4OUUB

Anti-mt1-mmp monoclonal antibody
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
217
structure length
210
Chain Sequence
EVKLVESGGGLVKPGGSLKLSCAASGFIFSNYAMSWVRQTPEKRLEWVATISGGGRNIYSLDSVKGRFTFFRDNARNTLYLQMSSLRSEDTAMYFCSRENYGSSFTYWGQGTLVTVSSAKTTPPSVYPLAPSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Inhibition mechanism of membrane metalloprotease by an exosite-swiveling conformational antibody.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase
molecule keywords anti_MT1-MMP Heavy chain
total genus 43
structure length 210
sequence length 217
chains with identical sequence H
ec nomenclature
pdb deposition date 2014-02-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ouuB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ouuB01
3HMXL 4ODUA 3G6JE 1VACB 2GSIA 3GMMA 3BISA 3BEWA 3VRLF 5GZOC 4XVTL 5JW3L 3I6KB 2ZCHL 4HKZB 3T4AA 4U0QB 4OCYH 2XQBH 2WQRA 1IVLA 1BVLB 1WZMA 5IMKA 4YXLH 4DGYL 3HHRB 1JGUH 4XC3H 4Y88A 3HI1A 3VRIA 3T4YA 1N59B 2FH8A 3LKPA 5HYSB 4LLUB 4QWWD 1I1AA 3NVQA 2X1WL 1N7ML 5I66A 3NCYP 2NW2A 2VKXA 3K2MC 2BNRB 2FIKB 3SDCD 2NY0B 4CVXA 1CICD 3O6MH 4PG2A 1BBDH 5GS1C 2XA3A 3TV3H 1NGXB 3H0TB 3KYMA 1PQZA 4ZOCA 1AE6H 1S5IL 3O41B 5DEGB 4M03A 4YHYC 3O6LH 4ZUWB 3U30B 3Q6FA 2R69H 2XN9B 2EYTB 4NQVB 3WS3A 4N68A 5CZVH 1T1YA 1WEJL 5JORA 1X5ZA 2UVFA 2MCPH 1F45A 2VLKE 4OIIL 4XPHL 3LCYA 4LIQE 3FTGB 2AJVH 3D0VA 1BJMA 3IGAA 3OBAA 2NY6D 3SOBL 4HAFA 2VL5B 1KELH 1PLGH 4KHXL 4OZ4B 5C9JB 2B7DT 1GC1L 2XY2A 3DURA 4OZFG 4IDJH 1A6UL 1QYGH 5J6GA 1NGYB 4LLMB 1IAKA 2Z35B 3FQTB 5AYQA 4UTAH 3NACH 2MMXA 2Q3AA 1FFQA 2AKRA 2JJSC 1RZGB 4I2XA 5T1LB 4H5SB 4XCCH 5JOFA 5I75C 3HG1E 3P40A 2NY4C 4P2OA 4J3TA 3WKML 3QDMA 3F58L 1A21A 2AEQL 4UOJA 3DYMA 3EW3B 3B9KD 2F53A 4M61A 1I4FA 4X6DE 3MACL 4KJYB 4PJGA 3BH9B 4YXHL 3TN0A 1FFNA 2C1PB 4K71B 1AD0A 1JBJA 3DGGA 1TVBB 3BP5A 4FQXB 3GSRB 1HXYB 3JWOL 4IRSD 1MCPL 1EO7A 1VKXB 4JFDA 2A9ML 5DFWH 1CD1B 1FZKB 3UTSE 4GW1A 2BRRL 2IFGA 2QADC 5D71L 3ZE2E 1D9KB 4PJ9D 3THMH 1ZT1B 1K8IB 4FZ8L 2YPLD 1C12B 1AXSB 4N8VA 5DLMH 4MQTB 4RQQA 4LSDA 1MUJB 4QWWC 2CR3A 3TO2B 1AD9A 2H1PL 1U93A 3CFEA 3LKOB 4PJ7B 1DUZB 2NXYB 3RWDA 2OQJA 5E8DH 3FQNA 4CADA 1AC0A 1CGSL 4N0UB 1FIGL 3QRFM 5C0RH 4ZD3L 4F7TB 5GS0H 1N4XH 4UQ2B 2EYSB 4V1DE 2J88H 5EUKA 3V95A 4JZJA 4FMKA 5IFAL 4WWKD 2RHEA 3C09C 5KZCB 1T0PB 4QHMA 3MA9H 4Z76A 4OB5H 2PXYA 2CK2A 5T1LD 3SE3C 2X4TB 2A6JA 3CVHH 3M07A 3MLRH 5DD3L 4WFFE 4XVUC 1OPGL 4BK5A 5HYSG 2YN3A 4Z0BL 3ULUE 1AXTH 3QP3A 4N0CD 5B38A 1U8JB 2VLMD 1IM9A 3NIFE 1TJIH 4WDIB 3RL2B 4NZUH 1T2XA 3C60C 2ADJA 4WFEE 5I1EH 3TPKA 4MA3B 3TCLB 2WSKA 1EJOL 4MJ6A 2G2RA 2HRPH 1TQCC 1MJ8L 3FQWB 4YDJB 3BO8B 4BFIB 5JW4R 1MFEH 2AEPL 4NQDA 4RAHA 3KJ6L 3VXRA 4LSUL 1WCQA 1WZKA 1A1NB 4TSBH 2DAVA 1BFSA 4X4XB 1RI8A 2UZYB 4OUUA 3A6BH 4WEUD 1MCHA 2X4OB 4UAOC 2XG4A 3FN3A 3ZDYF 3MO1B 4V1DB 4CN4A 2JK5A 1JUFA 4OZFH 3L7EA 3O9WA 1OT1A 4H0HB 4CU8A 1TENA 3GJFB 4HPOL 3FQWA 1P53A 2Z8SA 4LSQL 2NXZB 3QR2A 4GAGH 4Z7OF 1FL3B 3UX9B 5I1AA 2RB8A 4PG9B 4PRHA 5FGBC 4X7FC 4HXBH 5D1XD 1AGCB 4NJ9H 2D31B 1FVEA 3UTPE 5ESQB 5CHNB 3TJHC 5EFIB 1MRDL 1ED3B 4R0LA 1CTNA 2MFNA 1HSBA 1XT5A 1ZGLB 4HUVA 4HXAH 4WWID 1AP2B 3RHWF 4TNVK 5GXBB 4H1LG 3ZDXF 2D7QA 3O8XA 5E94A 3VFRA 3EIFA 1QPPA 4G6AC 5EOQH 1G1YA 4JN1H 4J1UA 3G6JF 3UBXG 3TN0D 5I2IB 4Y2DB 1L7TL 2HN7B 1PJ9A 1A0QL 4JHAH 4OQTH 5SX4H 5F3HA 5FGCE 1CK0H 4ZS6C 2LABA 2ERJB 4TUJA 3ZKND 1NBVL 4H8WC 2FWOA 2Z92B 1FLTX 2B39A 1S9KC 3C5JB 3H2WA 4XWOC 1IGTA 3R0NA 1MJ8H 3UAJD 5GISL 5EU6D 5F7MC 4U2YA 3TO2A 3QT2A 4U31A 1OP3H 4QHNB 5TDOB 3DMMC 1EPFA 4IEFB 3O9WD 4DAGL 4NZTH 1U8IB 2LV4A 1Q9WB 5D1ZA 5I1DB 4K2UL 4PGCA 3NZHL 3UZEA 4Q2ZA 1DE4B 1KTRL 2HT4C 2CDEB 3BDBA 4HC1H 4JAMB 5D6DC 5TQ2H 4EZMA 4P4RA 2H41A 4GW1B 5I1LA 2VLLA 5L2JA 2YBRB 2IAMD 5FYLH 5DZNA 1YPZE 1N6QH 4FQXA 2E7CA 4YBQC 5ITBL 2ICEB 3HTLX 4KROB 5SWSA 1E6JL 1PY4A 4PJXA 4LHUG 4PJBB 4A6YL 4RRPG 1HNGA 4LVNB 1ZXQA 4MAYA 1OSPH 4HG4K 4MNGE 3K2UH 2IQ9L 3BW9B 5E03A 3IXAB 3WN5A 3V5KB 2P5ED 2AEIT 1WTLA 2A73B 1NMCC 2IAMC 2CKNA 4LLMA 1HILA 4IMKA 1IC4H 4OLXH 4LSSL 3MCKB 1HSBB 5K93A 1ZHBA 1QOKA 3BPNB 5KN5A 2J3SA 4F2MB 4FQ1H 2NZ9D 5GS2H 4H8WH 1F90H 2Z8RA 4M48H 4XMLH 2C4FT 5CWSB 4GS7C 5T3ZL 2IADA 1OAZH 2MOVA 3MUY1 1A9BA 3I6LE 3KXFD 5GIRA 5INDA 4X5LA 1Y6MR 3FTGA 1Y6NR 4I9WE 1AGFB 3WIFB 4QHUB 3FN0H 1SEBA 4KZDH 1KIRA 5HDBE 4K7PY 1J8HA 5LJYH 2V6HA 3TBTA 3BIKA 5F9WB 4CVXB 3DX8B 3AREB 5TE6H 3TBSA 3CX5K 4Y19A 2HFEA 2RFXA 4JDZB 4JREB 1A1MB 4YPGB 3AM8C 2FECI 4WW2C 5KOVC 4IM8A 1UT9A 2ZOKA 4WI8A 4N5UA 2PXYD 4Y16D 4MQ7A 3BPLB 5DUML 2YWYA 3KR3H 4H1LB 4R2GB 3IJHB 2BXYA 4P5TA 4X8JB 1JZ5A 4WUUB 5CJOH 3SJVD 1B2WH 3JWDC 4PRID 1JI2A 1RJLB 3C5SB 4DQOL 2VUOA 4KJWC 5JHDE 1NAKL 5DJ2B 5C2BH 3L3HA 3PWJA 2BFVH 3QIBA 1NKRA 1HYSC 2OR9L 4ISVB 5I9QC 5CS7A 4I18A 3CPLA 3PP3K 1CI5A 2YUVA 1TZGH 3GNML 4QF1B 2FIRT 3KWWA 2WWMC 3QFJB 3DBXB 1PZ5B 1KJ2A 2PYEA 3OXRB 3SCMB 4NQSA 4X4ZA 3IJSA 2UWEE 4NDMB 3QYCA 3TNNA 1LO0H 1I1YA 5KZCD 3VXME 1NGQL 1TFHA 3EO9H 1V3JA 2O5ZL 4IRJD 5JQHC 1MF2H 5KVMC 3FL7A 4O51B 4RIRA 3GHBH 5BW7A 5FYJH 1CD1A 1YZZA 5F44A 1MFDL 1OW0A 2F54B 2E27H 1LQSR 1OAUH 3M17A 2GTWA 4DN4H 3DXAE 3H7LA 4LVOB 3BAEH 2CUHA 3TVMA 4JO2L 1GZQB 4MD5B 3VW3L 2Q6WA 4D94A 2EYRB 3P30L 2CGRL 3PWPA 4JGJA 4NO0A 2R39A 4UV4H 4KVCL 2JELH 3BGFB 5DJ6B 4O2FB 3OR6A 4LMQI 1KBGH 1HH6A 3MRQA 4OGZA 1BGXH 4QTIH 3DUSB 5FKAB 2AK4D 3BPNC 4F9LA 1BZQK 4RX4D 1L4IA 5ADPL 3QHFL 1B0WA 5CSGA 3VH8A 3IFOA 2A6KB 4ALAL 3M1BA 2SEBB 3L6FB 2CIIB 5FGBA 3VWKB 5GGRY 2FX8L 4GXVL 1YDPB 1TTGA 3ARDB 4JDTL 4NO5B 5IG7B 1L9NA 3VXOA 1KT2A 5EPMA 1ZLUH 3DXAD 2GYSA 1A7OH 3SO3C 1RHHA 1XEDA 1S9VA 5EC2A 3PNWB 3U36B 1MCWW 4OZIF 4NQVA 2IAMA 1HKLH 4AMKL 2JIXD 1P2CB 3GSVA 4HF5L 3MA7B 5HPMA 5FDWA 1QSFD 4R4FH 1AGBA 5T3ZH 1DZBA 2BSRA 1QFWL 3EO9L 4J6RL 4M48L 1HHKB 4MNHA 3OR7B 1UZ6F 4JM2D 1HDMB 4P46D 5ESAB 1GAFL 4KJQC 4XCYA 3D3VB 1B9ZA 5FO7B 3NPSC 7FABH 1T4KA 4BZ2H 2VXSL 4I2XE 3RGVA 5B39G 3QUML 3I9GL 4NQEE 4PJHB 4XTRC 3GSOB 3N85H 1UM5L 3RWGB 3VD3A 1JL8A 1FE8L 4N90E 1MWAB 2MHAA 5IB5A 4PRIA 2Q7YB 3C9NA 3UTTB 3IT8D 2EEBA 2VAAA 2NCMA 3BZFA 4PR5A 2PYFB 2R0WH 5C07E 3BX7C 2BK8A 3QEQA 3TT1H 3UBXI 2G60L 5LCVL 4D3CL 5JO5B 2COQA 5EOCJ 4XRCA 1ADQA 4YUEH 2DQCL 3K8MA 5CP7A 1U36A 4NRXB 4H88L 5I76B 2GUOA 3MRKA 4UIKL 4KVCH 5T5NG 4I48B 1XIWA 3FQUB 5BXFB 4M7JH 2C7UA 1HK6A 2XNAB 4FP8H 2DIJA 4QRQB 1U8QA 4Z5RB 2V5RA 3T1FB 3OZ9L 1H5BC 3VXMA 5I1LB 3S35H 1GSMA 4HUXA 4TOYH 2VLJE 5FV1L 1RD6A 1T66C 1PW3A 3QO0B 3AXLA 4LCWB 2HT2D 1XGPA 4P9MH 1RMFL 1T2QL 2DQDH 4PJDE 3CZFA 3S37X 3TWCL 4KK8D 4O9HL 2OTWB 2OTUA 5F9DC 1IAOB 3U1SL 1X5YA 2DQFA 3STZB 3DTXA 3SPVA 3DLQR 3LKSB 4X7TA 2DF3A 5L8JB 4LSRH 5C09A 2AQ2A 1I8KB 2D03L 4LHUB 3MRHA 5D7JA 4UDTB 4F58H 1JNLL 5DD1H 2P5WB 3MYJB 3ARGB 4XMPH 4Y8AA 1UZ8A 1DQQA 4YHZL 4GRLD 4WI3A 3W0WA 1JZ4A 2ARJA 3AAZA 5E1AA 4OD3H 3BMVA 4JFHE 4ORGA 5B38G 4KMTL 3OX8A 2YEZA 3O3EB 4X9IA 2EH7L 3K2UL 3VI4E 5CFHA 4UV7H 3DHJA 1NC2D 1I7TB 5CCKL 5F3BA 5D8JL 1BQHA 1GRWA 3FT4B 1YUHB 4LQFH 4AL8H 4F7EA 2JB5H 1ONQA 4MSWA 3AM8A 2F58L 4OCWL 3DVGB 5H94A 4WTXA 4BH7B 4EUPG 2AI0L 4PTUA 2YZ1A 1EDQA 3WIFA 2JK5B 1SVCP 2PO6B 4I4WA 5BV7B 2VDNH 15C8H 3PP3H 4L3AA 3WJJC 4OUUB 2WUBL 4DZ8B 4F9LC 4Z7VB 1DVFA 4GT7A 2VDLL 4GH7B 4OCLC 4XCFL 4KROC 3OSKA 1S7TB 3Q2CA 4JKLA 1L0QA 3B8YA 4RRPA 1VGEL 4ZXBB 1FGNH 43CAA 5GISH 4YFEA 1A4JB 4UDUA 4KKLD 1RUPH 3ARBB 4XBPB 1UA6L 1NMBL 3SJVA 1X3DA 2ID5A 2VSCA 1NBVH 1TZHA 1YEGH 2AJXH 4LRIC 1NAML 2YD5A 1D6EA 2BVUA 1E0OB 2IWGA 3HRZA 1CK0L 1NUNB 1OGTB 1QRNA 1F6FB 1Y18A 4UT9L 1KCLA 4PUBL 1MJUL 3EYUH 3TH2T 2X42A 3TIDB 1ZA3B 3I02A 4JFYA 1VFMA 4HUKB 1QSFB 2WWMD 2A77L 3VGAB 2VERN 3O0RH 4PBWD 2EDYA 4QTHB 4JRYA 3WFDH 1R3HA 1P7KA 1AGEB 4K7PL 3H9HA 2WQ8A 3MOBL 4F7TA 2ED7A 3I84A 1JWSB 2ZOLA 3SDDC 3GSUA 4NJAH 5HY9B 1F4XL 5DD0H 3WO3B 1IM3A 3GJFK 3TVMC 3R8QA 1GGBH 4P23B 3FHAA 3NFSH 1DVFD 5CBEB 4YDVB 5FYLL 4JM2A 4GUPA 1ONQB 3G6JA 3EOAA 4PGZA 5E4EC 4OFKA 5TDOA 4PGBB 4U7MA 5EU7E 3WCYA 3MRPA 1JNHA 4TSBL 4AZ8A 4ELKA 2IH1A 1HCFX 4XWOD 5C0EA 2C3GA 4KDTC 1JWMB 4JKMA 1MFAH 3B2VL 5CEXA 4I9WD 3WNNA 1D5MA 3SDXF 5JUEH 4BKLA 1LO5B 1W0VB 2AEQH 4U6XB 1JNLH 4GBXB 5DD1L 1G7QB 5BO1L 3DRQA 1VEOA 4YO0A 3FFCE 3D48R 1XGUA 3SDXA 1A6TA 1KTDB 4MB3A 4Q6IC 3GKWH 4FZEH 1OAXH 3GJEB 5D7IF 5HHOB 1BOGA 3BQUB 4L3CB 5EORH 1YY9D 2QR0B 4UILL 1JZ8A 4DKDC 3MGTA 2AABL 1YEIL 3QXDA 1JTPA 5I1KL 1M7IB 1F8TH 1YN6A 4M7LT 5DVKA 5EOQL 3TBVA 4JFFD 2D31A 1DUYA 4PD4K 1I8MA 2VAJA 4R0LC 4B7LA 2W0KA 3QO0A 1QPXA 4OZ4A 3EGSA 3LY6A 1CF8L 2VISB 5BVJA 2I5YL 1N4XL 5D7LA 3AC0A 3OAUH 3R8BB 4ESKA 5E9DA 5IVNA 2WNGA 1R5VB 2ZPKL 4R7DB 1S7VA 2G9HB 3EYVB 4K55A 2YD1A 3SGKA 2ZCKH 4X5XB 1D7FA 3HLAA 1UQSA 4WGWB 4EVNB 4D3CH 1C1EL 1H3GA 3QPXL 4UT6L 2H32B 3DX7B 3QNYB 4QTHA 4CBPA 2G5BB 1KC5H 4XNUL 3Q6FB 3AS3A 2V17L 3K8KA 5LQBL 3VWKD 1FIEA 1TJHH 3SDXE 1KJMB 5IMMA 3HAEG 1MQKL 3QXAA 1OP9A 3ZKXB 1RZIB 4CVZA 3NMEA 3PJSB 1H0DB 2BY1A 3BUTA 4OT1H 4KKBC 1AHWA 4M3KB 1K4CB 2YXMA 4GAFB 4NP4L 2VL4A 2QBWA 1I1AB 4Q6YA 5HVHC 3VFSB 4PJ8B 2W65B 2ZCHH 3QSKB 4AQ1B 1F11B 5C3LD 1ZS8B 3ZTNL 2D7TL 1GPOH 4FQJH 1UH3A 2VLRB 2ICCA 4EXKA 4G3YH 1C5DB 5FGRA 5IT2H 5DS8B 1TVDA 4M7ZC 4KGJA 4YGVA 1U41A 3LEVL 4P2OC 2DI7A 3T77A 2K1MA 3MZGB 3CMOH 4ZSOA 4NM4H 1YEKH 3LS4H 3QPQD 1A1OA 5FYKD 1NPUA 1AKJD 4D9LH 4XBEH 5JPMA 2FL5B 1JJUA 1EEYB 1MNUL 3QZWB 5FKPA 3MSPA 5DEZA 1IQDB 3UTSA 1EZVX 4OAWA 4ZAKA 4JFDE 1CFQB 4NQCA 3FAXA 4HS3B 5IEKB 3VXNA 5C0RL 2V9TA 5M95B 3MV8A 2BXZA 1NCDH 5IMLA 1MRFH 2YSSB 3U83A 2HVJA 3IU3B 3WFCH 3QHFH 3KPSB 5IFHL 1W0YT 1U58A 3WIHL 4DVRH 1LDSA 4CAGA 5ITFA 1KJVA 3SE4A 4JO2H 4S2SA 2VABB 3TYFB 1OGAB 4MQSB 5E6YA 4FFVD 5KSUB 4TUKL 3BPOC 3NCBB 4UV4L 4D0DA 1VPOL 5D72H 1CGVA 3CFDA 2ZJSL 3ARGA 3FT2B 2XFXB 4HUMB 5ERWA 4YXKH 5D5MF 4G9FE 1DJSA 1G9NC 5MEND 1A14L 4GSDH 2CMRH 2BVTA 3MOAL 2DIAA 2EDJA 3UJJL 5C86A 2MWCA 3ZO0A 2K7QA 1U2HA 43C9B 3RA7H 4D0DB 3L3OA 1E28B 1CXLA 4Q9QL 2OTUB 5A3IC 5FYKU 1F4AA 1QQDA 1MEXH 3L5JA 1N3NB 4ZUVA 1AIFB 1ETZB 4Y2DC 4F15B 4PJ9C 5DHVB 1G7JB 1FG2B 3FFDB 1QACA 2ERJC 3T3MF 1CFVL 5H2BB 4M4PA 3BKMH 1M05B 1LO0L 5TGBA 1BVKB 4JRXA 1QYGL 5KW9H 2YPLB 3B6SA 4DVRL 1AR1C 3EYFB 4XWGL 3NIFF 5F89B 3VFVB 4Z77A 4GSDL 1CXEA 2EYTA 2QJDA 3GSWA 4QHLA 2AW2A 5I76A 3PHOB 5LGHL 2E3VA 2YD6A 3DIFB 5IB2B 4ZSOB 2XKUA 3QIBB 2P8MA 4ETYA 1BLNA 5JO5A 3IAPA 4K3HA 2AXJA 5CZVL 4M6OH 5I73B 2YR3A 3T8XA 2NYYC 1OB1A 2CQVA 2WANA 1NCCH 1IL1A 3HB3D 3WV0A 4DGVH 3FB8A 1T1XA 5T3XH 3D39B 1EUUA 2Q7YA 4MZ3A 3LHPL 3T0BA 3LKPB 2E6QA 4TULL 4JM4L 5HYJD 5HYSA 3CVHB 5C07B 3ZYZA 4P23D 2XG5A 3T8XB 3VFNB 5E8PB 1AHWB 2QADD 3J7HA 4R4BA 5CZXD 4AIOA 5AZEH 4XXCA 2ZUQC 4MNHB 4JM2C 4FXKB 2UYLA 4A2MA 5EZJA 3Q1SL 3ZE0E 1QLFB 1PKQB 2HYMA 4FFWC 3QA3B 3BP7B 4CN1A 3RA7L 4OZHE 1J8HB 4IRSB 4WV1B 1M71B 3QCVH 1GOGA 4YR6B 3T04D 5ISZE 4JPVL 2YPKB 4X9GA 3UTSD 1RULH 1FLRH 2R1YA 1H8OA 5ICXB 3TCXA 5IJVA 1IKNA 2AJZB 1AI1L 2GCYA 3RAJL 1D5IH 5DURB 4R2GC 3IFNL 1UYWL 1CU4L 4ODWB 1KEML 3SDCA 3DROB 3LDBB 3G5XA 1CGUA 4WY7H 3KPSE 2R56L 5CJQH 1X9QA 2APVA 1G9EA 1QR4A 3IVKB 3BZ4B 3CIQA 3MCKA 4RAUB 2VXQH 3LN4A 1S78D 2VMFA 5TDPB 1IAIH 3T0EB 3QIBD 1E28A 5K9KB 3MRJA 5IHLB 4PRPB 3L3OB 2OP4L 1MHCA 5B22A 5SX4I 4JPIA 3NIDF 4LLVA 2Q87A 3TVMB 4YDLB 4G9DA 4M93B 2BVPA 2NNAA 4JO3L 1KB9J 4UT6H 5EOCL 1YEIH 2AABH 4FFVC 3ILPA 1KIQA 2GAZA 4RGOH 4YO0B 1MCOL 4FQXC 3T0AA 5BVPH 1VFAB 1IGYA 2R0ZH 3SO3B 2ICEA 1HHJA 2YC1A 1T21A 1L6XA 1OVZA 4GS7B 2CIKA 1MJJA 3KYAA 5E8OB 3TYGL 1J8HD 1KLUB 4HIXH 4R26H 2I25N 3TYFA 3GB7A 2ENSA 1ERNA 1EEZB 3PDDA 3DX9B 3BEVA 3DXAB 3BESR 1FN4B 1I7ZB 2VQ1A 5JUEL 4HJJH 5GRYA 2IGFL 3EYSL 2VZSA 3VXNB 2Q76A 1HI6A 5IMOB 2YSSA 4Y4HC 3QI9B 5L88H 1K5NB 3IU4L 5MEPA 2I9LA 5JXAL 2X70B 1XGYH 2GK0A 1L6ZA 3RZCB 4OI7A 2FX9L 2VDRL 2YA2A 1MCNA 4Z95L 2DYPA 4PJDF 5C6PB 1Q72L 5L9DH 5F70A 4JRYB 2PW2A 4DVBB 1TJHL 2PCPB 5IEHB 1NQBA 1OTUC 5IHBA 4PRPD 4XGZB 5DHVH 3LV3A 4W6XB 5L2KE 1KPVA 3ES6A 2N7BA 1XR9A 3TZVB 1JNJA 2VYRE 4IJ3C 3H9SB 3RIFF 5HDQH 1EA9C 5JIHA 2H2PD 4KY1H 3KG5A 1IKFH 4GAGL 4M8VA 2VLJA 1TZHB 4I3RL 1A02N 1AO7E 4XBGB 4X7SH 2P5EB 3HNSL 4EI5C 5DMKB 3OAZH 4P2YA 5EBMA 2VB5A 3GIVA 1R5IB 2DM4A 3U0PA 3ILQC 4NNYA 2HTKD 1RZIA 4NZRH 1MIEH 4NRZA 2ICWB 4P3DA 5IMMB 3MJ9L 4P5TC 4P2OD 4ZUTA 3W9EA 1AO7A 2OR8A 2P8LA 1K85A 2C9AA 4PP1D 2Y9RT 3GSXB 5JHDD 3EHBC 4HQQL 2YRZA 5TF1H 5MENB 1R5WA 4GQPH 1TQBC 3ARGC 1S7VB 2G9HA 4MJ2A 4UQ3B 4HFUL 2D9CA 4L29A 1X4YA 2X10A 2H26A 5GGUA 2FHBA 5KSAD 5EO0B 1WWWX 4X0KB 3I75A 1FG9C 3HPJA 4LHUD 2EDFA 2KH2B 4NQEA 5GRWA 5I1EL 3F7QA 5IMOA 3QG6B 3MGTB 3NCFB 3RUGE 3BWUC 4ZO7A 2W0FA 3UBXA 5D7SH 4JY5L 3PV7A 4Z0BH 5F3BB 1JF6A 4WO4A 1T66D 4Y7MA 5TE7H 4HS6B 4ORGB 4YHIB 1VDGA 3WN5B 5C08B 3HR5A 1LK3H 5HVGB 4OUOA 5EU3B 1XGUB 1UCTA 3MV01 1KTDA 1S8DA 1AFVH 5EU4B 4N8CH 2P5WA 3MYJA 1G84A 5D7JB 1BP3B 1W8OA 1G7QA 5SWSB 1MHEB 3HNVL 4BKLB 2NLJA 4TRPL 4CNIA 4HG4J 2UY7A 3IDNA 5AWNL 3FQNB 3HZKB 2OL3L 4LCCB 1V3KA 4U1MB 3S35X 4ELKB 1CZ8L 3G9AB 3O6KH 3TPUB 2X41A 2K9UA 3ZYOA 5D93C 1U8LB 3BZDA 4OFPA 4XPAH 4PJ5B 4PRNA 5FYKL 4RGND 5DJCA 4XP1H 1U8MA 1AI1H 3E3QE 1S7QB 3SBWC 1KCRH 3PWPE 4K8RH 2IPKA 4MVBD 4O9HH 4WHCA 4YWGL 4YXHH 4W6WB 1PAMA 3C5JA 1NCAH 1QZ1A 2LFGA 2YUXA 2HJLA 2J7LA 3P77B 1X7QB 4I18C 1CR9L 3MLTA 3DUUA 1WIUA 1CICB 4HFUH 1R24B 4YR6A 4ZO6A 1ZT4A 2BSSA 1R3JA 3Q48A 2VC2L 1E4JA 4HCRH 1SVZA 3ULUC 3PHSA 3V7MA 4PLKC 2BOCB 4UNTA 2FGZA 2XQYG 4XPGL 1ES0B 2W07A 4YGAB 1UB6A 4KK5D 4NC1C 5EBMB 1QHPA 2P24A 3QNZA 2HT3D 4KROD 5EH1A 5F1OB 3VFNA 3QDJD 4FFYL 1QRNB 4XHJD 1HWGB 4XBPA 5D93B 1QSVA 4YHPA 4PJHA 3PIQB 2DWEA 2P47B 1GYAA 3SDCC 2R1WB 2NY2B 1E27A 1T1XB 1DQLL 3GMNB 3A6CL 2EH7H 2VL5A 1NLBL 1I85A 4PJHF 2JF1A 5JW4Q 2D9QB 4MDJB 5EBLA 4EEEA 2WINB 2V2TA 1FNGA 3RI5F 2CPCA 1PDKA 1HQ4A 2BSRB 3O2DH 4NRYA 2FX7L 4E41A 3GFUA 3ARFB 2NW3B 4LLQB 4KC3B 3BP4A 3DOSA 1GAFH 4NWUH 4XNMA 1SJEA 4G6AD 4YPJA 4ZS6D 3RIAF 3C60D 2KQMA 1YN7A 1ZA6A 2O61B 5E5MB 2LU3A 1EMTL 1Q8MA 3T1WA 5MI0B 4OGXL 3SQBA 1MHPH 5A16A 5KAQF 4DEPB 1NH6A 1HI6B 4OGYH 3VWJD 5E5RB 3QQ3B 2JB6A 2HJKB 2J8OA 4QT5A 2QLVB 4OCNC 4F7PB 2EDEA 1FG2A 5DHVA 2H2SD 2WW8A 5IR1A 2B8OT 1OW0C 4NUJA 2ARJB 4XAWL 2ADIA 3OG6B 1CIDA 3PQYE 1SYVA 4P3WA 1IT9H 1LP9E 4MAUL 3WFBL 3WEXB 3N06B 1NSNH 2XT1B 3O9WC 2DQEL 2YZ8A 5CD3B 5I9QB 3EFFA 4HIIB 4EN3A 2GAZB 5IGXL 3IDGA 4NPYA 4P48A 2BVPB 2NNAB 3QXWA 1PG7W 3ARFC 5HI5C 2EYSA 4LEXL 4GLRH 3I85A 4MDIB 3TZVD 4DCQB 4HWZA 2DIBA 1INEH 5DC4B 2NY2D 3MRJB 3CLEH 2XA8L 4JO1L 3LSOA 3X14B 4AM0A 3WFCL 1NLDH 4AT6B 3NA9H 4QNPE 4KH2A 4NKOB 2CO7B 2XWJB 1U58B 1HOCB 3C60B 4G9FA 5L7XL 2OI9C 2WUCH 2BY2A 5EWIH 2KQNA 1YECL 3M45A 1G9ML 3O11B 3B9AA 4C59B 1W0WA 2G5RA 4GRMB 3I9GH 2XWJA 4OFIA 1CDIA 4XXCC 4AT6A 4FTVE 3ULVE 2IFFL 2C3VB 1YEKL 3LS4L 3ZHDA 4U33A 5T1KA 4BUHA 5BS0E 5I8OH 4R4ND 3AGVA 2C1PA 3GSNA 1CLZL 1FFNB 4FTVD 1RZFL 4ODBD 2V5YA 5BOZG 5GSVB 5DUBB 3LPGA 4MXVE 1R3KB 1I7UA 3OKMA 5CP7B 1HEZA 2VDQH 2VWEE 2VQTA 4NPYB 3WJJA 5E00B 2CKBA 2NY4D 5A43C 4NZJA 4Z7UB 4U6YA 4ZPTB 5JXEA 5D2LE 2AKRB 5T3ZD 6FABH 4I77L 1VERA 1OAYH 2JCCF 3KYKL 3EAKA 4Y4KC 1S7WA 5IVOA 3X3GH 2PO6C 4PJ8A 2AQ3A 2QSVA 4NSKB 1LO4L 5ESAA 5DQ9A 1FV1A 3RGVB 1Q9KA 4L3ED 3BD5A 4WI7A 3IGAB 3MBXH 4MNQD 3OV6A 5I18L 4HUUB 4N8VG 1J0HA 5EBGA 2IG2L 4XNUH 3HC4H 3OAYK 1BLNB 4U1JB 1MI5A 3P4OA 5TE4L 3QQ4B 3ZKNC 1H15B 4JKKA 1I1FA 2KBGA 4JHWH 2YN5A 2NY1D 5DTFA 1XIWC 1ACYL 1DN0B 2FH6A 3VFUB 1CVSC 1JF5A 3TNMB 4NM8L 1IC1A 3R0MA 2ZNWA 4U1JA 1LK2A 1RV6X 4Y5VB 1QFPA 3WFEL 3QWQB 5A3ID 3VG0H 5HYJA 2VDKL 2VITB 4ODTH 3KJ4C 1CGYA 2F53E 5TE4H 1FQ9C 3NCEB 2VOTA 1G1CA 2F5BL 5CWSA 5KN5B 3MLWL 1ROWA 3MR9B 2QSCH 5HVWA 2HLAA 2APBA 3WXVH 2YPVH 5JDJA 4DN3H 3OR6B 4K94C 4E5XB 1M7IA 2ZNXA 1MH5A 3W39A 4DTGL 3MUGA 2Q8BL 2UWEB 5EULV 5DJ6A 2CRZA 3B4NA 1RJZB 2Y5TA 4H8WL 4LP5A 1UACH 5C1MB 4KQ3H 2F19H 3BEWB 3HPLA 3MLYL 4L4TD 3SE8H 1HXMA 4MNGA 5LVEA 3LS5L 2GTWB 1EAPA 2ED9A 1MCBA 3SDYH 1S7XB 3OQ3B 2WP3T 1A6ZA 2X4SB 4KV5E 1MVFA 5GRJL 2HJLB 5FYKH 5C2BL 3NABH 3VD9A 1MHHB 4P59H 2VN7A 1WBZB 1YPZA 5KJRH 1BIIB 1QBLL 1CZ8H 1WBYB 5I8CB 32C2B 3PE9A 4QXUL 4Z8FL 4NHCH 4KHTH 3TIEB 4GQ9H 2R4SL 1DCLA 2NY2C 5ACZA 2AXGB 2CRMA 4EI5A 2CLVB 3FOLA 4RX4A 2B5IB 1G9MH 3PQYB 2B1AL 2VLKB 1NFKA 3WL9B 4RGNB 3LQZB 3O4LB 1F97A 5IB3A 3KPQB 5HJ3A 2BERA 4CMMB 1IC7L 3QEGL 4U1SA 2ITCA 5FYLD 4DCQA 4LPWA 1G7PA 3BIBX 4ORZC 1LP9A 2UUDH 4L4JA 1L0XA 4TUJB 4G7VL 1OARH 1FNSL 2B5IC 1NEZB 2H8PB 2BY3A 5E95B 2EXWC 4WUUA 5ABDE 5C7XH 5EO9B 1MJUH 4J3XA 4PRBB 2VZTA 1J1PL 2Q86A 3UMTA 4CJ0A 4X4ME 3V6FA 2GT9B 3RWJA 1H5BB 2RAMA 3TO4C 3WSQH 2DLFL 1UA6H 2XIDA 4NYLB 3TFKC 1K8DA 3GI9L 4PIRF 4Q7DA 1K4CA 3TBSB 1RJYB 1MIML 2BJML 4IJ3B 4WVRA 4ZTPH 3SJVB 4KKAC 4IIQC 3OKOA 1C08B 2HFEB 2RFXB 3MNVA 3GJFA 2EH8L 1GH7A 1ZK9A 4K3JH 4KRMB 4QRSA 5E2VH 4PGEA 1OGAE 4RMWA 5GS2D 3WHE1 1KNOA 1TJGL 3RWCB 1QRNE 1SJEB 5HYQB 3NPSB 5EU7C 1YYLL 1BREA 3QNYA 1XH3B 2HMID 4JHAL 3EYOB 2CK0L 2OXHA 5IVZB 3WMSA 1ND0A 2CKBL 1FBIL 4JN1L 2L7UA 4NN6C 3MGOA 5DRZA 5E9DB 4EN3C 1CLYH 1WGOA 2FJHB 3SKMA 1KV3A 1N6UA 3L1OH 3C08L 3HE6C 3K7UA 4S1QL 3DVGA 5D1ZC 2EKJA 3QPXH 2EO1A 3H8NA 3N1MC 2R9HD 4WJ5A 3O3DB 3VFTB 2A1WH 2CLRB 3BH8B 1G7HB 4JZOB 4KMTH 5B38B 4Y19D 1T04B 2XKNA 1Y6KR 1U8JA 1UM6L 2EE3A 3GJEA 3VFGL 4OZGE 3AAZB 2R2BA 4XVSH 3IXAA 1TVHB 1EFXB 5IVXE 1YYMH 4MAYD 4PJXB 4NHUA 4C54A 5DJDB 4LKXA 3VXPB 3RBGA 3BHBA 2H8PA 3ZT6A 1BJ8A 4YHNB 1T5WB 1CICA 3P77A 4QRTA 5IBTL 4DVBA 1R0AH 1JCKA 2OZ4L 1DVFC 3L5XL 1BQLH 1FZOA 2EXYD 2VQUA 5GGVY 1CR9H 3U46B 4ZNCD 1MRCL 3S9DB 3ZL4L 4Y8DC 3KPTA 4HH9A 4U1SB 1IZJA 1E4XH 1U93B 3CFEB 4UINL 3WL9A 4PFEA 2E7HA 1GC1C 1KN4L 4ZO8A 3MBEA 1TZIA 3RWEA 5IOPA 4F7CB 1J9CT 4NT6B 4TSCL 3B2UD 2BDNH 4S1DC 5J13B 2ADGB 1B0GA 4LIQH 1MRDH 3MMEB 3U46A 1ZT1A 3HE7A 4HDIA 5FUZL 4HPYL 4DK3A 4R6UA 4HW6A 5C0BB 5EOCH 5JW4N 3QJHB 3CSPA 4UIKH 3VFGH 4FZ8H 4LSTL 1FNSH 3EKCA 3BH9A 1NEZG 4M62H 5F7LB 1ZSDA 1RK0A 3A6BL 4OLUL 1FIGH 3TN0B 3KPPA 1MCPH 4LKXB 3JBG7 5F97E 1B4JL 3HI6H 5L8KB 3CX5J 2F53B 4M61B 3MV9B 3WFDL 1AFVL 3O3BA 1OLZA 3O8XD 4NN7B 1Y18B 5DJXA 5KVEH 1AP2A 3LQMA 3NA4A 5KBNC 3NCCB 1ED3A 4R0LB 3CD4A 4H5SA 1NGYA 1MELA 4N0YH 4JFHD 4KKLC 1YJDC 4APQD 2BRRH 2CLRA 4HLJA 2J5LC 3FMGH 5J6GB 4LVHC 3BJ91 4X0KA 2CO6B 1I3RB 1U8NA 3BVNB 5FO7A 1OAQH 3SKMB 3DROA 4JPWL 4JCLA 1P4BL 3U7YH 4ZNEE 3KHOA 3KVQA 3MFFB 5GZNC 2D7NA 2WIIB 5HYJB 3D0VB 4KKAD 3RWFB 3GSXA 2A6IA 4K9EL 4X6CF 4HKJA 4Y5VA 4NKDA 8FABB 3GI8H 1VGEH 1DQJA 2DQUL 3MV8E 1RIHL 1KIPB 3U9UA 3MLXH 3TGXA 5FM4A 1I1FB 1P84K 1JWUB 1R5IA 3MRMA 1PQZB 2WZPD 3ARPA 3P4OB 3WIHA 2X9XA 1IKNC 5T3XL 1YUHA 4F7EB 1AGDA 2SEBA 1IZKA 2YKLH 1FYTB 2FLBT 3RWJB 5C0CA 1PLGL 4X4MA 3T4YB 2FJGA 4RMRA 2ATPB 3HNSH 2H6PA 1OAKL 4LLUA 3O81A 3INUH 2LU4A 4PLOB 4XP5L 4Y5XB 3QAZB 4KQ4L 5IJKC 1X5JA 2H9GA 3W0WB 4AL8L 5E08L 3KGRA 3QNXA 4KY1L 4IOFD 2CR6A 4NO2A 5C09E 2DKUA 3EO0A 5CBAB 1JYVA 5EZLA 4ODUB 4HH8A 1KFAL 4PJEA 1SHMA 3BPOB 3QUZD 1I7UB 1VENA 1KCVH 1BBDL 2HP4A 1AH1A 2I26N 2PTVA 5J4MA 1JHLH 2W92A 3FJTA 3B43A 1LD9A 4LLDB 2CSPA 4HCRA 1QBLH 3HI5H 1FPTL 4EQ2A 4PJIE 1DQTA 5IB3B 4R9HA 3O4LA 3QQ9C 4YNYB 5IV2A 4OF5A 4R97C 4IIQB 4XVJH 5IW6A 2AXGA 4HK3N 3DXAA 4KI5F 4LCWE 4YXLL 1ETZA 5DK2B 3T65A 4GKNB 1ZKAA 1WBZA 3LEYL 1XZ0A 1U8PB 3S36L 2P43B 3X14A 4AM0B 2P44B 1XIWB 4M7KL 5BXFA 4ODXA 3HMXH 3AY4C 4QF1A 2EDHA 3EZ8A 1NC2B 4QXWA 1KIQB 3CPLB 3VXRE 4KJYA 3OB0H 1XF3A 1IGMH 2P1YA 2BNQE 1T5XB 4L8CB 1FDLL 5C09D 1TTFA 2UWEA 3X12A 5IFHH 3KLHD 1BX2A 3HCVB 4LARL 1CXIA 3EFFB 4HIIA 1V7NL 3HE7C 4YDKL 3PABA 3FQTA 5E6ID 4JFEB 1OGAA 5EWIL 4KRPC 4PRIB 5I18H 2AK4E 5BCAA 5T3ZE 2Z4QB 4KUZL 4AQOA 1C16B 4XPBL 4JGUA 5FM5M 3TT1L 3FT3B 2UUDK 5IVXB 2DI9A 1ITCA 5F7HA 4LAQL 4OZGB 1U3HA 3MV8B 2DMCA 1FRGH 2EC9U 3ULVC 3LEVH 1U95B 1JK8B 3BIKB 3QUMH 4P0DA 5GGSB 1YQVH 3CXDH 4R8WH 3W2DL 3PUCA 4Q6IA 5AD0B 1UM4H 4LLQA 1S9VB 2NW3A 5KSBB 1M71A 5FYJE 3OHXA 1MI5E 4XAKE 4E41B 1HINH 3BP7A 5EPMB 1OQOA 2F74B 3ARFA 4JKWA 4JQIH 3ROOB 2WIIA 3CLFL 3D69B 4HGWA 3E1F1 3PGDB 3NCYS 2R9HC 2VDPH 1Q0YL 4KPHH 3VA6A 3OXSB 5C6TH 1G6RB 4JY4B 3IFOB 2QQKL 2KDGA 1C5BH 2AJSL 3H9ZA 3IXTA 5D1XB 5C0DA 5IUSA 1YECH 3HI1B 4HIHA 2QQQA 4YBHA 4Y5VC 3VFSA 3FKUS 5L7XH 1CYGA 2EDRA 2QKIA 5F7EL 3N0PB 3BUYB 3JUYA 5LQBH 4I0PB 1T89C 1KCKA 3DGCR 2ATKA 2X1PA 2UZIL 3ZLQC 3D6GA 1I9RH 3LPFA 3MBEC 4GKZA 1UENA 4XHJC 2HLFC 1MCCA 2EEDA 2EYRA 5HTSA 3JV5A 4XPBH 3D18B 4MAYB 1BMGA 2CRIA 3DIFA 4WGVB 5JIKA 5DVOA 1A3RL 4BQBA 4BQCA 2J4WL 5J56B 5IB4A 4YHLH 1ZT4B 5C08D 5ICZA 5HHOD 1TCMA 2CGRH 3DUUB 5ID1A 4LEOB 4YDIH 2FBOJ 1XFPA 4J4PD 1JNNL 5SWZD 4DKFL 4P4RB 2BY0A 3V7AG 1RZJH 5CMAA 3V5DB 4Z7VF 2YK1H 1H3VA 2XN9E 4NBXB 2DL2A 1TDQA 4PJAB 3STBA 1A7RL 1LNUA 4OFVA 4NCC1 5DJCB 5FCUL 1HYSD 1FFRA 3OL2A 5C9KA 2DL9A 3CFJA 1QQDB 4APQB 4HH9B 3DBXA 1LD9B 2C4XA 5I16B 5BO1H 5GGQH 4QRUA 3IDYC 4Z18A 5AZ2H 4XVJL 3EO1B 4B53A 1ORSA 2O5ZH 3JV4B 2X4NB 1FZOB 3DETC 4ISVA 1VADA 5E2WH 3PWJB 3ZKMC 1XF4A 4XAWH 4UT7L 4XCNA 3HG1B 5DJ2A 4LCYB 1XGRA 4X9FA 2IMMA 3SGJC 4AK1A 3UXFA 2XACC 5J8OA 2DQTH 1EEQA 3F7PC 1F5WA 1G7MB 5IIEB 4YXKL 4HGMA 5CEZL 2IF7A 3PWNA 3A0OA 1KGCD 4XT1C 5HGAB 4XC1H 1VPOH 5D72L 4JB9L 3MJ7B 5EU3A 2X9YA 5C0BD 4ZODA 2RCSL 1M4KA 2C3XA 2ZOKB 3P0VH 1LP9F 1ZHNA 1IEBB 3ROLA 3CJJA 3EOAB 1WISA 1JHKH 1CXFA 5K9OB 3DO3A 3FQXA 3D85B 5A16B 2Q1EA 5E5MA 5I1JH 1SEQL 5JOEA 3FHQA 3QWOB 4G42A 3CFKB 1J5OH 1EEYA 2VUYA 3MCLL 2O5YL 3GMOA 5EUOA 5L6YH 1A1OB 4O58H 3MGOB 5DRZB 5GGTA 3WLBA 4C56E 1DQJB 2QV2A 1S7UB 1KYOJ 2EICA 4WUUD 3BRGC 4RDQF 4E41E 1FZJA 5JXED 1A6AB 4GG8B 1Z3GL 2QQLL 4JO4L 4ZUTB 3W9EB 3MFFA 3PHQB 1A6VL 1G6RH 4HX1A 1J1OH 3FN0L 5C0ND 2ZUWA 1S9XA 5IT2L 1KGCE 3RL1A 2O26U 3RVUD 1GIGH 3PIQA 1NMBH 4DEPC 2J6EA 3U4BL 3OKOB 3GMRB 1NBZB 2IBBA 3RPIA 2B0SH 4M02A 3OKDA 4WO4C 4DW2L 3OMZA 4M3JA 4GG6A 4LU5L 4FNLH 1LE5A 4L3EE 3ARTA 2VZ1A 3BRDA 3MLZH 2GT9A 4Y4FA 2LTQB 4TVSa 3UYPA 4XNYL 4EOWL 3W0WD 4NIKB 1XR9B 1WITA 3LZFH 1D9KD 4PJ9B 3Q3GA 5IROC 1IQWH 4PS4H 4K8RL 4EUPB 3MLSH 3SDDB 3PP4H 5HGDA 1GGUA 3DSFL 1QR1B 4K3EL 5HHOE 3AROA 4EI6A 2XRAH 2HFTA 5D1ZD 1J05B 1KTKE 1RSFA 2DYPB 1LP9B 3RIAK 2AXFA 2DD8H 3P0VL 1P9MA 3BI9X 4M62L 5J9PB 1V3MA 1QKZH 5BVJB 2GTZA 2F8XC 2CH8A 5GJTH 3HMWL 3L3KA 4C56A 3WHXB 3TPUA 3PP4L 4WFHE 1MCDA 1ZTXH 2IALA 5D1QD 1DLHA 3HFMH 3LVEA 4X6BB 1IQWL 5TQ2L 5HDQL 3HZKA 4JN2B 3W81A 1HN1A 2Z31B 3VWJB 1HHHA 4EOWH 4XMPL 3HMXA 3BQUA 4L3CA 5IWLA 4W4OA 1FN4A 2NZIA 2YEZB 3O3EA 5EN2A 5C0FB 5HGAA 3GSRA 3NCJL 1QUNA 3S88H 4GBXD 4JGMA 5EORL 5FGSA 3BPCB 5J1AA 1QTYT 4QRRE 2AJYL 5EU4A 3U7WH 5E7FA 3ILPB 4L8DA 2NY6B 1BEYH 1JPFB 3IKCA 1JGDB 2EIZA 4OZIB 1PYWA 1MCKA 3GRWA 1EFXA 2DKMA 1YYML 1Q9OA 5CSBA 5HHNA 2X4NA 1AQDB 1MPAL 5JR1H 4X7TB 3ZYIA 4D9RD 5C08A 1Z5LB 1RIUH 4IDJL 5TDPA 5I16A 4HS6A 4KK9D 5IHUH 3GM8A 12E8H 5TF1L 3KPRA 5FUOH 1RY7B 1JNNH 1QNZH 2Z8WC 1NMAL 4YDVA 1AGCA 4TTDD 1WF5A 1U9KA 5FB8A 1VESA 4YE4L 5JTWA 1MOEA 2DJ4A 2IC2A 1PKQE 1YC7A 3HC0B 3RUGF 2H26B 2VXVH 4LMQE 5DR5H 4LNVA 4P5KB 2F8VA 3OKYA 5ICXA 3RP1A 3L95A 2YA1A 4OIAA 2X4OA 1F4XH 2GCYB 2V7NB 1AGEA 1CWVA 5F96H 2C7UB 3TNMA 5JMOC 1IGCL 3RWIA 1RUKH 1HSAB 4F3FA 5FOBB 1QBAA 3MV8D 1P1ZB 1QLFA 2F54D 5FCSH 4RGMC 1SY6A 2XKSA 1OTSD 5HVHB 1C08A 4KXZI 1BQHG 1N7MH 1CDGA 2R2EA 5LGJB 4U7SA 1RURH 1XGYL 4G8GE 5DT1H 5C6TL 3HAEH 4KWUA 2R23B 1Q9KB 2VLJB 4WFED 4S1SH 1NGPH 5L88L 1YPZF 4YAQA 4PREA 3QCUL 1KOAA 4J6RH 4OCYL 1N0XH 4KXZH 4X6CA 5AAWA 2A6JB 1CU4H 4M7ZB 3DMMD 5ACMA 3MBED 4QHMB 4XCYB 5AUMB 1EGJL 4G6JL 1XCQB 1W2KT 2QQNH 1ZLUK 1J7VR 1SJXA 4LCUA 3B3IA 3ES6B 1X44A 4HBCH 2A74B 3ROOA 1ZLSH 4JDTH 1RZ7L 4DOHE 4MXQD 2P8MB 3GSWB 1P2CA 3S3PA 3FONA 4Z7WE 5J6HB 1GXEA 1S7UA 1EHXA 5DD5H 2VDML 3LN9A 3KAAA 1QEWA 4LSVH 4QO1A 2WUBH 4WW1A 5DZLA 1J1XH 4JJHA 5T1KB 4M1DL 2AS5M 4GW5A 3TN0C 1BVKA 5C0BE 3WYRA 4AH2B 4LF3A 3U7AA 1QD0A 3EYFA 1MUJA 5I1CH 2H3NA 3R1GL 3OKNA 2ESVD 4R96B 3RUGB 3VXTB 3N9GH 3ROLB 3MLUH 1YEHH 3FT4A 4O2EB 4GW4B 3M1BB 1FO0L 3TIEA 3DX9A 1B90A 5I8CA 1WBYA 3ARRA 1KLGB 3P30H 5DYOB 3D0LB 3X3FL 1GVIA 3FB5B 4JQVA 1KXVC 1F3DH 1TVBA 4KKNA 4AG4L 1OTUD 1S78C 1BX2B 3V4PH 5K59E 4RZCA 4PJGB 3HG1A 4PJDA 3JWOH 2AK4A 3NZ8A 3VXRD 1N64L 4JE4B 3GZKA 1Q0YH 4KPHL 4EBQL 5AG8A 2DMBA 5ERWB 3FZUC 2AXHA 3H7BB 4NQUA 5HHQA 1MH5B 3BQUC 1M1SA 4LSRL 1ZLWK 5IWLC 4OLYL 4Y4KA 1P4IL 2VWEC 2YWZA 2BNUA 2FNBA 4L5FL 4K94H 1OF2A 4OTXL 3TBWA 1KJVB 1KB5H 3WXVL 4U1KB 3TF7C 1JHLL 3PWVA 1CE1H 4OD1L 4HUXB 2GFBA 3P0GB 3K81A 1HIML 2AGJH 2X9WA 1PX3A 4TVPL 5EIVA 3WFEH 3MV11 2ZKHH 4JQXC 2X89A 2XNAA 4JRXD 4L3EA 1NAKH 1YN7B 1ZA6B 5BZWB 1JPTL 4O02H 1CXKA 4OSUL 5DUPH 2NR6C 3DETD 4RMUA 1N2RB 4I18B 5E08H 2E8ZA 4J8RB 3B5HA 5FYJD 3S4SA 2BRQA 2F54E 5KS9F 3MV7D 5F9JA 1GGIH 4U6TA 3CU1A 4G9FD 2HTLD 1A3LL 5KVGL 5EBLB 5IBLD 2FIKA 3QIUB 2OSLB 4YEEA 3MRGA 2PNDA 4TVPH 4F7MA 2I9TB 4JFZL 5K9QI 1H3XA 1WZ1H 2FJFB 3HC4L 1EAJA 4XX1E 3MRNB 2R0LH 5DI8A 2GIYA 3DARA 5SX5K 2JCCE 3QDJE 4JY4A 1FZMA 4M7KH 2VO5A 2XTJB 3WDIA 3QIUA 5FF6B 3CMGA 4F7MB 2E9JA 2J8UB 5DUPL 4WU5A 2W9LA 3NTCL 4HKZA 1JI1A 1H0DA 4ODVH 4YPGA 2GSGA 3I6KA 3GI8L 1FO0B 2YS4A 1HEZB 3NCMA 5CINL 2XZAH 3ZZ1A 3FB6B 3HAEA 1U8OA 6FABL 1X5XA 4QRRA 5F89A 2CMRL 3I50H 2V7NA 4RISH 1NFDA 3RY6C 1T7YA 4FQ1L 2ZJSH 3SDAA 1JK8A 3ARDA 1NUFA 4M1CD 3C8KA 5TGBB 2EDBA 3NIDE 1PEZA 3MJ8A 3B6SB 3QO1A 2A83B 1WWCA 1NFDF 1XGQB 3EGSB 4RGNE 1R5VA 4AEHL 4J3UA 4Y4HA 4Z7UE 5A1AA 5DRNA 4P57B 3PWVB 3VGEA 5J0BA 1DLFH 2M1KA 5FGCB 1S3KH 4KFZC 4PJGE 5DZOA 5T1DL 3QPQC 1CDCA 4HIJB 2HLFD 1RU9H 4NQDE 1RVFH 4ENED 5FDYA 3R1GH 1WQVT 4KQ4H 2DQIH 1BQSA 1T0MB 1U3HC 3MX0A 3V0WH 3HS0B 3INUL 4HIEA 4UZGA 5C07D 4QCIA 5EU6A 3P4NA 3SDXB 5D6DA 4ZAKC 2Q6WB 3E6FB 1CGXA 2E6PA 4XBEL 2EDNA 2R0KH 4NNXA 4JO1H 4YQXH 3GMQB 1NC2A 1VA9A 1ZSDB 5F72S 3CFDB 3FT2A 3PWUA 5J12B 3KPOB 5GGVL 2E9WA 1NCDL 3C6LC 4OZHA 4MA8H 4OF3A 2XI9A 5DRWA 3TO4A 4GKNA 3MRIB 1RK1A 2MJWA 5CEXB 4K8RD 1S9WA 2Y6SD 4UINH 1FNEB 4WO4B 4RFOH 3BZEB 3O2DA 3G6JB 3CCHA 2ADGA 4R96A 2HVJB 3IU3A 3DX6B 3QG6A 5C0NC 1A2YA 2ESVA 4PJGF 4S1DD 4HS3A 5MEOB 1YMME 2E9BA 4U3HA 3O4LE 3QH3B 1WWAX 2QQNL 3NIGF 4ZQKB 4ZSOE 3T77B 4D2NA 4WRLA 2D3VA 3V52H 1HH9A 2E9IA 2VR9A 2PR4H 4MHHI 1NBYB 4ZOEA 1IGFL 3EO0B 2UZXB 4PJ9A 3B2VH 3QAZC 4LPUA 4Y1AD 1CFTA 3RDTB 3V6OE 3VI3E 3GO1L 3UJTL 1I9IH 2FATL 2A9NH 3GIZH 3EDEA 4JFED 4NP4H 3QNXB 2C1OB 4LLYB 1WICA 2OX5A 5DT1L 2ZCKL 4HLZG 2BVYA 1HCVA 3RWHB 1J8HE 2I5YH 1Z0NA 1ZV5A 4S1QH 2Z31D 1RZKC 1ZGLA 4XP9H 4C4KO 1TQCB 3GRWL 4DKEH 2W0PA 1G7HA 4JZOA 1G9MC 5ICYA 1T83A 3O3DA 3DNKA 4CVZB 4OFYD 2I60L 2RIKA 3IB4A 5AEAA 4U1NA 4PJBF 4H25B 4F9PC 1ADQL 5F8RC 3K74B 1R3JB 4E42B 4PV9B 2WWKO 3U0TB 5D7KD 1KB5B 3BKYL 4ZAKD 1KN4H 3A67L 4CU7A 2RR3A 3EYOA 4ZFZA 4IOIA 1WZLA 1K4DB 3H3BC 3EYVA 4DZ8A 1JRHL 1UQSB 2HFGH 2NY3C 2PO6A 4I4WB 4PJ8C 3VXRB 3SGJA 4YHML 4TYUA 2IADB 4WFHD 35C8H 1S7QA 4WWKC 3PL6C 2D7MA 2IMNA 4KZEL 1MFAL 3MFGB 1KEGL 3WSQL 4YDLC 4HULB 3BMWA 3QI9A 3ARZA 1YN6B 5E6IA 3TBYB 4MLIA 2FYYA 3MRFB 3ULUD 3VFOA 3ESUF 3VXSA 4M5ZH 2P7TA 4PB9L 4XP1L 3RBSA 3P9LA 5DHXB 2OL3H 4XXDB 3MV9A 4LKCB 5AWNH 2EIZB 5ALCH 3FFCA 5BW7C 1D6VL 4YHKL 3U4EA 1MCFA 3H9SD 2NY5C 3F5WA 1X5IA 4M6NH 5EO9A 1T20A 1JGDA 3MRBB 4XCNB 1WIPA 3L3GB 3BPCA 4RMSA 1KG0A 1XF2A 4KTEH 3P9LB 4LRNL 3RHWK 4BSVA 1E4XI 3U4EB 3E6HB 5IQ7H 2AI0H 1JWMA 3O6FD 2Y07H 4PJFB 1GL4B 3SY0A 3REWB 3HMWH 1P5UA 1DQMH 2FEDC 4UB0L 2F58H 3LN5A 1YMHA 5ITBH 3SKJL 4GRWE 2IPUG 5EN2B 2CKBH 4O00A 1UJ3C 1IAOA 3ZHKA 3LN4B 3OGCA 4MNQE 3MBEB 4PJCA 4N8VB 5F6IB 4JM2B 1I1AD 3MPCA 2ZUQB 3F65A 1HQRB 1OP5K 5D7SL 1D6VH 1YJDL 1VKXA 4X83A 1KB5A 2W91A 2NY1B 1KENL 3VXMB 1HZHL 1EHNA 3UROR 2Y5EA 2IJ0C 5IBLC 4QRTB 2P8PB 3UZQA 4QOKA 2CLZB 2VDLH 1P7KB 5GGRA 5I8KH 3P73A 3ULUL 35C8L 2EO9A 3HZVA 3SQOH 2HN7A 5D96C 3D18A 2GUOB 3MRKB 4L8SC 4PRHE 5HHXH 2R2BB 3GM0A 4H1LH 4TSAH 4ZO9A 3S97C 1IEAB 4JDVA 4LLWB 2WBJD 4X6DA 3MUGB 1KELL 1RUQL 3FO1B 1OGTA 1CLOL 1G6VK 1VHPA 4GG6B 3GMRA 5D1XA 4E0RA 5D8JH 1IMHC 3DURB 3OXSA 2HLAB 1NBYA 3K8LA 5C9JA 5L8LB 4HX1B 4P23C 1EIBA 3ISWA 1HDMA 2W9EL 4JB9H 2A9NL 1CIUA 1JPGB 2O5XH 1EERB 5HSFA 2DLEA 3G6AB 4MZ2A 4NCC2 3GGWB 3RVXC 1SY6L 2IPTL 4RWHA 1S7SB 1SJHA 4K71C 2P48B 4WTZA 5C0JA 1I9IL 3EJJX 4HEME 3VXOB 4XI5D 1MQ8A 4Z95H 3VFVA 3PNWA 4MMZC 4WW2B 3VGAC 4LGSB 3O6FC 1YDPA 1FORH 4F37K 4FQHB 5H94B 2ED8A 4HT1L 4NO5A 5IG7A 3UEZA 1TJGH 2AEPH 1EFXD 1V7ML 5LG1A 5GHWL 4Y4FD 3QFJE 2Q76B 2EIEA 3EJZD 3OJDB 4NQCE 5CIPA 2VXTL 5K33A 2VQ1B 1A47A 5DRWB 1G7JA 3NPZB 3ULUF 3MLVH 3OKLB 2EIBA 3MROA 4LNRA 1C16A 1A9EA 4UTBH 4TPRL 1ACZA 1I9JL 3HNTH 2FSEB 2MTPA 4FMFA 3W5MA 25C8L 1WFNA 2A38A 5FKAA 2X7LB 4X6EB 2UY6A 5TQ0H 5DD3H 3P4NB 4DN3L 4G7YL 4GOSA 1XF4B 3GMQA 3OF6A 4PJEE 5F9OL 4RGOL 5TFSL 1XF3B 4LDOB 1EXUB 1J0ZA 2OMNA 3MQIA 4YQXL 4X99B 3JV4A 1QP1A 4X80L 1CLCA 2AJUL 1SMAA 3EFDL 5FFLA 1N0LA 2ITCB 2HKHH 1NMCB 4KU1A 1JYXA 3DTXB 3SPVB 2UVEA 2C3VA 2OTWA 3AXLB 4WI5A 2XTJD 3CFJB 1NC4A 1OD7A 5FM8A 1ORQA 1T0NB 4P2CG 3V4VL 3GSNL 3OPZL 3U0WH 4G8EB 4ONHB 4XB8A 4Y16C 1I1YB 3EDJA 1X4ZA 4BQ9A 1KTLA 5M7QA 5IJKA 4OKVB 5CUSL 3DGGB 4YIQB 3QEQD 4NGHL 4WIQA 2R1YB 3VXSD 3FB6A 3IJSB 1FH5H 2PYEB 5A2FA 5D96B 1NSNL 5D70H 1MFBL 2AQ1A 4JPVH 4WV1A 3ZTJG 2YXFA 3OB8A 5DK3A 1CFSA 3JTSB 3P9WB 4U2ZA 3TLRA 1UM4L 4WHDA 3ZKXC 5BQ7A 4JLRB 5KAQG 3H3PH 3CUPA 4MVBC 4PRDB 4GKZB 4Z0XB 1DEEA 2FJFA 3QCVL 3NTCH 5JPNB 4U05A 2ATKB 4F33A 5FF6A 1GCFA 3C2AH 2NY5H 4ZFOL 1BJ1H 3O4OC 2ADIB 2XZAL 3C9NB 4U0RB 3I50L 4RISL 1MFBH 5BQ7B 4NUJB 5IR1B 5BMFL 2I9TA 1QG3A 3PL6A 4U1GB 1AGDB 5JW5B 4HGWB 3EYQC 5DC0A 5F7DB 4U3XA 3L3IA 4LVHB 3QULA 4PY7A 5KTEL 3H9SE 5C08E 3FRUB 3PJSA 1SM3L 5F7KC 3PV6B 2R4RH 4U1HA 3BGMA 1KCSH 4G80A 5DDHB 2GJ6A 3VMOA 2VDKH 4ODTL 5DD6B 4JCMA 3AY4A 3TBTB 3WS3B 2R2HB 2HTLC 2ARWA 5K59F 3O3UN 4MA7L 3NH7L 4Z7QF 1SEBB 1Q0XH 3DX7A 1UEMA 3JTTA 2WBJB 2HWZL 4QOKD 2R69L 2DM7A 4KUZH 3AS1A 4LL9A 2WINA 4ONFH 5C0GB 1JMZA 4WNQA 1I85C 4N9OB 5CEYB 1VFOA 4Y4KB 1J88A 3TZVC 5KANG 1J87A 3IETA 1J0YA 1QFUL 1I8MB 3JSSA 3P11H 5D2LB 5IGXH 2NXZD 3KNBB 4YHPB 1K3ZA 3PABB 4FXGA 1JPTH 1BD2D 4O02L 4R7NB 4K94L 1MEXL 2CJUH 4ODSH 1QSEE 1UJ3A 3QI9C 4Q9QH 3KJ4B 5H8DA 3W11C 1BD2B 1T5XA 4L8CA 4ZUUA 3SO5A 2FECL 3MLVL 3AB0B 1R3KA 3EOBA 5DO2C 3LIZL 2NXYC 4JJ5B 1CDHA 3WFHB 2VH5H 2EDDA 5H37G 2X89D 1AJ7L 2FR4A 4NN5C 4OV6F 4PJIB 4ODXB 2V5TA 4Y4HD 3HZYB 3ZT7A 4YIQA 2VABA 4XPTL 5DFTA 1KTLB 5B4MD 2UV3A 1I7RA 3DRTA 5C0EB 5CILL 1J18A 4JANB 3ULVL 1OP3K 4I13B 3IDXH 4IIQA 4S0SD 1Q9WA 4P49A 2VE6A 1N64H 5MI0C 3VU2A 5IW6B 4NQED 1YEHL 4BA8A 1R3IH 5D1ZB 1FHGA 4DZBA 1KFAH 4RGMB 3QZWA 3Q0HA 3G5YB 2BSTA 2EDLA 5IK3B 3RVUC 2KUTA 1SYSA 3WIIH 1J8KA 2NY4B 1H3PH 1IGTB 3AFLA 2KL6A 5DS8A 3KR3L 4YHNA 1PSKH 1EH9A 1QFHA 4LCIH 3RJDA 4U1LB 4KDVA 4TSAL 1QSFA 1MLBA 1ULVA 5F7FA 5IBUB 3KDMB 2F9BT 5EUOE 3TT3L 1LILA 4X6DB 3RTQA 2ATPA 3MNZA 2YOCA 4LSPL 5LGJA 2XKNB 1AR2A 4L8SA 3QCUH 4OCMC 1VGKA 3Q5YA 2MCG1 3BOVA 5EFIA 1NGPL 4JDZA 3QQNA 3UPAA 1NCAL 2F5AH 2ORBL 1SBBA 4KK6C 3UC0H 4OLWL 4W4NA 5DO2D 4WTZG 1KIRB 3QHZL 4QHUA 1TMCB 4XNMB 2CRYA 4HT1H 4HUWB 3CC5A 5C0JB 2G5BA 1DDHA 1OAQL 1KC5L 2JJVA 2EXWD 1U91B 5FO9B 2RBLA 5BRZA 3WD5H 2NXYD 1IBGL 3KHQA 3L7FB 1NGZA 1FNGB 1GGCH 4R7DA 1RIVL 5FB8B 2DN7A 1CE6A 4EDWL 1JP5A 2W9DH 4ZUSB 2NTFA 3BD4A 3DVNB 3O2DL 1C5CH 3QDHA 1KN2L 3GIVB 1S5HB 1HNFA 5SWZA 1U92A 1E4WH 3SY0B 3MJGX 1WCBA 3A6CH 3QUYC 4B50A 5D1QB 1NCUA 4N90D 3QBTB 4POUB 1F58L 3RFZC 4I0CC 2WLYA 4YC2B 3JV6B 2IPUK 4MCZA 5CIPH 1Q9OB 3O3BB 1K6QL 3ARBD 4N0CC 5CJXA 5F7UA 2L0DA 1F8TL 5CGMA 5KS9A 3KYOB 4HZLA 3VCLB 5DVMA 3ARVA 5C0FA 1NMAH 1ZEAL 1MI5D 3WN5C 4WU7A 3EYQD 4TSCH 3MRFA 3PGFL 5GRUH 1ZVYA 5L2JB 4NZDA 1ZT7B 3TBYA 1G7PB 3ETBF 4GMTL 1RIUL 2GITA 4M5YH 3LKOA 4UQ2A 1NJ9A 1UB5B 4XI5C 4HHAB 3BWAB 1B0RA 4CUCA 4OCRH 4IDLA 2XTJE 3BXNB 2WBWB 3QUMA 1AXSA 4OV5B 4N0FA 4P4KB 3S88L 4HWEH 1BEYL 3OJ2C 5JW4M 3WHXA 5I1DA 1H3UA 1ZT7A 3U9PH 3RPKA 1YNLH 4GMSH 1KCUH 5F6HI 4X9HA 1F42A 3MLRL 1O0VA 2G75A 3CVHL 4RCAA 1QLRA 3CXHK 1K8IA 4EI6B 3RVWD 4JFDB 1WSST 5ETUB 1DBBL 5HY9A 3MA9L 2I60H 1VFUA 2B4CL 5J89A 4ZDHB 3O2VH 4PJIF 1DFBH 4O2CB 2J88L 2IBZY 3BRFA 1YEJH 2YRLA 3S37H 3X11A 3VXPA 3MCG1 3MV7E 2DD8L 2CK0H 3ZKSD 2X4UB 1MFCL 3BHBB 5CKAA 1H8NA 5DJYB 3GUTA 1TVHA 4K3EH 4HUVB 5SWZB 5CJQL 3W39B 5C0AE 2ZG1A 3EYUL 3TESA 1WT5A 3HUJB 3BQUD 4L4VB 1MCIA 4UT9H 4MB5A 4PY8I 3KLAB 1UYWH 1YEGL 1T04A 2MHAB 4L8BB 3ZE1E 3V5HA 3DSFH 5E6IC 1NGZB 3GSOA 3MXWH 4JY5H 4FXLA 3LB6D 5BRZB 4FNLL 4LSUH 4GAYA 4WHTB 3V6OC 1LE9A 3MLZL 1HHKA 1A64A 1RUPL 4HZAA 2LVEA 5C7XL 2BNQA 4LCIL 2F5AL 2ORBH 2X4PB 3UC0L 3GSVB 3MA7A 3T3PF 5HPMB 3QIWA 5C71A 5D4QA 5DVNA 3TT3H 1G6RL 3BO8A 2XN9A 2HKFH 4O58L 2ADFL 3KPSD 5DEGA 3BKYH 3F6LA 4PGEB 4QRSB 4R4NC 2QQLH 4U1NB 1PSKL 2UYLB 4YFDB 2XWBA 5I1JL 4MCYB 3V0VA 4XP4H 3SDAC 5JA8B 1H3PL 4IOSD 3RTQB 4YK4C 1RJYA 2ZSVB 1T6WA 3JVGC 5D5MB 4RFEB 3BKJL 5FUCC 4JQVC 1JF1A 5T3XD 3U6RA 1SMOA 2Q86B 3L5IA 4JFFE 1MJ7H 1OARL 1XGRB 5L6YL 3MOQA 3QUYD 3FB8B 3UTOA 3TZVA 5CILH 3NBNA 3SKUD 3PXHA 4QRPD 2MCPL 3FRPA 4ODHH 4U1IA 3HS0A 4HIEB 4MJIE 2GSIB 4Q9RL 3MRHB 5DJAB 1JRHI 1AJ7H 1HH9B 1OGAD 4K7FB 1JZ2A 4APQA 1JTTA 3ME0A 5IK3A 5SV4A 5DSCB 4YHZH 4NO3A 2VE6B 3VGFA 4QXUH 5KSAB 3U79A 3ZE0F 2Y36H 3NFPA 3DRTB 4GJTB 5ISZB 2FCBA 1FLRL 2Y7QA 3K4ZA 5T1KD 4XCCL 5GGTL 2APXA 1I8IB 5FECB 2APTA 1C7TA 4Y19E 5FCUH 3FFDA 4RIRB 3F7VA 5FA4A 3HZYA 2VSDA 5AZ2L 5EUOF 2E6JA 1FNEA 1RZKL 3MNWB 4QRRB 3IKKA 1RZJL 2HTKC 3SE8L 5EG6C 1RMFH 4P9ML 3MV7B 1KJ2B 1FP5A 2AK1L 2B1HH 4QRRD 3SCMA 1EFQA 2AJVL 2HG5A 2OK0L 5TDNA 1F2XK 4TOYL 3FO2B 3IRZA 2MKWA 2BVOB 2B2XL 1XCTB 4OQ1A 4JZNB 2Q3ZA 5MENE 3OZ9H 4ZMAT 4HSQA 1EAPB 5HPOA 3D2UD 4WI2A 1QSZA 5JNYB 3IDGB 5ESVA 1YEDA 3SGDH 4MA7H 2VTFA 4MNGB 4DGVL 2GKIA 3RVVC 3AMLA 1MHCB 2EKSA 3DHMA 1I9RL 5D2NA 2IG2H 4X8JA 5I71B 4OQTA 3IJHA 2X05A 2ZG2A 1X5AA 1KCSL 3KPNA 2HJKA 1WAAF 4RBPH 3NH7H 4LBEB 3C5ZB 5BJTB 1A1MA 1S3KL 1S5IH 3OR7A 3MJ8B 2UZIH 2DTSA 5JORB 4ZYKB 1T83C 3O6ML 1IILE 4R4FL 3BP4B 1Z2KA 2IAMB 4MD4A 4RMQA 4OLZH 2HH0L 1AGFA 3C5ZA 5BJTA 1C5BL 1KT2B 4ZUWA 3HAEB 1CL7H 4CL7A 1BZ7B 4KRPD 4LVNC 4HF5H 4JKPH 4N9GB 1VCAA 2ZZUT 3BSZH 4FQCL 1E27B 5DJZA 4HUNB 1MAMH 1S9YA 1A14H 3FT3A 3AUVA 5AZEL 2VIRA 1I3GL 3K4DA 2IQAA 2WUCL 4HGKC 3JUZA 4IRZH 4JFOB 5DA4A 5JIPA 3TVMD 1DSFL 5FUCE 2X6MA 4U6YB 1FFPA 4JG0H 1GZPB 3S34H 5D70L 5DMIL 1V7NH 2R8SH 4IS6A 5EA0H 5GS0C 4NO0B 4GKSB 3MV7A 4J3SA 4YHYB 3QCTL 2XA8H 1NEUA 2AJ3A 2HG5B 4M6ML 3QFDA 3S4SB 5GSVA 2XPGA 2FO1A 3GMLB 1AR1D 8CGTA 3D0LA 1R24A 2P5WE 2XWTB 1CG9B 4YDKH 1EO8L 4RMVA 5F8QC 2M26A 4QYOA 2AERT 1CBVH 3M17B 4Z77B 5FA4B 1JYNA 3VRLE 4EI5D 5H35A 4KKBD 4X6DF 2C3HA 4JHBA 3AS0A 4JVUA 4OSUH 1ITBB 4OM0H 1RFDH 4ZTOH 1NC4B 1CFBA 5DK2A 5B21A 1ZGLM 1IFHL 4LF3B 3T3ME 2XN9D 2ZKHL 5DD5L 5EB9A 2AVGA 1U0QA 1W0WB 3JXAA 4GRMA 5F9OH 5TFSH 5D2LF 3LPWA 1I9JH 1RZ7H 5H35B 1P5VA 2P49B 3QXUA 1ZLSL 2AJUH 1BIHA 5TQ0L 4L9LB 1ZWIB 4KTYA 5DJAA 5T33L 5E9DE 4BZYA 2BNUB 4NDMA 2Y36L 4FQQB 4C56D 3HNTL 1U8KB 2JCCB 3QDJB 1V7MH 4ZNEA 3O45B 5TJWK 2EDWA 1YNKH 3PXJA 1CFNB 1KCVL 1FNAA 2E7LC 4UUJA 4KV5F 3NZ8B 2PF6A 5F21B 5J3HC 5B3NA 5F6IC 3EJZC 4GO6B 4PREB 4ZS7L 3WEXA 4NO2B 3UTQB 3KPLA 5C0CB 5CD3A 1PVHA 4CN6A 3UTZB 2FHCA 4B7IA 4JVWA 1MCQA 5HXMA 1WC7B 4AG4H 4OLVL 1FGVL 3G5VA 1EMTH 1FYTA 4F7PA 5SWZE 4OZFA 2ENYA 3MRPB 3OJDA 5CIPB 5FIEA 5B39A 5T1MB 3X3FH 2IANE 1P1ZA 2FB4L 4K3DL 4RSVA 3HPJB 1UZ6E 4Y19B 2JKXA 2DKSA 4I3GA 4Q0XH 5I1HH 1UWXH 1F6LL 1MREH 3RX8A 4OGAD 4XCEB 3HZMA 1CF8H 2XTJC 4HKBA 1KIPA 1WTGT 1JPGA 1QSEA 1CLOH 4WUUE 1RIHH 2Z93A 3F8UB 3E8UL 1Q1JL 4CW1A 3BKJH 5FUOL 2P8LB 5B3JE 1JTOA 3BVNA 3M8OH 4K9EH 3UTPD 3G04A 2VLRA 1EHLL 3SE9L 5FAAA 2DBLL 3B3IB 5L2KD 2MSPA 3U7YL 3V5HB 2V2WA 3ARDD 4PJCE 1T3FB 4N8PA 5GJSH 2VJXA 4RNRA 5EO1B 3RGVD 2P5EA 4X98B 2ITDB 4AY0A 2DWEB 4AIXA 5ID0B 3H9YA 2XICA 1IC4L 4JQXA 2GJ6D 2DQJH 3ZSSA 5DJYA 5C92A 2JLLA 2GY5A 3Q5TA 3DV4B 4L8DB 3QRGH 4NFCA 4F80A 4S1SL 5TDNB 2WV3A 4O4YL 2GI7A 3IRPX 4X5WA 5LAXB 4WEBH 1ES0A 3SKJH 1RURL 4YX2H 2OJEB 4MJ4A 4QRPB 5BOPA 4OM1L 1YQ2A 2DTMH 3UO1L 4ZDHA 5HDOA 5F1SA 1P7HL 2VZUA 1EK3A 5D6CB 1T1WB 1VFBB 3CDGB 3FB7B 4HWBA 5EIIA 4OCWH 3O4LD 4N0FB 4P4KA 1DFBL 1HHIB 5DD0L 4BZ1H 2VLLB 5I0DA 3HE7D 3VFWB 1FAIH 2Y7QB 4UU9A 4PJ7A 1DBBH 3TA3B 3MOBH 1B6UA 2PETA 2B20A 1YMHB 2VXVL 2BDNL 3BWAA 1BFVL 4M9OA 4W81A 4XTRD 3P9MA 4TRPH 1HHIA 1U8LA 5IQ7L 2DTML 2FZ3B 3S37L 3R06A 4K7FA 1AO7D 1IGIL 3VH8G 1KLFA 3WO4B 1O7SA 1U3ZA 5GGSY 12E8L 1N26A 5IHUL 4HZLB 4OFDA 4DAGH 4XNXH 3CNKA 2WBJC 4U6VH 1NAMH 2D0FA 2Y06H 2R29H 2BHYA 1CD8A 5KG9A 1T20B 4GBXA 2P5EE 2X09A 3PGCA 1JF1B 3PWLA 3CX2A 4NHUB 5GJSL 1I8KA 1OHQA 3RPIB 1NBZA 1QBMH 4PRPA 1J1OL 4N0RA 4JR9L 3D39D 4TUOA 4MCYA 2W0FB 4OBSA 1Z9OA 3QUZC 15C8L 5AAMA 5ESQA 2NYYD 3G5ZB 4HWUA 5E8EA 4M7JL 2AAVA 4YJZL 5L0QC 3GDBA 5GZOD 3L1OL 3X13B 1KIUA 3N1GC 3RDTD 2ZOLB 1K4DA 3O9WB 1JHKL 2EE2A 4YUEL 4Z7WF 4JZJC 2Y1VA 4POZD 5IVZA 1AO7B 2XTLA 5IB1B 4FABH 4JREC 4BZ1L 3S5LA 4Z7QE 4E42A 4UNVA 2XRAL 5E99L 3MYZA 3UJTH 3IFLL 2DM2A 4XRCB 1NGXA 3KYMB 4DUVA 3FO0H 3ULVF 2EDOA 3MJ7A 4PS4L 2HT3C 2VDRH 2A6DB 2PR4L 3SN6N 5I30H 1U42A 3ZTJH 2MQCA 2NY7H 4LGPB 3PWNB 3V6FB 5HHPB 5GS0D 3AREC 3GO1H 3ECBB 5DMKA 2WAHA 3LKNA 5E2VL 4XBGA 3GHEH 2OS7A 3HE6B 5JHDB 1YYLH 5EZOH 2EDXA 1QBML 4ZTPL 3FRPG 3UZVB 3QHZH 4MXQC 1T4KB 1HWHB 1IAII 2QSTA 4AMKH 1KPVB 2E5EA 3LMJH 4NBYB 3WE6B 2BNQD 4Y5YB 4XGZA 4OLWH 1SBSH 3G9VA 4KRPB 5DQJB 4F57H 5F7YC 5DVLA 3S6CA 1TXKA 2PKDA 4Z7VA 2BSTB 3RKPA 2Z9TA 1VACA 4DZBB 5INCB 3G5YA 4GG8A 4ZFGL 3L3DA 1P7QB 4JY6B 4OB5L 1JGVH 2XXMB 3H42H 1B4RA 5FK9B 3QXVA 4NUGL 4QNPF 4OF8A 4JO4H 1MWAL 3OF6D 4K23H 1DL7H 1RFDL 3T09A 3IF1A 1I7RB 5K9JL 4MA1C 3PQYA 4RWYL 4RQQB 5C0AA 2YD3A 5F1KC 3MTRA 1IEBA 1J5OL 1YA5A 3DUHA 4XPFL 2QL1A 4HV8A 2DOCA 2OBGA 4Y16A 3O8XC 4IMLB 5IQ9A 3DO7A 3ARXA 4Z8FH 4PLKD 1WBXA 4ZUVB 2NMSA 3OX8B 1NC4D 3NGBC 4ERSL 3V8OA 3HA0A 5BV7C 3O6FB 1IGYB 2PTTB 3CSBA 2CIKB 3B9DA 1OAUL 1VFAA 4G9DB 3V6OA 2ZUVA 3BUYA 3VFMB 4Z6AT 3KLHC 1JGEA 3KNBA 1T2JA 4H20H 4ZS7H 3HPLB 5C09B 2OJZL 5GRJH 3QDGD 2E7MA 4P9HL 3OKEB 1K2DA 2DJUA 5FYKE 2BHUA 4RGNC 5KANI 3SKOA 3DMMA 4AEHH 3SDYL 1NCWH 2HFFA 4KVNH 3VG9C 4P9HC 2NZ9C 4MNQB 4R90L 3BZ4A 2A83A 2M8XA 4J3VA 5C0GA 4Y89A 3P11L 5E6ZA 1CD9B 5JOPE 3ZDZE 3RKDC 2DQHL 5SWQB 5CP3A 2Z93B 1FNLA 3WXWL 3CVIL 1UVQA 3C8KB 3AU1A 5AG9A 3D85D 4G80B 3ZDYE 4FS0A 3QEUB 3HZMB 1NCTA 5E2UH 1I3VA 1IARB 2FL5A 5EZIH 4D8PA 3FRUA 3KWWB 3BGMB 4PY7B 1A7NL 3VXSE 3ARDC 2APFA 1B2WL 4LLAA 4CVUA 2LQRA 2RGSA 3D2UB 3MUHL 3F7YA 1N8ZB 1RUAH 4Y1AE 1LEGA 3QA3A 4S0TD 1A3LH 5JMRA 4NSKA 4L8SB 1SM3H 3VG0L 2PYFA 2BNRA 3AS2A 2UWEF 1RHFA 1DEEB 1ACYH 3IDIA 4KJWD 3V7AE 1PKOA 1FV1B 4MD0A 3MRGB 4LPCA 2R1XA 4P5TB 3NFNA 5EA0L 3BKML 3D3VE 2J6EL 5C07A 2YRPA 3D39A 3ARGD 5HI4D 2Q8AL 4KRLB 1DSFH 2C5DC 3BN9D 3MBXL 1R3LB 5E1HB 3HN3A 1KB5L 1FE8H 1OY3B 3BJLA 4I77H 3LD8B 1F00I 3QDGB 3D69A 4Z7UA 4OD1H 4X7EC 5E00A 1G7IA 2FDBP 2VXSH 5A2KH 2DJSA 3F62A 5ANME 3H3PL 2YUZA 3C8HA 2LAAA 3DV6A 5FOJA 4MYWB 1TITA 5CJBA 2E7LA 5CGTA 4PRAA 4OZIE 2XQBL 2BCKA 1U8HA 2XV6B 1KJ2H 4OLYH 4L3EB 2DQHH 3UJJH 2WIMA 4KVNL 4PV8A 3RTQD 4KK5C 1NCWL 3SGDI 3FOMA 3BP6A 5IFJB 2HVKA 5GS3A 1LEIB 1AKJA 1JN6A 4PLNC 3D25B 1ORQB 1T0NA 2IFFH 4M6AA 3CU7A 5T33H 3LKRB 3WHE0 5D7IB 1HKFA 1M05A 4MNQA 4I0KA 3LH2H 5IKCA 4TNVF 4U1KA 3GK8H 2FBJL 1M7DA 1D5XA 1WVZA 4G9FB 5C2UB 5FYLE 2XWTA 1P9MC 4RAVB 3RNQA 3ZDXE 3TM6A 3CSYA 5I1IH 3QFDB 2OZ4A 1VEPA 3JZ7A 4V1DD 2X1OA 1W72H 3QUZA 1NFIB 4QTIL 1BGXL 4UNUA 4FQPA 1JPSH 2DWDB 2NY0D 3S3SA 3CSYB 2X40A 2ZSWB 2AV7B 1CDBA 1T7XA 4TNWK 2FJGB 1MAKA 2YA0A 4X6FB 3HRPA 1IGML 4HMEA 5KSUA 4Z78A 1CTOA 3KXFB 4TVPD 4Q97A 3MLUL 2OXGA 1JMXA 1D9KC 4X6CE 3WFBH 5IM7B 3UCRA 4IRJB 4QXGH 4U49A 3VXTA 3K3QA 4W68A 3T65B 3VXMD 3KPSA 5MEQB 2OK0H 3CH1B 4TVPE 3MRMB 3AMKA 1U3YA 4GW5B 1DL7L 3ILQD 3LEYH 3IF1B 4O2EA 3BE1L 4IRSC 4D9LL 1YNTA 3LKQB 3JTTB 1JFQH 4FA8A 4FQCH 4AH2A 3GGWA 4HAGA 3QEQE 1SJHB 5EU6E 3UDWA 4ZYKA 3VGGA 5I6XB 1QEWB 1EVTC 4XZUB 4MAUH 1IT9L 1A0QH 4OQTL 5FKPB 3B9KA 1JYWA 1UGNA 2P42B 4DFIA 4PRIE 1FPTH 2DYPD 1KXQE 2NY7L 1AY1L 1BAFH 2CXKA 4CMHC 3LQAL 2X44D 1QO3A 3P0YL 5CBAA 3VA2C 4I5BB 2OR9H 3HE6A 4YAQB 5BRZE 3IFLH 2VXUL 1F11A 1Q9LB 2O5XL 4JFYB 4UOW0 3LKNB 4C57C 5HHPA 3CDCA 3HUJA 1NKOA 5I30L 1UWGL 1DQLH 2VZ3A 5JPNA 3CSGA 5I19L 3FO0L 1F3JA 1PZUB 3QNZB 3GSQA 4YK4B 4J3OC 3DI2B 3OB0K 3HUJF 1XIWD 3KPPB 3WDHA 1QNZL 5CZKA 3O3AB 1KPRB 1OP5H 5GSRA 43CAB 5DMGD 4PG9A 1JHTB 4ZXBA 1BPVA 3DSNA 1UH2A 4YH6A 1CL7I 4QOKB 4P2QA 2MKLC 1II4E 4RFNC 3U9UB 5DR5L 5I8EA 1UVQB 3O4OB 3SQOL 2XQYK 3OAUL 1MFEL 3ZMRA 4ONHA 3L95B 4CDGC 3BDYH 3RKDD 4ONOA 1MSPA 4GRWF 3LRSB 3ZL4H 5CJ8A 4FFYH 3W11D 1F13A 2VC2H 4HJGB 3IDMA 4GMTH 2HFFB 2PO6D 5EOTA 4PTTA 4NO3B 5C8JB 4JFEE 4TUOB 5E8NA 5B8CA 4WHYG 1LO2L 3KPRB 4MA3A 3TCLA 4U6VL 5GGTH 3MJ9A 3IDNB 1UKQA 1KG0B 1XF2B 3RNKA 4JEGB 2BVQB 1IAMA 4ZFFA 2YD9A 1QRKA 2Y4SA 3QXTA 1JZ7A 3TP4A 1DQML 2PTTA 5HHOA 4HXAL 4UIMA 3QHTC 1BJ1J 2NPLX 2FEDD 2Q20A 2EC8A 3HNVH 2FGWH 1I1CA 5D5MA 4M7LL 3UPRB 2IANB 1JGLL 5EUKB 1V8HA 4Y16B 4FQIL 2BVQA 5DWUL 2FZ3A 3BH8A 4A6YH 4Y0GA 1WCBB 2VLME 5F6HJ 2CUMA 3HR6A 4U7KA 4LSTH 4JN2A 2XZCL 4XMKH 2VLRD 2VZOA 2GQHA 4TQEL 4HFWB 2B4CH 4GUPB 5DWUH 3LQAC 1NL0H 2Z8VC 4PUBH 1A7PH 4HWBL 2F53D 4PGBA 1LEKB 3QUYA 4YX2L 1PFCA 1J05A 4UI2A 4WEBL 4XP4L 3L9RB 2BNQB 3STLB 3ABZA 5GZND 1G7LA 2B0SL 4Y5YC 1CD0A 4G43A 2K3TA 3LZFL 3U0TA 2HFGL 4PV9A 1JRHH 1DBJL 4P5MA 3UTTD 1J86A 3H9HB 5CJ5A 1T1ZB 1EJ6A 1X5GA 1EBAA 2NX5A 3G08B 1T7WA 1FVDA 3MRR