 3QT2A 1Q72L 4GKNB 4OFYD 1V05A 1OL0A 4NQVB 1WIPA 3F65A 3SGEI 1UC6A 1HE7A 3OAYK 3HE6B 4PRBA 1U41A 3HCVB 1BBDL 2EDNA 1XGRA 3WE6B 5T1KD 4MD5A 4ZDHB 3BW9B 2ZOKB 1FIGL 2APFA 2IBBA 4R3SA 1VGKA 2NW2A 3X14B 1HHGA 1WISA 3V7AE 4D9QE 3RUGA 3O4LB 1LO5A 3B4NA 3E8UH 2DTSA 2F53B 2BSTA 2VQTA 4LFHG 4G6JH 3W5NA 1J12A 5J11C 3V5HA 5L6YL 1PKQE 1C5DA 1T21B 4KK8C 3V6ZA 4G7YL 2OL3A 2I9TB 1EDQA 4PLKC 4PJ5D 2P43B 4TUKH 3OR6B 3D39E 3GHEL 3ILPA 5FK9A 5CWSB 3MYZA 2BCKA 3EGSB 5DGRA 3BIKB 4I8DA 2VLLA 1IC7L 2YD3A 1RULL 4PJFE 1JHLL 3T65A 1CVRA 3WFHB 2M8XA 4OIIH 1VACA 4PJDB 1VFAB 3DVIA 4NO0D 1WCBA 4K94L 5I9QC 2WIIA 1DDHB 1EIBA 4L4VE 2CKBL 4DOHE 1JJUA 2XQBL 2V2TB 1WFUA 3MNVA 1RFDH 4B5EA 5HY9B 5GRJL 2EDQA 1RK1B 1T1WB 2JELL 4KI5F 4YC2C 2E9JA 3E1F1 4MSWB 1EH9A 1AE6L 3RVUC 4GG6F 4FTVE 3WS6C 4EXKA 3HNTL 4L5FL 3MLTB 2IADB 3DO7A 3WXWH 3BH9B 4Z0BL 5C07A 4WIQA 4G43B 4E42B 2J8UB 5E5RB 3PDOB 3LOWA 1CL7I 1KLGA 1OGTB 1WZ1L 3CZFA 3EYUL 5JPNB 1P69B 1QLRA 1NAKH 5KSUA 1S9YB 3KPQA 4AJ0A 3D25B 1S7VA 5HDLA 2O61B 4LRNL 4XNMA 3TV3L 1F58L 3SE4C 5E03A 2DKSA 4OD3L 2R2BA 4H25A 4Y4KB 3ZL4H 4WY7H 5J1AA 1KULA 1P2CA 4MNGA 3RWGB 1C5CL 4LLDA 4F9LC 3CFJB 5EUKB 3SDCA 1JV5A 4JM4L 3U9UA 1NMAL 1YEIH 4X98B 3GSUA 2KBGA 5DLML 2DL2A 2FRGP 4QWWD 5J13C 1AKJD 3FQNB 3GSWB 2CDFB 3OR7B 4GXVL 4IIQC 1O7VA 3UDWA 1X5GA 4X4XA 5DVKA 3OHXA 25C8H 1PEWA 5JPMA 2YPVH 4FXKA 4AIZA 1CXHA 1FO0B 2P45B 2ZUUA 5TGBB 4CMMA 1QLEL 1U3HC 1EGJH 2AERT 4UOW1 3ULSB 1HXMA 1OP3H 3JZ7A 5INDA 1CU4L 3P9MA 1JN6B 1CFTA 1JHKH 5D7IB 5D8JL 2ITCA 4GS7C 2CDEB 5DEZA 2ZUSA 1R3KB 5IF0A 1CFSB 3VXPB 4JAMB 2FLBT 1A6VH 3QBTB 1L7IH 2QKIA 3A0OA 4PUBL 2Z35B 2FZ3B 1R3IH 4ODXB 2I60L 5AG8A 1D5IL 4R4FL 4ODUB 3RVXD 1C12B 2Y07H 5DVLA 4L8SA 3SE3A 3A67L 3N1QC 4GKSB 5EC1A 1XH3A 2ZNXA 2DQTH 3STZA 4G7VL 1A6TB 2OCFD 1JYWA 1H3PL 4ZUTB 3EOAB 2UZXB 1TETH 1CZ8L 4RDQF 1AGCA 3BDYH 3L5XH 5SWSB 4H0GA 4NWUH 5L88L 1UJ3C 3EO1A 1WSST 1ZWIB 3LRGA 4WW1A 1I85A 3TA3D 3IXAB 2FJHA 1JK8A 5JW4R 3DOSA 1U8KB 4LLUA 1JWSA 2RCSH 5DO2C 4QRPB 1J86A 3BUYA 3QUXA 1FL3B 3C87A 1XAUA 1MVFA 4NUGL 1KCVL 5FUOH 3WL9B 5C92A 3CNKA 4H20L 4S1SL 5IFAH 3HB3D 3TIEA 1RV6X 2DM7A 4PP2B 2YK1L 1IAMA 2AK4B 2W60B 3E2HB 4OQ1A 4LBEA 1H8SA 2VN7A 3AREC 3MLRH 4OCNC 4XC1H 5D72H 3VU2A 2ICWA 3GSNB 3VXMA 3SO3C 1CL7L 1Z9MA 2OXGA 1FN4B 4PG9B 4Y5YA 5JNYA 2VDRH 5FYLE 4U6XA 3VXNB 1HKLH 1P4LA 3DURA 1KJ2B 1A2YB 4ZAKB 3ZDZF 3GMNA 1QQDB 4YHLH 3Q5TA 1F4AA 3G6AB 4PJGA 1GYAA 2VABA 1KELH 4QCIA 1CS6A 2DDQL 3I6KB 4DKEL 4YC2B 4UQ3B 1CFQA 1IGJA 4TNWF 4F57H 1SEQH 4JRXE 1UYWL 3BZ4A 3MRHB 4PLNC 1TLKA 4I3GA 4BZ1H 4NT6B 4R0LC 5E6IC 3MOBL 2HT2D 3LSOB 3KPOB 4Z7QF 4KKLD 1OGAA 1JMZA 2VXUH 4K8RH 1A7OL 5LXGH 3ULUD 3KDMA 1FZOB 2GEEA 5HVWA 4PRDA 1KJVB 1NCWH 4PJBA 1YEGH 1MI5A 4X5WA 4YDJB 5DSCB 1W72B 4GG8B 1F3JB 5FV1L 4D9LL 1GVIA 5CMAA 1LEIB 3SKOA 3W2DH 4DUWA 1DL7L 2R39A 4G8FA 4N8CL 3GKWH 3WN5C 2WUCH 5DJ0A 5C09A 4CJ1A 1Z9SA 3U36B 2EC9U 4NWTL 4M6OH 2JK5A 4X80L 1YPZA 4KJPC 1CDYA 4V1DD 3N9GH 4CADB 3HI1B 4IHOB 3WNNA 5J89A 3HS0A 1EHNA 2HYMA 2J5LC 3EOTH 5GGSB 5D71L 2IPUG 3WIIH 4HJ0D 2G5RA 5HYJB 1LK2B 2KDGA 5I76B 2VDKH 2QSCH 3HNVH 3PQYE 4YQXL 3V6OA 4OKVB 2UV3A 5I73C 1MJJA 1GC1H 2VISB 3BIBX 3L7FB 2IH3B 1G7MA 3HUJB 4GKZB 1FH5H 1S3KH 4X6CE 4PJIB 1ZHKA 5BRZE 4AEHH 3CC5B 3U4BL 1RZFH 4MMXC 1GOGA 3CFBA 1JGDA 1K4CB 2ARJA 4EBQH 1NCBH 5L2KB 4Y5VB 3QUYD 1SYSA 4MA3B 1IQDB 3KPRA 5GJSL 3KYAA 5I1EL 5JMOC 2BX5A 1NUGA 5DWUL 1T1ZB 1BD2B 4UDTA 1OGAD 1RUPL 4NZUL 4KK5C 4QNPE 1NL0L 3P9LB 2FCBA 4F15B 3V5DB 5CEXB 5HGHB 4LVNB 3R0MA 4F9PA 4L29A 4JY6A 4YDKH 1IBGL 5BQ7B 3MV8A 3QWQB 3UMTA 1DN2A 5EU6E 5KSAA 2XZCH 1FCCA 3MLYL 1UENA 2W65A 3FT3A 2YR3A 1A7NL 1B0GA 4PJEB 5C09D 2E7LC 3QRGH 3FMGH 3V52H 3MRCB 4XAWH 5I1CH 5KVMC 1UWXH 3PWPA 1OWRM 5D2NC 1IAOA 3C6LB 4AG4H 4NSKA 4XMLL 3P77A 1UJ3B 4P2RB 4CNIB 1W0VB 2AEPL 4WHTA 4F7PA 2QSVA 3O3DA 4UB0L 1GGTA 1RUAL 1CD9B 4F58H 3T4YB 2AAVA 4UV4H 3BZFA 3IKCB 3MUGA 4NQEE 2E9IA 4LCWA 5GJTH 4F7TA 4YDVB 5GRXG 2VLJA 2GCYA 5I19L 3VFSB 3HKFA 3AMLA 1XT5A 5ESQB 2IG2L 3VXSA 5K9JH 2A9NL 3TJEH 3ZT7A 4NM4H 3VRJA 4X7TA 3MV9A 3KLAB 2XOTA 4K23H 3L95B 4Y4HC 4KDTA 4YPGA 3KPRD 5D1ZB 3AREB 4WJ5A 1OPGH 4Q58C 4RSVA 1KB9K 1JGEB 5DJCA 3TNMA 5IEHB 2BNQE 5TFSH 3BEVB 2WIMA 1U8IA 2XQYK 1I8IA 3UBXG 3OKKB 3B9VA 3LIZL 5ILTL 4JHBA 4JFHE 5MENB 4LLQB 2NXYC 2VSCA 4LCUA 1MCOH 3ZMRA 5BXFB 2VLME 4BYHA 5B8CB 3VFUA 2Q6WB 3HR5B 3RHWK 3VG9B 5KSAD 3S3PA 1TZGH 1QSEB 4XVSH 4MNHB 2QQKL 4WFEE 2P42B 4NQTA 2E7BA 3IFOB 5DJDA 3PWPD 1YEDA 2YSSA 5TDNB 1MJUL 1NJ9B 3EOYG 1E27B 4R0LB 1A1OA 5E6IB 3U0TB 3LEXA 1F11B 1W2KT 4HMEA 4ZOEA 4YHMH 2R0KL 1SY6L 5F9OH 1XGTA 1DUZB 3TT3L 4KRMB 3OAUL 1DQML 2CKBB 3EYSL 5GGUA 5C08E 3MZGB 5CCKH 3MRMA 5DMIH 4EUPB 3ARDB 2JIXA 3FFCA 3S8WA 1AGDB 2VLJD 1X5ZA 4QRUA 4QWWC 3RWJA 3TBTA 1N64H 4KU1A 2ZSWB 3BSZL 4TRPH 5IVXA 1L4IA 2MPAL 3VXSD 4OF8A 1EMTL 2ID5A 1A02N 5KSBE 3WN5B 3X13B 1HH6B 4LLMA 1KPRB 2AI0L 4S1QL 1T6WA 4QY8B 2DOCA 4XP4H 1X6LA 3MV9D 3AGVA 1Y0LB 3TO4A 5DF0A 2ESVE 1TJGH 1EX0A 1EXUB 2QV2A 3GI8L 5D2LE 4NQDB 3FTGB 1AO7E 2IC2A 2IWGA 5E2VH 1DQQB 5T1MB 2YUWA 3E6FA 1CDJA 5IB3B 5KVFL 4KJYB 1QBAA 1VERA 4NJAL 2JLLA 5EOQH 4PJCA 5H35A 4UDUA 5I73B 5A2JH 1W8NA 1XGQA 4P23D 5C0FA 2FJFA 4DGIL 3LKNB 2Y36H 2R0LL 4LSUL 3H6JA 5E8OA 1D6EA 1S7TA 1UM5H 3VFTB 4NP4L 4POUB 2ICEA 3QFJB 4K07A 5KS9A 5MP6L 4I2XA 4LSPH 1NFDF 2DLFH 1XGUA 4NCC1 5DUMH 3B5GA 2R4SL 1RMFH 2IALB 2UY6A 2QJDA 1IGCH 4JB9L 5C0JB 4LCYB 3ROLB 3JWDH 5J6HA 3QISA 2P44B 5M95B 1KIQB 1FNSL 1A6UH 2B1HH 2E27L 1RIVH 1T0MA 1AI1H 1HKFA 5DEGB 1FO0H 4XCYB 5BW7A 5CIPA 2KQMA 3TA3C 3UTZA 4P5MA 4WI7A 5BS0E 1M05A 2JIXD 4LSDA 1HCFX 1REIA 2NNAA 2PTUA 2HVKA 2ORBL 3QJHB 4GAYA 4CJ0A 4PB0H 1LNUB 2R1XB 2D2OA 3H9SD 3KYOB 5T1KB 2CRYA 4ZS7H 3MJ7A 2IGFH 2EH7H 4EVNB 3DXAE 4ZYKB 5SWZD 3LN4A 5IJKA 4XHJC 4W4OA 2J2ZA 1CG9B 5D2NB 2C3XA 3HB3C 3W0WE 4XMKL 2FB4L 4HBCL 4NN7C 3TJHC 5J06A 3H3KA 3CAFA 1JGLH 3VXRB 1HHIA 2BOBA 3S4SA 2OR9L 2P8LA 4Z7WB 1HHJA 4I4WA 3MXVH 4YAQB 1U91A 5GGTL 4LF3B 1QEWB 4OF7A 3VH8A 1ZAGA 1PSKL 3BWAA 4G3YL 5FKAA 4Y8AA 1V7NH 4LLWA 5EU3B 3V9FA 4PJDF 1ZLWK 6FABL 2DQJL 2VLRE 1ULVA 2QHRH 4FQCH 1YEHL 2A38A 3BAEH 1J0KA 3MRLB 1LE5A 2R0WL 2XPGB 4DFIA 3RWDB 3RX8A 1BWMA 3GSXB 4YDIL 3L5WA 3TBYA 4KI5E 2HMID 2M26A 3GUTB 1HH9A 1CF8L 1HILA 2HT2C 4KKLC 4DCQA 4PBVC 2C3WA 1FYTD 4OLYH 3CXDH 4H88L 5IHZA 3UC0L 4HT1H 4PRBB 1TJIL 3L3OA 4LKCA 1CFNA 4D8PA 3SDXA 1BZQK 1GHFL 2CMRL 3UTPD 1BGXH 4C4KT 1GSMA 1XGRB 1ZXQA 1LILA 2J8UF 4MD5B 5CJ5A 5FGRA 3GSNH 3BD3A 3ZE1F 4R3SB 1VGKB 2NW2B 7FABL 4XPBH 3CPLA 4BFIA 1LO5B 2X1OA 2H2SD 3LB6D 1P6AB 4Y19E 1ZT7A 2BSTB 3MLXL 4FG6C 2ZUTA 5GGRY 3V5HB 1FYHB 1C5DB 1Q0XH 3V6ZB 1OSPL 2OL3B 2EDLA 1IL1A 2P5WD 1CGUA 1X5YA 3ILPB 3KAAA 5FK9B 5EZJB 1KJ2H 4HJ0C 2BCKB 2VLLB 3ZLQC 3T65B 2PYED 4S10A 4O5LL 3IAGC 4WNQA 2VXVH 1WCBB 4IOSD 2WIIB 2FBJL 5GPRA 1JE6A 1XGYH 4XHQA 5I71B 4NQCE 5D6DC 3KPMA 3MNVB 1D5XA 4P3WA 2HWZH 1AR1D 2BC4A 2NY7L 3SHSA 2OMBA 3IDNA 4IMLA 1NANH 5T1LD 3WKNA 1W72H 3MMEA 3QUYC 2EZ0D 4D0DA 2OZ4H 3UJJH 5TQ0L 3DO7B 3IGAA 1MRFL 5D7IF 2A9MH 3VE0A 2X7LA 2G2RA 5DK2A 5FHBL 3DROA 1BQLH 4OUOA 2DICA 3EJZD 3RL1A 3TH4T 3CZFB 5AYQA 5A2KH 1KYOJ 1QLRB 1P4BH 3KPQB 2ZUYA 1S7VB 4W81A 4XNMB 1NLBH 4LLYA 4KMTH 5E1HB 3M1BA 1H5BA 3TIDB 3KS0H 1DUYA 4J3WA 5GS0L 5LKNA 1XR9A 4H25B 3DI2B 1IM9A 3HN3A 4P2QA 3NZHL 4YO0A 5J1AB 1I9RL 1P2CB 4GAJL 4LLDB 5TPWL 2EE3A 4TPRL 5KVDH 1MNUH 3U9UB 3NCYS 4CL7A 3F6LA 3ABZA 5CUSH 3GSUB 4L4TE 3MGTB 3V6OC 4X4ZA 1K5NB 4C55A 3LMJL 1KCRL 1MFCH 4X4XB 4AYFA 5E8DH 2Y5EA 4HDIB 4QOKA 4M1CD 4Z7VA 4FXKB 4AIZB 4XNUH 2FEEI 5T3XH 2X41A 1BVZA 1D9KD 4CMMB 4UIKL 5D1QD 3VGAC 3WFDH 3P11L 2OM5A 1HXMB 4JFDD 4QRQB 1NC4D 4NN7B 5INDB 3P9MB 1FDLL 1CFTB 1B2WH 4NGHL 3SGDH 3VWKA 3QI9A 1LGVA 2ITCB 3C5SA 3FO9A 3GNMH 5IF0B 4H1LG 2AQ3A 5E2JA 1SBSH 2W07A 4U0QB 1KV3A 5EG6C 1XIWA 1PW3A 1KXQE 3RU8L 1UXWA 3K81A 4HCRA 5KOVC 3UO1H 1GIGH 4PGCA 1INDH 2EC9T 3K4AA 4HSQA 3NPSC 4L8SB 5EC1B 1LO0L 1XH3B 3STZB 3VGBA 5KSAC 3FB6A 3WBDA 3A6CL 2YC1A 2IAMA 2B0SL 5GS3A 3ZDZE 4ALAL 3TH3T 1QKZH 5C6TH 1LO3L 4X8XA 3PP4H 5SX4I 5B39G 3ZZ1A 1A7RH 1AGCB 1QG3A 4P2QD 5D96C 5F6HI 3QDME 1U8JA 1YEEL 1AP2B 3JV6A 1G7LA 2IPKB 3P0VL 3NVQA 4WW1B 3INUL 4NYLB 2FJHB 1JK8B 2GJJA 5ITFB 4LLUB 4Z7QE 1MJ7H 1JWSB 3DV4A 1L7TL 3CUPB 1F3DH 3BUYB 3MLVH 3OAZH 1IC4L 2R1WA 3KYNB 3QXTA 2BY0A 4HQQL 2C4FU 3V0AC 1A3RH 4KMLB 5F9JB 1A64A 1SYVA 1BOGA 1WBYA 3QPQD 4ODSL 2CXGA 4OGYL 5GXBB 3TIEB 2O5YL 2VDQL 5LBSH 2H32H 3O2DA 4LPUA 4ZMAT 4LBEB 5L8LB 1KENL 2R29H 1LD9A 2ICWB 3VXMB 1EZVX 5E9DE 1VEMA 1G7JA 4Y5YB 2IFFL 4BQBA 2AJUL 2X4OA 5EUOA 5JNYB 4NBXB 4P23C 3ZYOA 4WUUE 4HKBA 4U6XB 1MUJA 3V4UL 1ZEAH 3QUZA 1SQ2N 3DURB 3MRFA 3GMNB 3OGOE 3KR3L 3SKJL 4PJGB 3FZUD 2IAMD 2VABB 4JGMA 3Q5OA 4JY4A 4QCIB 4ONOA 3WNKA 3BGMA 2EICA 5JORA 2UZIL 1CFQB 3HUJF 2NMSA 4NN5C 2JB6A 2NR6D 4MXQD 5GISL 3VFGL 1MRDH 1Y6NR 2O5XL 3QUYB 3IFPA 1YYML 1URLA 5DR5H 4MMZC 1I9EA 1OGAB 3T0WA 5DMGC 3CFCL 4GJTB 1ZKAA 4TVPD 5GS1A 3KDMB 1F2XK 4EI6A 5CD3B 4PRDB 3PE9A 5JHDA 4XP9H 1MI5B 4X5WB 4J8RA 3LEVL 2C26A 3GBNH 4DWHA 2Z31A 2DYPA 4PRAA 1PDKA 5TE4L 5CMAB 3SKOB 3C09C 3SGKC 3REVA 4G8FB 1BF8A 1X5LA 5DJ0B 5C09B 4L3EA 1QLFA 2JK5B 5AAMA 5DHYA 3T0DA 5KW9L 1YPZB 4OZGA 5GS2D 3MCKA 4DAGH 2I27N 5F71A 1K8IA 4PJEF 4HWBH 4KFZC 2XY1A 4OZ4A 3JV4B 4MAUL 3L3JA 5J1TC 1HNGA 3NAAL 2VXTH 5LQBL 3TVMA 5FUCC 4JPKH 4ZOCA 1GL4B 2CRIA 1MJJB 1A7PH 4PRPE 3RIAK 4MB5A 1A4JA 1A0QL 3BP5A 2CIKA 1AY1L 4Z95L 1LE9A 1G7MB 1FL6B 5DMJB 1OD7A 2MOVA 3E0GA 1ZHKB 4OIBA 5I1HL 3CFBB 1JGDB 5KANG 2ARJB 5GRUL 2ADFL 3UTQB 4X4YA 2DLTA 1YZZA 2OJZH 3MJ9H 3P30L 1SYSB 3L3DA 3KPRB 1IAKA 2X4SA 4A2MA 1T7ZA 5K9OA 4UDTB 1N5AA 2B2XH 1QRNE 1XGPA 3QEHA 2HMIC 3UJTH 4KVCH 4LAQL 3RX7A 3AS1A 1KB5B 5IB5B 5JHDD 5D5ME 4ZS6D 1G9ML 1CGSH 2ZUWA 4ZOAA 3MQIA 1MFNA 2BSRA 2X5PA 2Z31D 2DYPD 1ITCA 4JY6B 4L29B 1MVUA 3NPSB 1JGVH 4P0DA 5KSAB 2ENYA 1I3GH 1SEBA 2Z0BA 4GT7A 3FT3B 2FO1A 1B0GB 1AIFA 2C9AA 3ARFD 4HCRL 4NNYA 1MQ8A 2JB5L 3MBXL 2P5ED 1VESA 4KDVA 2GFBA 5IJKC 5TE6H 1AFVL 3K4ZA 4YIQA 2H2SC 3PWPB 5JIPA 1AH1A 3LB6C 1IAOB 4R2GD 1QA9B 1AJ7H 4APQD 4C56E 1K6QH 1L9NA 3CX5K 4NSKB 3ARBA 4XPAL 3P77B 4IOFD 4ONFL 2C7UA 4F7PB 4ZO6A 4O2EA 1TITA 3R8BB 1G9NC 3O3DB 2E5EA 3GJFB 5I1GH 1JPSL 4M7KL 5GSRA 4LLAA 5H37H 3BZFB 3MUGB 5C0DA 2Q87A 2EH8H 4LCWB 2OSLB 4F7TB 1DFBL 4J7RA 4NC2B 2VLJB 5CLTA 2GCYB 5AEAA 5E08H 2VXSL 1SBBA 1B0WA 5E99L 3VXSB 2QQQA 3T2QA 2DBJA 3X17A 2NY4C 2WBJD 4TQEH 3D1MC 3MV9B 3W9DA 4LSVL 3G6JE 1BFTA 2BERA 1JZ7A 4YPGB 4Q0XL 1RUML 3MUHL 4FNLH 1DE4B 2X09A 1T89C 4WJ5B 5SX5K 5BOZG 5FF6A 4HGKC 3UTSA 1VADA 1U2CA 1OP5H 5DJCB 3TNMB 2EZ0C 3SQBA 4I3SH 3V6FB 1H8OA 1U8IB 1I8IB 3BGFC 2VDPH 3DMMA 3O2DL 3BP4A 4M00A 3BQUD 1T2QH 2N4IA 5E4EC 5H94A 1B0RA 5LCVL 3W39A 1YEJH 2BHZA 4LCUB 3TEUA 1EVUA 3NCJH 4BK4A 2H45A 1C5BL 3EJZC 3IJSA 2OL3H 4WEMB 4M8QB 2BZDA 1FNEA 4PGZA 4HUMB 3IJHA 5K9KB 5TE7L 1KFAL 2DWDA 2C1PA 3MA7A 5FUZL 5DJDB 1YEDB 2YSSB 3BP6A 1A1OB 3NCFB 3QCTL 3VI4E 3W11D 3ARBD 1ES0B 3T3MF 2D4FA 4JVWA 1XGTB 2F15A 2AKRA 4OJFL 4OT1L 4PRIE 5GGUB 3N1MC 3BHBA 3MRMB 5I1IL 1EBAA 1NUNB 2R8SL 1R24A 1DBML 2JIXB 1Z0NA 3TPUA 3RWJB 3TBTB 5EBMA 2EDRA 1FVCA 1P7HL 3VW3H 3C09B 2X70A 5IVXB 4AT6A 3H9SB 3I6LE 4HX1A 4XP1L 2GY5A 4LLMB 4M1CC 4BQ9A 4EKXA 3PDDA 1K2DA 5IKCA 4OTXL 1D9KC 3RDTD 5D1QC 3TH2T 3TO4B 3DUUA 4GLRH 4KTDH 3FO1A 4TUOA 5IROA 3H9ZA 2DM4A 2W0KA 1INEL 2XQYG 3O4LE 3E6FB 1EUUA 4D9RD 3DMMD 2F53E 4PJCB 5H35B 3ZE2F 4O02L 3BI9X 4RBPK 5DUPL 1AQKH 1XGQB 5C0FB 2A73B 2BSSA 4KROB 2FJFB 4Z7WF 4Z9KB 4RGOH 5E8OB 1D6EB 1S7TB 3AB0C 5E00A 1BFVL 4MA8L 2ICEB 3IDXL 1XZ0A 4I2XB 3LKRA 4LGRB 3WUWB 1ORSA 1XGUB 4PJDE 2Y06L 3HMXL 1KGCD 4OM1H 1W8OA 1G9EA 5C2UB 1U58A 5JIIA 1YY8A 5J6HB 1S7SA 1WGOA 4IRSA 1KSRA 1JFQH 1T0MB 1RUKH 3BJLA 2LTQC 5CJQL 5CIPB 5D7SL 5FM5O 4P5MB 4FQHB 3UTZB 4BUHA 1M05B 4C59B 1UEMA 3UJIH 3BISA 2NNAB 5F44A 2ZPKL 2HVKB 4OCSH 2XZAH 1HI6A 3VRLE 5JUEH 2FO4A 2DQIL 3MJ7B 5KOMC 1NBZA 5HDOA 2DD8L 5DVOA 2J8UE 1Q9WA 3LN4B 1F8TH 3QPQC 5DZNA 5DVNA 3ZE1E 1KBGL 4NRYB 5BZDA 1O7SA 3QNXA 4N9OB 5GRWA 4AENB 4ERSL 5BOPA 1FLRH 4YGVA 2M2DA 3KJ4C 1HHIB 3S4SB 3BPOC 4NJ9L 2DWEA 4ZFGH 4I4WB 2BNRA 2XWJA 4DKAA 1U91B 2VL5A 1EFXA 2J6EH 3I6GA 4G8GA 3VH8B 5FKAB 1Q9KA 4K7FA 2RR3A 4LLWB 1VGEH 3SGJC 5EU6A 4NM8H 4GQ9L 3MACH 4HFUL 2YZ1A 3FZUC 1N5YL 2IAMC 4RWYL 4TSBH 1PZ5A 5T1LB 3ULUH 4OQTA 5DD0H 1KN4L 3QDGA 1LE5B 3U82B 2D7PA 2NR6C 4MXQC 2K7QA 3K2MC 3L5WB 2XZQH 1ZT1A 4HPOL 3RA7L 2E8ZA 4QRRA 4KZEH 1JNNL 2HKFL 5T5FH 4WWKA 1HILB 5I8EA 4DCQB 5FV2A 5DJ2A 4UV7L 5T33H 5CP3H 1CXFA 4BQ8A 3T08A 4I5BA 4NQEA 1FV1A 1S8DA 3L3OB 3VXTA 3S36L 1CFNB 4D8PB 5JLZA 3SDXB 3B5HA 2ENSA 4PJHA 1UWGL 4YBHA 5D7JD 1WFNA 2YRPA 4N0UA 4QO1A 3T1FA 3SKMA 4F3FA 4YNYA 3CPLB 4PJ8A 4B41A 4BFIB 3PXHA 1ZT7B 1DVFD 4ODTH 2BVQB 5HHVL 2FL5A 1IL1B 5IMOA 3O6FC 3T2NL 1DQDL 1DBKH 2R4RH 2D7TH 4YZFF 3KLSA 3NCCB 4JQXC 1GOFA 2BNRD 4RMQA 2AGJH 1QD0A 3DWTA 3FONA 1WV7T 3IVKA 4U1GB 3BYTA 3D3VA 1FCGA 4G8GD 1KLUA 5SWSE 3I50L 1MCPL 2F74A 3MOQA 4D3CL 3KPMB 2BOCA 1NFKA 1D5XB 4KKCD 2BC4B 4WI8A 3S9DB 4DEPC 1IGFH 3OB0K 4IMLB 4M1DL 5C0ND 2HTLD 3QDGD 4ZUSB 5FYLL 5D93C 2OP4L 3V4PL 5KZCD 5F8RC 2KQNA 4NO3A 2GIYA 2GJZA 1RIUL 1JGUL 3K8MA 3O3UN 1H8NA 3MMEB 4HK0A 4OGAC 5CFHA 2CGRH 4D0DB 5DT1L 5EZOL 3QEGL 1TIUA 4NFDA 1CR9L 1PAMA 5HGDB 3IGAB 1PY4A 3VE0B 1RSFA 4WEBL 2X7LB 2G2RB 2O5ZL 1RJYB 3IS0X 1B3JA 2ADIA 3DROB 3QUKA 2AK4E 3L3KA 3L7EA 1T1YB 1UACL 3S98A 3LZFL 4XVTH 3AB0B 2Z31C 2EC8A 4X6EA 1GGUA 1WF5A 1TZIA 5KSBA 4BUGA 2WQ8A 5JXED 1NMBH 3OKOA 4LLYB 2DLEA 1H5BB 3ARFC 4KTYA 4YHNA 1MSPA 1XR9B 4UINL 1EFQA 5HHNA 4QHUB 1IM9B 5DJXB 4P2QB 4YO0B 4KRLB 3GKZA 4R2GC 4APQC 2C4XA 4J2XA 4IOFC 2NY0D 5L7XL 3T77A 1BQHA 3KPSA 3ILQD 2Q8AH 1NBYA 3ZO0A 2DQGL 5DQJA 2WQRA 2FJGA 1CLOH 5JIKA 2YZ8A 3WUZA 4WDIA 3T0EA 3NA4A 3ULUF 5DA4A 3RPKA 2ZJSL 4QOKB 4R6UA 1E6OH 4LRIA 2AJYH 1MCIA 1QP1A 3DX9B 3RFZC 3U0PA 1A14H 5IV2A 1KB5H 2WBJC 1G1CA 3VWKB 1WT5A 3QI9B 4OLXL 4TNVF 5IT2L 3C5SB 5KJRL 3KJ4B 2D0GA 3IAQA 3BH8B 5BMFL 1AQDA 4UT9L 1IGIL 1OAKH 1NUDA 4RMUA 1UXWB 4LHUD 3ORJA 3WEXA 5A43C 3BQUC 3AAZA 2HRPH 4XVJH 3MFGB 2KZWA 5HYJE 4XPTH 1BBJA 3MCG1 4YE4H 3ARGD 3EZJB 2HT3D 4W6YB 4EIGB 3FB6B 3DV6A 2IAMB 5ITBL 3GJFH 4DN3H 1T2XA 3GBLA 5E2WL 4J4PA 1T80A 3VJ6A 4YWGL 1E4WH 3RJQB 4DQOL 4V2CB 4QTIL 1CGYA 2H9GA 4LCCC 1ZTXH 1U8JB 1C7TA 2VQUA 3HUJE 3IRZA 3W11C 4BSVA 3ARBC 5FECA 1MJ8L 3JV6B 5F72S 4PJIE 1G7LB 3OBAA 3NZ8A 3P0GB 4ODVL 3KPSD 2F58H 2X4QA 6CGTA 3GSOA 5L2KE 3FQTB 3DV4B 4I77H 2HG5A 1GOHA 4RAHA 4H26A 4PTTA 2DQCL 3MRQA 3WLBA 2R1WB 2NXZC 3BRGC 4NO5A 1BD2E 4XXDA 5E2UL 1UCBH 4P5KA 32C2B 1SYVB 4TN9A 1BOGB 4F2MA 1WBYB 1TCMA 5KVGL 2UUDK 2X9WA 4XXCA 3RDTC 1NEZG 4PY7A 3VXQA 3WLWD 2FX9H 1JRHH 4PJEE 1LD9B 3QXWA 4PV9A 5EWIL 3ULVE 1OAZH 1INQA 35C8L 1Q8MA 2LAGB 4GG6A 4NQSA 2EIEA 5HDQL 4B53A 5TF1H 3DMMC 1U3JA 1WAAE 2Q7YA 2X4OB 5EUOB 1OY3B 4P2RE 1B88A 4HKBB 3VFWA 1MUJB 1OARL 3QUZB 1R6VA 5T1DH 3GO1H 4DEPB 4G6KL 4Q9QL 1CLZH 4JY4B 3L1OL 4MXWL 3BGMB 3CXHK 5JORB 4JG1H 1BVLA 1WTLA 2BP3A 2JB6B 4X99B 1VKXA 3ALPA 2DQDL 4XRCA 2EEBA 2PUQT 3IFPB 3P3YA 1UKTA 3W9EA 2NX5A 2MCG1 4LHUG 4C83A 4ELMA 4JKLA 3K74B 4KRNA 3CFIC 4K7PH 5C0BD 4EI6B 1QO3A 5JHDB 1EHLL 1A1NA 1ZHBA 3QHTC 4J8RB 5JO5A 3ET9F 2Z31B 5ALBL 5JIHA 2DYPB 1ZV5A 2WUBH 3X11A 4AEIL 1IKNC 4PRAB 4OLEA 4KV5F 2R2EA 2BDNL 3TN0A 2D03H 3VDAA 1MCEA 4HS6A 5ANMA 4KZDH 3ARFB 4L3EB 1QLFB 1EBPA 1WC7B 5DHYB 3LQAC 3ARRA 4OZGB 5MENE 3MCKB 4KPHH 1J1PL 1K8IB 2LFGA 2OTWA 3QO0A 4APQB 4OLWL 4QHNA 1QSEE 2VLKA 3HRPA 3QQ9D 3L3JB 4OCXH 1GJIA 4M43H 1P9MA 4JN1H 1T04A 1UM4H 1WWAX 2ZCKH 4JO1L 4CVXA 3R06A 4HGWA 1I9IL 2H6PA 1LO4H 3V8CA 3I84A 1A4JB 3BP5B 3BXNA 2CIKB 2DMCA 2X89D 2DL9A 5A3ID 3C08L 1LE9B 4JO4L 2NTFA 2WAHA 1L9MA 4HUXA 1PX4A 3EDDA 4IRZL 3S35H 3Q2CA 3FO0L 1EZVY 1G84A 5DFTA 2V9QA 1I7TA 2NY5L 1T3FA 5ALCH 4EOWL 1IAKB 1B4JH 2X4SB 2AJXH 2E3VA 1XGPB 3QEHB 2ED9A 2FIRT 43CAA 5HGBA 4DVBB 5CZXD 3VXOB 1I1FA 3Q6GH 4HC1L 3SDDC 5GRZA 4BSJA 2BSRB 1IJ9A 4MA1C 2QLVB 3ELAT 1MVUB 1FORL 2APXA 3TN0D 5GS0D 1SEBB 3P4MB 4YXLL 2GJ6A 5AD0A 1AIFB 4RISH 5D7JC 4NNYB 4LVHB 5F6IB 4AL8L 3CVHL 4UILL 3VG0L 3VFOA 4YIQB 3NH7H 4HMDA 4H1LH 2DBLH 3U7YH 3ARBB 1DVFC 2P8MA 3ZDYF 2VLKD 1RZGB 5F3HA 3QFJE 2C7UB 2A1WH 3MSPA 3NFPA 3NPZB 4JPWH 1Q0YL 4G9FD 4UTAH 1KNOA 1J8HE 3I02B 4FS0A 5GSRB 4X6DF 5IWLA 1TTUA 3OJDA 1FLTX 5C0DB 2YWYA 4DN4H 2XXCB 3ARTA 4K3GA 4PTUA 3V7MA 4P9MH 1PJ9A 5I1DA 4FMFA 1DSFL 3FHQA 1GZPA 3C2AL 4RZCA 2HAZA 3OGCA 3WNPA 4KKCC 3QEUA 2JJSC 4Z18A 1KCSL 3WFBH 4UI2A 3V79C 3W9DB 3RWFA 3VXUA 5C0NC 2HTLC 2P49B 3UTTA 1YNKL 2A83B 5L9DH 5DD3L 4K3JH 5FF6B 1W0WA 3UTSB 4LPVA 1VADB 5IW1A 4QYOA 1RIHH 3CD4A 4XCFL 3STLA 3GHBH 3PG2A 2JE8A 3GK8H 5D2NE 4Z8FL 1OAUH 3DMMB 3G6DH 3VRIA 4WTZG 5I6XC 5E94A 3BP4B 3MXWL 1DBJL 3MRJB 4K2UL 5H94B 1B0RB 2XNAA 4U1KB 3W39B 2VJXA 3ZE2E 2X1QA 3IJSB 4LCIL 3VXRE 1FNEB 4Z7WE 4FQIL 3FN0H 5JXEC 3IJHB 1KF9B 1QSVA 3SPVA 5JA8B 2YHGA 3IDGA 2DWDB 2C1PB 4JRYA 4JCMA 3SE8L 3MA7B 5BV7C 1N4XL 1CN4A 3BP6B 3FT4A 1EEZA 3FT2A 4CDHA 3QWRD 4YHZH 5C0GA 4HG4J 3BHBB 2RBLA 2VXQL 1QPXA 1MQKL 3WD5H 1R24B 3T0VA 3TPUB 4N8VG 1WWWX 5EBMB 2VNCA 2I5YH 1FVCB 4TSCH 2H1PL 1T2JA 4V2BA 1E0OB 2X70B 3DUHA 4AT6B 3I2CH 4HX1B 3EDFA 4LP4A 1A6WL 5FHAH 5I8KH 3GSQA 5B3JE 1EEQA 1HZHH 4OLZH 5IKCB 4PGJA 3VXUD 1JF5A 4MJ5B 3MRBA 3BPNC 3DUUB 1CE1H 1H9VA 3FO1B 4TUOB 1FNGB 4LU5L 1SMOA 1VPOH 1EEYB 1S7QA 2B4CL 1QYGL 5I1AA 2WANA 2G5BA 3RUGE 4YGAB 3AS3A 4ZFZA 3B6SA 4ZUWA 2Z91A 4G6ML 4P3CH 3QXDA 4JQIL 3CX5J 1IEBB 2VAAB 4W6WB 4Y1AD 4CW1A 1SMAA 4M6MH 5DJZA 3MLSH 5E00B 4JDVA 4XCNA 4CN1A 1T83A 4NPYA 1IRAY 5EH1A 3ARGC 1XZ0B 3WJLC 1TVBA 3LKRB 2YPLA 1ORSB 1N26A 4OF3A 1GXEA 4HKJA 5DJAB 1DBBH 1P7QA 4BQCA 4AM0A 1JL8A 1YY8B 3E8UL 2BRRH 1S7SB 4IRSB 3O8XA 2FGWH 4PJXF 4G6JL 1NCCH 4PJ7A 4IRJA 4J3TA 5CINH 4TUKL 2X6MA 5CEYA 4WU5A 5CJ8A 3HZMA 1HI6B 1FNLA 2H2PD 4MA1B 5I74B 3LKPA 4OIIL 2LV4A 5F96H 1NBZB 4LRIC 4N0FA 3TLRA 5C9KA 2CD0A 3LRSA 1Q9WB 4FMKA 3HRZA 4FQXD 1RFDL 4LSRH 5HPMA 4TTDD 3B2UD 5F89A 4MCZA 5BZDB 5C0AD 2VN4A 4KK6D 3ZTJG 3QNXB 4P4KD 1TXKA 4ZD3H 4YGVB 3WLWC 3KLHD 4JFED 4JR9H 1ZA6A 2DWEB 3U79A 2BNRB 2XWJB 1DANU 2CLRA 3MYJA 1EUTA 3TESA 2VL5B 4RA3A 5H2BA 1EFXB 5D7LD 3I6GB 4G8GB 1UA6H 1Q9KB 3WXWL 5KBNC 4K7FB 4GXUN 2DJUA 5DJYA 3Q6FA 2Z93A 1ADQA 4FQPA 2YD2A 1CDGA 2YPLD 4LARH 1NAKL 1PZ5B 4TVPH 3QDGB 3MUY1 2IQ9H 3D0VA 3WFZA 5KZCB 4JO3L 5C3LD 2YKLH 1F6LL 3GBMH 2X4UA 3GJEA 4PY8I 1ZT1B 4PG2C 2AVGA 3ZL4L 4IRJD 4QRRB 4WY7L 5BVJA 2AK1L 4WWKB 5I8EB 1E4XI 5AZEH 3MPCA 5DJ2B 1IAIH 1H3TA 1UVQA 4GAFB 4I5BB 5ADOH 2XN9D 1FV1B 1S8DB 3VXTB 5FA3A 2NTSP 1ZLUK 5GS2H 1YEIL 4FFZH 5IB4B 3S37H 2PKDA 4PJHB 2ZUVA 5JQ6H 3DGGB 3U9PH 4UAOC 4N0UB 4MVBD 3T1FB 3O6MH 1P4IH 3SKMB 2HLAA 3EZ8A 4YNYB 4F3FB 2H8PA 5BV7B 25C8L 2YPVL 3LV3A 1OM3H 2E6PA 2MWCA 4YLQT 4XXCC 5MEOA 1L6ZA 1EVTC 1EGJL 5IBLD 2FL5B 5IMOB 4A6YH 5LGHH 3QQ9C 2NY0B 2XWBA 1JHKL 1CTNA 3FONB 3IVKB 4AMKH 2DLIA 4X5XA 4DZBA 3D3VB 1A6VL 1KLUB 4ODBD 5ERWB 1L7IL 3O2VH 5DFWH 1LDPL 1BM3H 1IGYA 2BOCB 5A3IC 1R3IL 2D7OA 3F7RA 4NNXA 4WO4A 4N1EA 3ULUE 1Q94A 2Y07L 4BQ6A 4YBLB 3IF1A 4MJID 5IMLA 3TPKA 2W9EH 2DQTL 4KKBD 1FQ9C 2D0FA 4NO3B 1NFDA 2YA0A 2P4AB 2GJZB 2UVFA 4RFEA 1TETL 4LRNH 4ETQB 1JVKA 3N50A 3BDYL 3KG5A 1F4HA 3C5ZA 4OD3H 5E8EA 3L5XL 2C1OA 5JW4N 1CICA 4NWUL 4HUUA 3LAFA 1C5CH 3K1DA 3QUKB 3NBNA 5F21B 4RMRA 5CZXC 3L3KB 3L7EB 1X4YA 3OB8A 1MCRA 5IIEA 4X6EB 3VXME 3H42H 2RCSL 1TZIB 3QQNA 2KUTA 5K33A 3TN0C 5GS0C 3OKOB 3QZWA 2COQA 5FUOL 5LJYH 3E6HB 4YHNB 5F7EH 3HCVA 1UADC 3KYKH 1LK3H 3AY4A 3QQ3A 4HIXH 5HHNB 5IFAL 2J3SA 1M6OA 3EFDH 4XCEA 4ZDHA 4CU6A 4PJGE 1TVHA 4I9WE 4ZNEA 3T77B 1A6ZB 1BQHB 3KPSB 4ZOBA 1K85A 4PBXA 3MLRL 5DQJB 4XC1L 5D72L 2FJGB 5HHXH 3IDYB 4UNVA 3BP7A 3T0EB 2I9TA 2CLVA 3SGEH 3AM8C 4MB4A 1OGAE 2Y7QA 1RVFH 5CWSA 3WV0A 4P9HC 4WU7A 3EGSA 4WO4D 1VFUA 3STBA 4L4VD 4Z7NE 2VDRL 4P5TA 1HKLL 5F6HJ 3N06B 3U0PB 3ZKSD 4PJDA 5DS8A 1MI5E 4YHLL 4FXGA 3ZYZA 3NIDF 3PP3K 2A6KA 2BSED 4KJQD 1KELL 5EN2A 4NKDA 3S5LA 3WHE1 4F57L 1SEQL 1JZ3A 5EO1A 3PWLA 5C09E 3O9WA 3TYGH 3V6BR 4GRLA 4BZ1L 1FNFA 1V3KA 1YPZE 1CZ8H 4RFNB 1TQCB 2PW2A 3WEXB 2XG4A 2VXUL 4K8RL 3AAZB 5LXGL 2X40A 2QEJA 2RHEA 4UOW0 3QIUA 4LSSH 3HFMH 1NCWL 4P48A 1KOAA 5TJWK 1YEGL 5EUOF 4S1DD 3DV6B 1FFPB 3V6OE 3NCBB 4OSUH 4YEEA 2J8UA 3W2DL 4QXGH 1CXKA 3GKWL 3VJ6B 2WUCL 1NKOA 1DLFH 2E9WA 4RA0C 4EN3D 5IQ9A 1FSKC 4X7SL 4LPWA 2H9GB 4M6OL 4BSVB 1KTLA 3PGFH 5FECB 4HULB 4S11A 3RY4A 3N9GL