4OUUB

Anti-mt1-mmp monoclonal antibody
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
217
structure length
210
Chain Sequence
EVKLVESGGGLVKPGGSLKLSCAASGFIFSNYAMSWVRQTPEKRLEWVATISGGGRNIYSLDSVKGRFTFFRDNARNTLYLQMSSLRSEDTAMYFCSRENYGSSFTYWGQGTLVTVSSAKTTPPSVYPLAPSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Inhibition mechanism of membrane metalloprotease by an exosite-swiveling conformational antibody.
pubmed doi rcsb
molecule keywords anti_MT1-MMP Heavy chain
molecule tags Hydrolase
source organism Mus musculus
total genus 43
structure length 210
sequence length 217
chains with identical sequence H
ec nomenclature
pdb deposition date 2014-02-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ouuB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ouuB01
3MLWH 1CGUA 1DJSA 5I2IA 3BYTA 3VGDA 5B38A 1AGBB 4M1GH 1P2CB 5ANME 2VDNL 3H8NA 2RCSH 4H1LB 4LCWE 4OGXH 5DHVA 3MNZB 4GKZA 5AUMB 5IW1B 1IGTB 3PGCB 2EE6A 1PG7H 4X6DF 2IADA 2X4SA 2VDKH 3CD4A 5MP6H 4K71B 4ERSL 4BSJA 3NFNA 2MFNA 3PL6A 2Q7YB 4Z6AT 3CZFA 3RTQC 4LHUB 4XNXH 4KFZC 2R1YB 3E2HB 3KPRD 4FZEL 4ETQA 5D5MA 3RY6A 2WQ8A 4OGXL 2RCSL 2VITB 3CSGA 2R2EA 4YPGB 4UNUA 3QDME 2ZUUA 5B38G 1LEGB 2NYYC 3QHFH 5GS0D 3C8HA 2XZQH 3QHTC 1X3DA 1F97A 2VDKL 3IDGA 3OGCB 3TVMB 5MP6L 1KN2L 5DURB 3V7AE 1EAJA 1WGOA 4YHKH 5LGJB 3QAZB 1F6AA 3Q0HA 4LP5A 1XIWB 5EU5A 1A7QH 4M7KH 4WHYG 3THMH 4LARH 4FMKA 4WO4B 3X11A 1YDPA 4JE4B 3QHFL 2P8MA 4I77H 2G5BA 3P73A 1YN7A 4NDMB 3TBVB 4KQ3H 4YNYB 5MEOB 3C6SB 3SDDB 5J0BA 3V0AC 4YHKL 1WFTA 1ZKAA 2RIKA 3OJDB 2XFXA 1CDCA 1NMBH 1AQDA 3O11A 3LRSA 1A7QL 4M7KL 3THML 2OK0H 4HIIA 5CZVH 1J10A 5L6YH 4I77L 2FSEB 2WINA 3NVQA 1R6VA 3RZCD 5HDOA 5EZJA 5DO2D 1C12A 1KEGH 4KZEL 4JFFA 3VDCA 3OB0K 3OAUH 5FUZL 1NMBL 4HFWB 2O5XH 4WW2F 4TUJB 4EUPA 1Q9KA 4MNGE 4ZAKD 3GUTB 4EI5B 4QHLA 3OF6A 2OZ4A 3F6LA 5CZVL 2VDLL 5A2FA 4FFWC 2X9XA 3BDYL 3SHSA 3F5WA 4TVPE 1V8HA 4O2CA 5HVHB 5C7XH 2DF3A 3FN9A 2AKRA 3LZFL 1CG9B 1YEFH 4EEEA 1I9EA 4F15C 1FGVL 3D5OF 1JZ6A 3BZFB 5GRWA 2VR9A 1EDQA 4HS6B 5I17A 1M05A 1RURL 4R9HA 3GNMH 1TENA 2VJXA 3X13B 3JZ7A 3QEUB 3MLYL 2IAMC 1JGEA 5MHSD 5C7XL 1G7QB 5DJZB 4ZDHA 1CXFA 2GJ6A 5ENWA 4PGJA 1ZVHA 1UADC 4JHZA 1MVUA 5TE4H 1R3LB 1RU9H 3WXVH 3LAFA 3RVVC 4P2RD 4LHJB 3SKNB 1NBYB 2XZZA 3GNML 3H7LA 1A6ZA 1S9YA 2GSGA 4OZGB 4Y4HC 3WFEL 4RMRA 1S7UA 1LE9B 3GIZH 4BH7A 5FYLE 1BJ1J 3PWPD 3PNWA 3D85D 3QI9A 3RUGA 1IM9B 3JTTA 3GM0A 3TH4T 5C08D 3EDJA 1EJ6A 3NA4A 4Q6IA 3W5NA 1RU9L 4PJXB 2JK5B 2B5IB 3UBXB 2E7LA 1DEEB 3V5KB 1P5UA 2CD0A 1MWAA 4KRPB 3IU3B 3LKOA 3MNVA 3BZ4B 1FG2B 5DYOA 1V3JA 5EOCH 1PBYA 1KIRB 3GIZL 2BX5A 3L6FA 3ZE0F 2D4DA 4X6BA 3VFVA 4H26A 3L3IB 1NC2B 4KY1H 3HRPA 1B6UA 3TH3T 3L5XH 1P4IL 3W81A 1XR9B 2NY6D 5EORL 1T1YA 4CVUA 4OGZA 3ARPA 3TIEB 1CFBA 2ZOKA 4FQ2H 4QYOB 2P5EE 4U1GC 2XY2A 5DF0A 2UVFA 1FO0A 3BKMH 4KKLC 1P1ZA 1TETL 3OG4B 5JORB 1JHLH 4BQ8A 1I85A 3FHAA 4KY1L 1ZLVK 3OG6B 1QVOB 3L5XL 4U1JB 3M1BA 2FR4A 3V6ZA 4JZJB 4NC1C 4XNZC 2CKNA 5F1IB 3IETB 3DV4A 4XNUH 4FQ2L 4L4VA 3GEWB 4X6CA 4JM2A 4M7ZB 1S3KH 1HZHL 1OWRM 3QQ9D 4CU8A 1KYOJ 5HHQB 4WU5B 1IVLA 3UX9B 1XCTB 3BQUD 1J0HA 1L7TH 1JHLL 2BVOB 4I0PB 1CGSL 1NKRA 2YD2A 3IDIA 3ZZ1A 2Z4QA 2F58H 1FH5L 2GK0B 1UWEL 3QQNA 1DR9A 4N68A 4JPKH 3RWHB 2JJUA 1MCSA 4NP4H 1C16B 3G5YA 5IMLA 5CJQL 2EDBA 4ZFFB 1EAPA 2XWJA 1T7YA 3DTXB 5T3ZE 4J4PC 1R3IH 1E27A 2P5WE 5ISZA 1ZA3B 3NACH 4GW4A 4PREB 1MHCB 1L7TL 2P4AB 5DT1L 3H9SE 4Y2DB 2F58L 5C09D 4H8WC 5FYKD 5JA8B 5FGBC 3HRZB 3VGAC 2VO5A 4WI2A 2P44B 5FCSH 1VERA 1LP9A 1F8TH 2JJVA 1R3IL 4GLRI 2IANA 4QHMA 1N6VA 3BSZH 3NACL 5CHNA 5IHUL 1F3DH 4RMVA 4JO4H 1JNLL 4M7LH 2PW2A 1ADQA 1YPZA 3KPNA 3DECA 4P9HC 3QUYD 3V8CA 2XV6B 3TO4B 2KBGA 5FDYA 4E9LA 3FB7A 3REVB 4FABH 5KVGH 4MCYA 5GJTH 3UROR 5FK9A 1AIFB 5JW4R 3ZHKA 1ZSDB 1WIPA 3QT2A 3WDJA 5I1AB 3D3VE 4DOHE 5FGRA 3BSZL 3KWWB 1KF9B 3QUZA 4JO4L 3W9DB 2EYSB 5A2JH 2ADIB 5FO8B 3JUYA 4M7LL 3LN5B 1KTDA 3NMEA 1J05B 1WC7B 2NY3B 3GDBA 3MNWA 5TF1H 1F5WA 4CKVX 3PUCA 4ODWB 1JK8A 1CGYA 3MPCA 1EFXA 4ZTPH 4CVXB 3EO9L 1RVFH 5KVGL 1ZK9A 5GJTL 1KTRL 4LNRB 43C9A 2WK2A 1H8OA 1AC6A 2AW2A 4Y88A 4E42B 4MS8C 2HH0H 5JQHC 1GGTA 1A6TA 4WWKC 1PZUB 5KS9F 5TF1L 2HJFA 4N1EA 3RWDA 2Z8RA 1FNGA 1RQ5A 1DQTA 1RVFL 4XRCB 3LS5L 1Q0YH 3N1GC 5C0EB 5JMRA 1AXSB 1LEIA 1MCWM 5IVXA 3WBDA 2HH0L 1BD2B 1BJMA 1WZLA 3TNMA 1NUDA 5JNYA 2ED8A 4XP6H 5DDHA 3W11C 4XNYH 2K7QA 1DDHA 3M8OH 3CSYB 1GH7A 4F33B 4MZ2A 1EZVY 1QSFA 2YUZA 4JFFD 1M7IA 3BP7B 5ID0B 4R7NA 5GS1C 2M26A 1U8QA 4Z77B 1GC1H 2P24A 3O9WD 1OLLA 3FONA 4IS6A 1Q0YL 1TJHL 4RA3A 5E8NB 3OF6D 5HGDB 4YBHA 4MD4B 1C5CH 1IAKA 1A9EA 1N0LA 2AQ1A 1T21A 4XP6L 5JOPD 1P4BH 1RJLA 2ADFL 2EEDA 4L3EB 4XNYL 3M8OL 4O4YH 3RPIB 5IQ7H 5KSAC 4KVNH 3FZUD 2LVCA 2Y1VA 4N0UB 5HHOE 3OQ3B 3I9GH 3QPXH 1GC1L 3MV9A 3RNKB 3GSOB 4HBQA 5I76A 1IGJB 4JR9L 4G8IB 1KIPB 1C5CL 1UJ3B 3GB7B 5HPMB 1G7LA 2VRAA 1L0XA 1HHHB 1P4BL 1TVBB 4U6YB 3I6GA 5IQ7L 3FRUA 4KVNL 4WTZA 3Q6FA 2WWMD 4MNQD 2GJ6D 1MJ8L 4ODXB 5F7DB 5LG1A 2QQLH 3O8XA 5JW4M 3QPXL 4JKMA 3HCVB 4UUJB 2L0DA 5GGUA 43CAA 1BX2B 2JE8A 1ZLWK 2D7TL 3MRJB 3CFCH 4ZPVB 5ICXA 4P49A 4X7SH 4JKWA 1BIIA 4LKCA 2OTWB 4QXUH 3QI9D 2UWEB 4N1HB 4HBCH 5T3XE 2YPLA 3ARFB 4LCCA 3D39D 3IDMB 3DX6B 3KDMA 3SBWA 3T4AB 5I1CL 3CFEB 2BSSB 5KSBA 4LBEB 1NCNA 2YS4A 5C3LD 4P2QE 3X14B 1FVCA 4OCSL 5J3HC 3NZ8A 4LVNC 4X7SL 1X4YA 1XGTB 2Z92A 4ZUWA 5TDPB 5LJYH 4QXUL 3N0PB 3C6LC 2BHZA 4JB9L 4PRBB 4QRQA 5LXGH 4PRIA 5DRNA 1CFNB 3VXUA 4LIQH 5HVFB 4OV5B 2BC4A 3LSOB 3HI6L 4PJ8C 2XQYK 1LO3H 3D0VA 2A83B 3VRJB 1ONQB 5SWSA 4Y1AA 5D96C 1F4YL 2JCCA 1QBAA 1X5ZA 2PTTB 2XA8H 1RZ7L 3BP6A 4XCEB 2NX5B 3QXWA 4C56E 5CJBA 1F3DJ 5LXGL 4HUVA 5IW6B 1A7NH 4ODBD 2ZCHH 5FF6A 3STLB 3WO4C 2NXYB 5IMOA 3WEXB 1FNSH 1LO3L 4MA7L 4P2YA 2FX7L 4L4VD 5I73B 1AGEB 3HG1A 2AJUL 2X4QA 3C60B 3FQUB 4JM2D 5IHZB 4QRPE 2FL5B 2XA8L 2C5DC 4JRYD 1XH3A 1WK0A 3ARYA 3MUGB 4H20L 5SWZE 4WFED 5C3TA 4G8GB 3DUSB 1REIA 1KUMA 1A7NL 2ZCHL 5ANMA 1MCOH 3EGSB 4LCWA 5CD3A 4YHYB 2Y06H 3MOAH 1FNSL 4ZO6A 1IGML 2NY0D 4U3CA 3O3UN 4PRNA 4MJ4A 2RFXB 3AB0C 4WEBH 2NW3B 1MRDL 5ISZD 4GQPH 4Y19B 4KROC 5I9QB 4KHTL 1C5DB 4DKFL 5DUBA 3SDXB 3T0EB 2D03H 1AHWB 4JPVH 2Y06L 3MOAL 4MAYC 4ZYKA 4GS7C 3AMLA 3QDMA 4NOFA 5CSZA 2IFFH 5CEXB 5JHLH 2HMID 2FB4H 1IGFL 2VQ1B 3BMWA 4WEBL 2X4UB 4H8WH 4BQBA 2A9MH 3D69B 1IBGL 1NGYA 1S9WB 4MNHB 4CADB 5GGTL 5F88B 4LEXH 2PTUA 2YEZB 1P84K 1RJYA 3MLRH 4E41E 4HZAA 3QPQC 2D03L 4JPVL 4TSCH 5IB3A 3AU1A 1ZGLP 2IFFL 4P57B 2BNQD 5JHLL 1MCQA 4JY5H 3RWGB 4FQPA 1SJEA 2EE2A 4K8RD 1UZ6E 5KZCD 2D31A 2A77L 3MOQA 2FB4L 3FOLB 1ZLVH 1FVEA 1QFWL 4EN3B 5CEZE 2H32B 2RQ8A 5DVKA 3QUZD 3V7AG 4LEXL 2EYTA 3K1KC 3WIHA 5BQ7B 2VTFA 2JF1A 3HNSH 3TT3H 1KCUH 5D9SA 2GTZB 3RI5K 1DQDH 5D7JD 5MI0C 1UACL 1OF2B 3TV3H 1CD1A 1OWWA 4I0KA 5DEFB 2HFEA 1C08A 2AP2A 3IS1X 2IH3A 1WIOA 2BK8A 5DMIH 3BHBB 3EJYD 3PP4H 4P9MH 3J7HA 1B0RB 1PG7W 2GITA 5JW4N 4RFOL 4DAGH 4QXTB 4G6FD 3NOIA 2N1KA 4MNGA 3VWKB 3L5JA 3QWRA 4M61A 2KZWA 3QEQA 5DJ2B 2AK1L 1KCUL 5IKCA 4F7EB 1QRNE 5IOPB 4D3CH 4P3DB 1DQDL 2X7LA 2GSIB 4PJGF 2R1WB 5E8OA 2HVKA 4JN1L 3TESA 5GGRA 2MCPH 5DMIL 5LCVL 1MF2H 3PP4L 4RMQA 5FOBB 5EBWA 2MKLC 3BGAA 3QUMH 1SM3L 3WDIA 3GJFA 5FAAA 1G9ML 5DFTA 1AGDB 2OX5A 1OTUD 1SY6H 1QSFD 2AEWA 3JSSA 2A73B 4D3CL 4WFGE 1R0AH 4NRZB 2VABB 4GKNA 4OM1H 3HS0A 5JW5A 3V95A 1MF2L 1U8OB 1KCKA 5GS2H 3INUH 3ZSTA 3OKEB 5IB4A 3QUML 4LL9A 1FDLL 4HJ0D 2GUOB 2RBLA 1JMZA 2XTJB 3HE6B 3HR5A 3RL2B 5HVWA 3P9LA 2P7TB 5F6HI 2FWOB 4LRNH 2VXUH 4KPHH 4LPCA 5C0NC 2EH7L 3MV9D 5HDBF 5E8EB 1TDQA 3KJ4B 5DJ6A 2EO9A 3V6FA 4OM1L 2GCYA 4NC2B 1KPVB 3LEXA 4OF3A 2HTLD 3QDHA 1K6QL 1B90A 4YLQT 4BSWA 2OJZH 4LNVA 1HHGB 4MWFB 1DE4A 1DP0A 4LRNL 2VXUL 4QHKJ 3MTRA 3O8XD 3PWVB 2ZG1A 3I75B 3E0GA 4RGNE 3T77A 1TJGL 5E99H 3IFNL 1E4XI 4X7DC 4MXWL 4N0YH 5JA9A 4NO2B 5J6GB 4JJ5A 1GPOH 1DQMH 2AJSH 1TJIH 2YKLH 2EDJA 1I9JH 5F72S 3MLSH 2OJZL 4BKLA 1E4WH 2RHEA 5C0IB 3O6FC 1Z5LA 4JDZA 4L3CA 4WNQA 1T4KA 3X17A 4IJ3C 4OSUH 2P5EA 2YPLD 4D9RD 3MO1B 4O2FA 4Y4FB 5FA4A 4OZIF 3SY0B 4HKXB 1VADB 5E99L 5F89B 1EO8H 1CIDA 4R0LC 2NY5C 5CFHA 2AJSL 1KCSH 1TJIL 4NKDB 2YKLL 4JFHD 1YY8A 1U8NA 1I9JL 4OLYH 4HLJA 1XT5A 3MLSL 3KHOA 4KK6C 2EC9T 3T0VA 1ACYH 3QA3B 2R8SH 2EDOA 3QNXB 5J6HA 2AV7B 4OSUL 2I26N 4PRID 1NFKA 4LF3A 4F9LA 2ZUXA 4PJEE 3NIGE 3ZHLA 2VLKE 2X05A 3GMRA 2AV1B 3KYKH 2KZ1B 2X4PB 1HQ4B 1KCSL 4IOFC 1IC5L 2P46B 3CVHB 4IBLT 4IMKC 4Y1AD 1IEAA 4OLYL 3R8QA 3FO2A 3CDFA 4UOW1 4MLSA 1ACYL 4NZTH 1C8PA 1A02N 3LKNA 5MERA 1EMTL 4BFIB 2P5WA 2I24N 4OI8A 2JB5H 4TOYL 3QEHA 4MYWB 1FYTE 1N4XH 5E08H 3L3DA 5EG6C 4CRPA 3MR9B 4KGLA 3HG1D 1KENH 4O2EA 4L9LA 1ZHKA 2V5MA 5HI3C 4JRXB 4G6KH 4AY0A 4BZ1H 1KB5L 1JPSL 4NZTL 1IT9L 1ZLWH 1V7NH 1N64H 4P3WA 5T1KB 3SKUD 4LPXA 4MDJA 4AEFA 3ARXA 4LCWD 5JR1H 2JB5L 2BJMH 1N4XL 2IPKA 1DQJA 4GMSH 1U58A 1UM6H 4N8VA 3LKQA 3H3PH 1M6OB 1JPFA 1MFBH 3BGFB 2DKUA 5EIQA 3TA3C 4Z7WB 4TULL 1NGZA 1U0QA 2BRQA 4G6KL 4BZ1L 5IR1A 4JO1H 3T04D 1ERNA 2VZOA 1V7NL 4KKBD 4ENED 4UINH 3D3VA 5E1AB 5EOTB 1MHEA 2NXZC 2Q7NA 3FO9A 4Q9CA 1PKOA 4GMSL 5CCKH 3RWFB 1JVKA 4NQEE 3OKOA 4PJCB 5KG9B 1UM6L 4PGDA 3H3PL 2C3GA 1A1MA 4JFOB 4QHNB 1A6VL 1MFBL 3AAZB 5FO9B 5KSUB 4LGRB 4U1SB 4AH2A 3G08B 2CLRB 2QSVA 4WHYH 5D1QC 3ULUE 5D7LE 4K23L 3SE4C 4ODVH 2HT2D 4I2XB 1ORQB 1EHLH 3MRHB 3VRLE 2OM5A 2EXWD 4UINL 4NO3B 5DVLA 3ARUA 1GL4B 1MFEH 3S88L 1J0ZA 1N5AB 5CCKL 1DFBL 4KJPC 4GLRH 1W0VA 3HNTH 1U93B 2HLFD 3GSVB 1BGXL 1J0KA 4P5MB 3CX5J 1F2QA 4HK0B 5KANI 1UB5A 1BBJB 1D9KA 1EHLL 3QCVH 4XCCH 2YPKB 4EDXA 1ZHBA 3K2MC 1OTSC 2O5ZL 3BN9D 4L8DB 1TZHA 1UH4A 3HNTL 2L7JA 3NPSC 5KN5A 2H6PA 4L3AA 3CIQA 1IFHH 4ODUA 4DKAA 1FP5A 1F6FB 1NCAH 3DWTA 2DL2A 3QCVL 4XCCL 5ID1B 1J1OL 1HDMB 2J88H 3NA9H 3U4EA 5IFJB 4KQ4H 3FT3A 5CGYC 4PLOB 4N0CD 2D2OA 4TVPD 1K85A 1BQUA 5FGCB 12E8H 4M8VA 4PYHA 1IFHL 4XMPH 5HHOA 3MYJA 3QNZA 1TZGH 4HKBA 2F53B 2BVPB 1JWMA 2D0HA 1I1CA 5FA3A 1X7QB 2FCBA 4EUPH 4U0QB 2VXTH 1DBJH 2R2BB 4KKNA 2H2PC 3NA9L 2XG4A 4KQ4L 4G7VH 1UQSA 6CGTA 3GMQB 1K9TA 3VXME 4YBQC 1J0JA 3SCMA 2HT3C 3QJHB 12E8L 1BZ9A 2EC9U 1BAFL 4XMPL 1W72B 2AXGB 1H3XA 2QHLA 1AO7B 4HKJB 5DMKB 3CMOH 5EU3A 3F62A 1FZMA 1TZGL 3V52L 3WIFB 4LVOB 4OD3H 3OSKA 4GBXA 2VXTL 4LLUA 2OZ4L 2VLME 5HDQL 2VWEC 3RL1B 4RMUA 5FGSA 5ALBH 4G9DB 1QUNA 4R4ND 1DN0A 3LMJL 5E8PA 4IRZH 5DEZA 3S97C 5FYLD 4HS8H 3CMOL 4UU9B 4WEUD 2HT4D 3B5TA 3MLVH 3O45B 3EOBB 5LQBH 2BMKA 3MXWH 3UJIH 5FKPA 4HCRA 4QRSA 4KKAD 2QTEA 5H35B 3KYMB 3GGWA 1M71A 1FZKB 4P2QA 4MVBD 3SBWC 1JRHI 5ALBL 4LLQA 1DEDA 4L5FL 4TSAH 4MX7B 2KQMA 4HS8L 4PUBH 4DVBB 1DLFL 4R26L 5EU4A 2PO6B 4Y5XB 3QZWB 2R23A 1GSMA 5LQBL 1RUPH 1UXWB 1HH6B 3MXWL 5BXFB 5IHLB 1YEDA 3UJIL 4U1MA 5DVMA 4PJ9B 4G9FB 1BEYH 1G0YR 5GZNC 4X6CF 4JM2F 4WDIA 3IKCA 3IGAA 2Y9RT 4LCUB 1MWAH 2P5ED 1J18A 4TSAL 5F9WB 3O3EA 2WBWB 2NY1B 5JOFA 4PGCA 4PUBL 2XKNA 3QIBC 4C56A 2ZKHH 2DQGH 1IAOB 1CE1H 1GCFA 1FYHB 2AQ2A 1RUPL 3GMOA 2FIKB 3S5LA 4FQIH 4QO1A 2NY5H 4Y7MA 1MWAL 3CGTA 5I8EB 4QRPA 1DQQB 3ZDXE 1BOYA 1FO0H 2BVUA 5ICZA 4QXWA 3H9YA 1IAIH 1UH2A 5SWZA 3CC5B 2V9QA 2ZKHL 2DQGL 3CK0H 3LD8C 5ESAA 1OAKL 4K7PY 1CE1L 4NRYA 1ZLSH 2XY1A 4J3WA 3TM6A 3HLAB 1CZ8L 4FQXB 4E5XB 1LP9F 5DGRA 3QDGD 1FE8H 1TZIA 5EN2B 3S5LG 3VFUA 4JM4L 2BDNH 3VCLB 5T3ZD 1XF3B 5DC4B 4YHPA 2PUQT 1FO0L 3MFGB 1BLNB 3ECBA 5J11B 1IAIL 1YPZF 5J9PA 7FABL 2J7LA 4PTUB 1ZHLA 3CK0L 3QIWA 5JXAL 3F8UB 3H9SD 1ZLSL 1YEIH 5HHPA 4PP2A 5BZWA 4C4KO 3BGMB 4DEPB 5GGQH 4UBDD 4ESKA 1FE8L 4GXUN 5HTSA 3O2DA 3FT4B 3RNQB 3C2AH 4R7DB 2VAJA 5D93C 2E8ZA 3DURA 4KJWD 3BMVA 3HC3L 3UEZA 1RZJC 4DN3H 1GZPB 3PHOA 3LDBC 3I85A 1YEIL 5E2TH 4E41A 1DQLH 2QKIB 5GGQL 1FFNA 1U3ZA 2LV4A 3EW3B 4LFHG 5C0FB 3T0WA 1AGCB 1KCVH 3C2AL 1NFIB 2V6HA 4O5LL 2VZ1A 3ARGA 3S3PA 3D3VD 4Q2ZA 5L8KB 2O61B 5FECA 3LKPB 4JREC 4L29A 3QFDB 3BIKA 4KK5D 2Y5TA 1IEBA 4QRRB 2X4RB 1DVFC 5E2TL 4B7LA 4BA8A 3DETC 2XPGB 3VWJB 4OZGE 3PWLB 1A2YA 5EULV 4M02A 4QRTB 4JRWA 1KCVL 1XGQA 2JJTC 5IVXF 2NY4C 5DK0A 3IXTB 3E6FA 1MCDA 5I1DA 1MCHA 1A1NA 2HFTA 3ALWA 3L5IA 4PJXE 5DK2B 3U48A 3VW3H 2ZG3A 1ADQL 4WV1B 3BP4A 4ZO7A 3TNNA 1R3KB 5EO0B 1XMWA 5FOJA 3MUZ1 25C8L 4B5EA 3KLHD 1P84J 1QRNA 1D5BA 3FB8B 3JV6A 1D9KD 4FXGB 4GSDH 4GFTB 4K8RL 4L4TB 1JNJA 4M93B 4FXKB 4G6JH 3QUYB 2Z8VC 5C0AD 2F54B 5EO1A 3I6KB 2YZ1A 3VW3L 2P42B 5DHYA 5HJ3A 2WWKO 1FCGA 2C4XA 4JFYA 4NNPL 4PV8B 5FB8B 1XF5B 4L8CB 3SE8H 3HE7B 2MQ3A 3IKKA 2VISB 4XNQA 2R56H 1T7XA 4U6HA 4GSDL 4HEPG 2FX9L 1CFTB 2MMXA 4CW1B 4U1IA 5FIEA 1E28B 1R3HA 2FD6L 1HINH 2BHYA 3MRLB 3PV6B 3B3IB 2ICWI 1QG3A 4JPIA 3O4OB 2Q6WB 1IGIH 4PRPB 1OP9A 1T0MA 2Z91B 3BT2H 3WJLA 1SYSA 2YD6A 4I3GA 3ZL4H 2PR4H 4L8BA 2R56L 4OF6A 5L9DH 4FFVD 5JPMB 1ZT1B 5J1SC 4U31A 5LVEA 2E9WA 2PXYC 5JIIA 2NNAB 4PG2C 3ROOA 1RJZB 1HINL 5JOEA 5GZOD 3C5ZB 3P77A 1MEXH 1JP5A 1SBSL 3KYOB 4OCYH 1EHXA 2A6IB 5F96H 3SCMD 1JHTB 4IOIA 1T1ZB 2CIKB 3DMMC 5ITFB 3WUWA 3BT2L 2QJDA 1KPUB 2JIXA 3ZL4L 2N56A 2PR4L 3AVEA 1LNUB 5L9DL 1HI6B 4LKXA 5KSBF 2NCMA 5IQ9B 4Q9RL 4GBXD 1X9QA 1XGPB 3B8YA 4HIHA 1MEXL 3HKFA 3STZA 4OCYL 5DA4A 2DM2A 4HXBL 3QIUB 1WT5A 3O9WB 5E94A 5F96L 4L1HA 4MA1C 5KOMC 3RVUD 3ARBC 1T1WB 2VL5B 3D0LB 3VXSB 1OHQA 3S7GA 3GKWH 3HNVH 3VXTB 5BO1H 5I66A 1GAFH 3JV0A 3V8OA 1U36A 4EI6A 1U8KA 5D2NB 5T3XD 5K9QG 3I2CH 4ISVB 1Z3GH 1ZHNB 3WUWG 3W9EA 5IBUG 1MRFH 3T0BA 2I9LB 4AZ8A 3S34H 1RUML 4P2QD 4GRWF 3KS0H 5SX5H 1A3QA 4KTDH 1T0PB 4HG4K 1VEPA 3GKWL 3HNVL 1GAFL 3OX8B 4NZRL 5ABDE 2ZZUT 2EIBA 1G7HA 4JDTH 1Z3GL 4JFPA 5C0GA 2VLKA 3KYNA 3SKOA 1AE6H 2M1KA 1DLHB 3FJTA 3R1GH 3S34L 2CLVB 2ESVD 3TC9A 1BFSA 1LO5A 2GFBA 4MJ5B 1E4XH 1T6WA 2OI9C 1S7QB 1J8KA 4KTDL 3HN3A 1X5GA 3L9RA 3A6OA 2DIBA 1FHGA 1G7JB 2IG2H 3RWEB 4F9PA 1CFSB 4HUUA 3W0WD 4I18A 2A6DB 3KPPA 4R4BB 4X99A 3FN0H 2WNGA 4X9IA 2DMBA 5CBEB 2M2DA 1FYTA 1FIEA 1U92A 5DRWA 4P5TA 5A3IC 2P49B 1E4XL 4CDGC 4KVCH 3U6RA 1BD2E 3U36A 2PYFB 3K4DA 1KJ2B 2EYRB 1WCBA 1T89A 3DX9B 5FEBA 2H9GA 2N7BA 3FN0L 5E5MA 1X6NA 2X40A 3IDJA 3M17B 5EZLB 1S7SB 4LSTH 4Z0XB 1KJMA 4OZ4A 4R97B 3V7MA 2W65B 15C8L 8CGTA 3MRFA 3SGEI 4KVCL 5JIKA 3AGVA 3FQTB 2Z93A 4YJZL 3VU2A 1XAUA 2VKXA 2P8PA 2ORBH 2UYLA 1MUJB 3QIWD 4XH2B 4NWTH 2CXKA 2CLZB 2V2WB 4LFHD 1EX0A 3ARED 1S9XA 4L3EE 3VA6A 4OLEA 5H2BB 4U2ZA 3ULSA 3KG5A 5I71C 1FL5A 3MRRB 4KDTA 1DUZA 5K9OB 4NQEA 1Q38A 4N0UE 4HDIA 4N8CL 5TQ2L 4TPRH 2JJSA 1R5IB 3QRFM 3VJ6A 4QF1B 3V2AR 1T22B 2ORBL 1Q8MA 4HK3N 4KU1A 3FFDB 5B3NA 2PF6A 5ADOH 1FV1A 4E41D 3RGVB 4JGUA 5ETUB 4OCXL 1IQDA 3DRQB 4JRYB 4NJ9L 3IS0X 1U3YA 1B0GA 1RZJH 5D2LB 4TPRL 4Y2OA 4NNXB 2YK1L 3ARGD 1KJ3H 5CKGA 3CFDA 1QLFB 3ES6A 5CEZD 2R69H 3EFFB 1KLUB 3BUYB 5DD1H 4X8JB 2D3VA 2FECI 3VMOA 1SVCP 4RFEB 1KIQA 3G04B 5DS8A 1S9KC 1S7WB 1TQBC 5F8RC 2UWEE 5AYUH 1A3RL 2MJWA 2OJEA 3SGJA 3I3EA 3D2UB 1KJ3L 5IG7B 2ZSVB 1PFCA 1NANI 4WUUB 2R69L 5DD1L 2B2XH 5DC9B 3NIFF 3WIHH 3MBEA 3MCKB 1F58H 1DZBA 4K3EH 5B21A 5CJOL 3N06B 4XT1C 4PG9B 5DEGA 4XPBH 1KFAH 3IF1B 1KXVC 1QRND 2X9YA 5AYUL 1YUHB 2FO4B 1CICB 4NGHH 3U46B 3VD7A 1V5JA 4UTAH 4IRJA 2IF7A 1DUYB 1UKTA 5HGBA 2ADJA 4X9HA 2H1PH 3HI5H 3P3YA 5DJ0B 3T0DA 1S5HB 2BNQB 4IIQC 1WISA 1HEZB 3WIHL 2C7UB 1KXTB 4NRXA 5KZCB 3CUPA 2VLRB 1TPXB 4LSDA 2NX5E 1KFAL 1FBIH 5GIRB 3T08A 4NGHL 2FGWH 4TVPH 4WFGD 3VXMA 1MCPH 1A1OB 1CT8A 3I3DA 1BOGB 4UTAL 5TDNB 3WLWC 2BNRB 5IM7B 5ACZB 5GSRB 1KIUA 1FNLA 1CCZA 2H1PL 3U0PB 4G43B 5HI4C 3GJFH 1CYGA 4WU7B 4XC3H 5D7JB 4ZUTB 3WL9A 3HC4H 4RA0C 3KS0J 2Q86B 4DCQA 3IFOB 3BXNB 2W38A 5BV7H 1GHFH 4ZODA 4Q58C 4X9BA 3EOYG 3RVWC 3WE6B 1FBIL 4G8GE 3ZYZA 4TVPL 2FGWL 5KJRH 1YJDC 2Z0BA 3D48R 5HGAB 1MCPL 1AGBA 1P2CA 4G6FB 1VGEL 5L88H 4PS4H 4H1LA 1CDGA 3MNZA 5AUMA 5IW1A 1IGTA 3PGCA 1JMXA 4GUPA 4LLYB 1HSBB 3CSBA 4XC3L 3ULVC 3UTSD 1TVDA 2WUBH 5DJCB 2Q7YA 5BV7L 3QDJD 1GHFL 2IBGA 4Y19E 2JIXD 4M48H 4LSVH 4LHUA 2R1YA 4Q9BA 2PKDA 4RGND 1PGRB 5L88L 4OCWH 3SDXE 1NC4B 3T0EE 3PWNB 1R24B 2VITA 4YPGA 5D1XC 1LEGA 3BJ91 4H1LG 1CI5A 4N90E 1IEHA 3OGCA 2WUBL 1CU4L 5BS0B 3ZE0E 3TVMA 3T3ME 3HUJB 4HV8B 2OCFD 3CMGA 5LGJA 1CLZH 3O4LB 2AK4B 3BISA 4LSSH 4M48L 3IDYC 5JIHA 3E6HB 3BD4A 1ND0B 5GISH 1KJVB 1XIWA 1B2WH 4GT7A 2NLJB 4S0TD 3CFKB 1CD8A 4AL8H 1E4KA 4OCWL 1WBZB 1G0XA 4WO4A 4ZUSB 3DOSA 4NN7C 3SDCC 1JZ8A 2H3NB 3O6MH 4WIQA 4KHXH 4NDMA 3TBVA 1LWRA 3ME0A 4YNYA 5MEOA 3C6SA 3SDDA 3TYFB 4RZCB 1CLZL 4JLRA 3OJDA 4LSSL 4ZPTB 1EERB 1ZTXH 5GISL 2MKWA 1B2WL 4PJAB 1OP5K 1I1FB 5DQJB 3OJVC 1IGCH 1MCJA 1KTLB 3ZKXB 4YHIB 2FSEA 4JDVB 1A7RH 1QBMH 3FQRB 3IJHB 1ZTXL 5DWUH 4HFWA 2HVJA 1B0WA 1IM3B 4FFZH 4JZOB 4TUJA 2UVEA 2OR8A 3GUTA 4EI5A 1IGCL 4F37K 1FYTD 4FQJH 1UFUA 1F4XH 3LEVH 4RAUB 4P5TD 3U82B 3ETBF 4Z7VB 1G9NL 1IE5A 4MJIA 1A7RL 4G6MH 5AEAA 1CG9A 1QBML 1K3ZA 1D5IL 4LSPL 3BZFA 3Q2CA 5DWUL 5T3ZH 3LHPL 4HS6A 4KK9C 1Y0LB 1OOAA 4FQJL 4YUEH 1EJOH 5KSVB 4NZDA 3X13A 3QEUA 4FQQB 1G7QA 5DJZA 5JXEC 3RVXC 1K4DB 5T3ZL 3ABZA 4CAGA 1F13A 1AR1C 1R3LA 1ZT7B 4FA8A 3WXWH 2Z31B 3GSNH 2XTJE 3SKNA 4CMHB 4YUEL 1NBYA 4X80H 1EJOL 3VE0B 1OAXH 1J12A 3AUVA 4UDTB 4OZGA 3DRTB 4ZUUB 1DL7H 4XHQA 4TSBH 4GXVH 1LE9A 3ULUD 4S1DD 5D7LD 1IM9A 1YN6B 4NBYB 2IFGA 2ZCLL 3DI2B 5DJ8B 1AD9B 1C5BH 3DGCR 3DI3B 3I50H 4PJXA 3WXWL 2JK5A 4P46D 4PLJC 3UBXA 4X80L 5D6CB 4I4WB 4CGTA 2EDLA 1DEEA 1TNMA 3V5KA 5L0QC 5F93C 4I13B 1OTSD 2XRAH 4BK5A 4DZ8B 4CDHA 1OAXL 3T3PF 5IB2B 3IU3A 1UCBH 1VCAA 1X5AA 2UV3A 3BZ4A 2Q8AH 1DL7L 3FMGH 3T65B 4TSBL 4D0DB 1KIRA 4GXVL 3RTQB 4C58B 2V2XB 1H0DB 3S98A 2VN4A 3L3IA 4YX2H 1NC2A 4ZFOB 4AQ1B 1C5BL 1BZQK 2J5LC 5IMMB 3I50L 4PV9A 2X10A 1XR9A 1OM3H 4GAFB 4NO5A 4OIAA 4RWYL 3TIEA 4HX1A 4M1CD 4WFHE 1RUAL 4QYOA 4YXKH 3VRIB 1UCBL 3UBXG 3FMGL 2J4WH 1JCKA 2ZUTA 3Q1SH 1MLCB 5JORA 2SEBA 2VC2L 5BVPH 2Y36H 5KVEH 4NJAL 4AJ0A 5DZNA 3MBED 1QVOA 3ESVF 4U1JA 2OTUB 4XVSL 3VG0H 3Q5TA 4G5ZL 4JZJA 1OM3L 2DM4A 2CDGB 3R06B 5F1IA 3IETA 4EQ3A 4O02H 3HMXA 2MQ0A 2J4WL 5HHQA 4WU5A 3MOBH 1JZ4A 1XCTA 3WJJA 2P43B 2Y72A 1YA5A 2BVOA 5KVEL 4I0PA 2GK0A 4GQ9H 1V3KA 1EXUB 3B83A 3VG0L 2HG5B 4DQOH 3RWHA 2DI7A 1C16A 3QUXC 4O02L 5I8OL 3U0TB 4PJDB 3DTXA 2KDGA 3B9EA 4WI6A 5IEKB 1ZA3A 4F7TB 1MREH 2D7MA 4PREA 1MHCA 2X6MA 5IFHH 5A1AA 4PRDB 4Y2DA 3L3GB 1NBQA 3HRZA 4DQOL 4F7MB 2Y6SC 2VLMD 4JRXE 3CPLB 1PEWA 3ZDZE 3BRGC 2DQUH 4RX4A 1U8PB 2XTLA 1OGTB 2ED7A 2OMNA 1FCCA 3BPCA 3D9AH 2PYEB 5IFHL 4ONHB 2OXGA 4KJYB 4D0BB 4J8RB 1YJDH 5BZDB 3TO4A 4Z7WE 4QHUB 1FNAA 3REVA 2YR3A 2IAMB 5EZIL 3FT2B 1AIFA 1HHIB 1ZSDA 5I1AA 2DIJA 2VLLB 5AZ2H 3ULVH 4WHTA 4OF5A 3D9AL 3KWWA 4GG6B 4X6FB 2DBJA 2EYSA 4JKPH 2ADIA 5FO8A 3LN5A 2IH1B 5D8JL 1J05A 4PJCE 5J8OA 1WC7A 1YJDL 2NY7H 1I8KB 1JUFB 4LRIA 2QQQA 4ODWA 3TVMD 5DURD 2BOBB 5FUOL 4CVXA 4YFDB 4RMSA 4Y4HB 3O3AA 3LOWA 1NCCH 4A6YH 1XIWD 4I2XE 4ZOEA 5AZ2L 1H3WM 2N4IA 4LMQE 4E42A 4C54A 5DMJB 4C55A 5HVGB 4WO4D 4WW1B 4JKPL 5T3XL 1J9CT 3P0VH 1G7PB 5IFAH 3VI4E 1QNZH 3SDDD 2A9NH 4I3RH 4I18C 4IRSA 3IU4L 4XRCA 4L4JA 5K9JH 5C0EA 3H7BB 1JE6A 1AXSA 1T83C 1CLOL 4XCNB 5CJXA 1BD2A 4WCYH 5ERWA 4ELMB 1GRWA 1MHHB 1YNTB 3P0VL 5IFAL 1NJ9B 3CSYA 5C2UB 4F33A 1QNZL 2G9HB 4I3RL 3X3FH 5ID0A 2AABL 3BP7A 5DC0A 1T89C 4U1GB 3A0OA 3VXOA 4Z77A 2G5RA 3GZKA 3EDDA 3B9AA 1T7ZA 1PKQB 1AD0B 1J1PL 1BQHB 5T33H 3S96B 5E8NA 1BIHA 5HGDA 4X6DA 4MD4A 2AJXL 4WCYL 4HKZA 3SQOH 2B4CC 3UTPE 4L3EA 4XNZB 5FGCE 1CTOA 4Z76B 3RPIA 4XCYB 4BFGA 4I5BB 1FNEB 1UZ6F 1SBBA 4N0UA 2DRUA 2F53E 3RNKA 3GSOA 3P0YL 5TDOB 1IGJA 2DQDH 3PWUB 4BH8B 4G8IA 1KIPA 5ICYA 4GJTB 1CS6A 3GB7A 5HPMA 4N8PA 4X7CC 2XWBB 1HHHA 1TVBA 4U6YA 5J89A 2R0KL 1ES0B 3D25B 1G6RB 2WSKA 1H5BC 1JHKL 3BVNB 4DKDC 4PFEA 1AO7E 3OXRB 4ODXA 5F7DA 1LK3H 2Y4SA 3VD9A 2NPLX 3UPAA 3HCVA 4UUJA 2E3VA 5C07B 1BX2A 1HXYB 2DQDL 4AEIH 4YK4C 1S7XB 2EECA 1P7QA 2XNAB 2NY4D 3MRJA 2DTML 4MLIA 3QG6B 4ODHL 3Q3GB 3QDGB 4ZPVA 3TPKA 3WNNA 3SGEH 4ZO9A 1OP5H 1QKZH 2HYMA 2UWEA 1LK3L 4HJJH 1IM9D 3O2DL 4NCC1 1X5JA 4NYLB 4HT1H 5CZKA 3ARFA 3H9SB 2YA0A 3IDMA 3EDKA 3DX6A 3T4AA 3CFEA 3CU1A 4AEIL 4AM0B 4HJGB 5CEZH 5B22A 2GT9B 4OKDA 4LBEA 4Z5RB 4DVRH 3F6IA 2GAZA 5DA0B 3X14A 1JZ7A 3I3BA 5IT2H 4Q9QH 2ZUSA 4KRPD 4X6EB 2GY5A 1CLCA 3VFTB 1XGTA 3VFGH 1SMOA 5TDPA 3MCLL 1SEBB 1D6EB 1VPOH 3GSUB 1QKZL 3FFCB 4P2CG 4PRBA 3RA7L 3WSQH 4HJJL 2QSQA 4HT1L 1NC2D 1BVZA 1CFNA 1JPST 1ZA6B 3RI5F 3UXFA 3GSXA 3V4PH 4OV5A 4YFLF 1SHMA 5CEZL 3VGEA 3O3DB 4DGVH 5IHBA 4G9FE 4Y4KC 4DVRL 4HAFA 4ACPA 3VRJA 2RB8A 1ONQA 3MX0A 3WFCL 5IT2L 4Q9QL 4IRJC 4P4RB 2PTTA 1NSNH 2FEDC 3VFGL 4IMLA 4OLXH 1YC7A 3JV4B 4XCEA 3T2NH 1OD9A 2NX5A 4WHDA 4YC2C 1ED3B 3DX8B 4DZBA 1YYMH 1RIHH 5IW6A 3GM8A 1F4WL 3STLA 3V4PL 1YYLH 3WEXA 3E3QE 4DGVL 4WWKB 4R96B 4G80B 3SKJH 3KLDA 1YEHL 4OZHB 1AGEA 3C60A 1NANH 3FQUA 4YEEA 5IHZA 1NSNL 2FL5A 3QUMB 1J7VR 5SX4I 4JHAL 3MUGA 2EDKA 3RX5A 4G8GA 2QHRH 3DUSA 4I0PD 4S1SL 1WQVT 1YYML 4PB9H 3DJ9A 3EGSA 3DUUB 1L9MA 2AXHA 4WUKL 2CIIB 3CFBB 3SKJL 1L6ZA 2JELH 5J06A 3B6SB 5KAQG 4P3CL 2I07A 2NW3A 5C0AB 1MNUH 2VYRE 4Y19A 4N0FB 3EYQD 3EHBC 1HIML 2QHRL 3ARBD 2CMRH 1NQBA 1M7XA 1C5DA 1DBKH 4Y2DD 4GRMB 4HWEL 4PB9L 3SDXA 4CU7A 2VNCA 3T0EA 1AHWA 4OZFG 2JJWA 1FC1A 2ZJSH 4OB5H 5CEXA 5KSAB 1IC7H 3TBSB 2ZUWA 3S9DB 4KZDH 1NCDL 2VQ1A 2X4UA 2XZAH 4JY4B 4PJEF 3D69A 3W39B 3NIGF 1S9WA 1CD0A 4MNHA 4CADA 5F88A 2CMRL 4PJHB 1DBKL 2YEZA 5KTEH 4MMZC 2EKSB 3SPVB 2ZJSL 4U2YA 4P57A 5JZ7C 2H41A 4AK1A 1IC7L 3F12B 3RWGA 3PQYB 1LHZA 3QULB 5I1EL 4KZDL 3ZT6A 3FOLA 1CN4A 2C1PB 2XZAL 4ZS6D 2H32A 4QRRE 4NQDB 5C9KA 2NY3D 3S6CA 1WIUA 3K4ZA 1KPRB 5GJSL 3BWAB 5BQ7A 4NQXB 5IB1B 4ZXBC 5JO5B 2DLTA 3A67H 2GTZA 4OIIL 4HC1A 4UAOC 1OF2A 4JQVA 5DEFA 3WFDH 4P4KC 3ZTNL 1B0RA 1XZ0B 1OLZA 4NCDA 1CQYA 4HULB 3DBXB 4QXTA 4YDKH 5CP3A 4ALAH 3VWKA 1NCBH 1J86A 3A6CH 5KVDL 3BZEA 1RK1B 1HYRC 3R0MA 4LVNB 5IOPA 4F58H 4P3DA 4L4TE 2GSIA 2R1WA 5ESQB 3VFOB 5DVOA 1ZMYA 2F54E 5FOBA 1BD2D 4P23D 1IC1A 4PJ8B 4ALAL 1AGDA 5F7EH 3U1SH 1NCBL 5F3BB 5D96B 1FL3B 4M6ML 2A73A 4URTB 3ARRA 3F7VA 4F58L 4NRZA 3TEUA 2VABA 3ULUF 3ROLB 3SKMB 1I8MB 3JWOC 3U0WH 1MSPA 4K94C 5TFSH 3VRLF 1U8OA 3OKEA 4U6XB 4WVRA 3S4SB 3WO4B 2Q8BH 2ESVB 3BKJH 2WBJC 2GUOA 4L3ED 1XF2A 1OSZB 3UYRH 1QFHA 5F7EL 3U1SL 4XGZB 3RL2A 3HE6A 4PRPE 2FWOA 1P9MC 2ATPB 4Z95L 3W0WB 3VI3E 5E8EA 2B4CH 1I3UA 3U0WL 1EBAA 2ZSWB 3RIFK 3OR7B 5TFSL 4U1LB 3MACH 4P59H 1KPVA 3EO1B 2Q8BL 2Z8SA 1MJUH 3UYRL 4MQ7B 3B2VL 3F58L 4KJQC 3BP5A 3AB0B 3IJYB 3PWVA 5IBLC 5CEYB 3I75A 5IMKB 5FYJH 4NO2A 1IARB 3MACL 1T2XA 2FHCA 5E2UH 1MJUL 4MAYB 4GS7B 5AWNH 3CZFB 5IF0B 5E8DL 4ZD3H 4HH9B 2AS5M 1UWXH 2HKFH 3SE3C 1A9BB 5C0IA 3VXSE 1JBJA 4XPTL 5HY9B 4QTIH 4HF5H 2HRLA 2WANA 2XWTA 2R2EB 5D2NE 3ARFD 2ILLA 3MO1A 3OKDB 5JOPE 4Y4FA 1PD6A 2B0SL 3AREB 3SY0A 5F89A 3ULUL 2HFGL 1NAKL 2UUDK 3O2VH 4NKDA 4UQ3B 4JFZH 5E2UL 3RHWK 5AWNL 1UYWH 1RZGB 3KPMB 4UMGA 1T20B 5CLTA 5EU5B 5FV2A 4KDWA 3ARDC 2HKFL 3QXUA 1F45A 4M6NH 1DSFH 3QA3A 4HF5L 3QNXA 3SDYH 3IB4A 2A0LD 2AV7A 2R0ZH 2Y07H 3ARVA 3CDYA 3TGXA 1YDPB 1WWAX 1J11A 4QWWC 3KJ6H 3KPSD 2AV1A 2P47B 4PRHB 2UZIH 2X4PA 5D71H 3WHE1 3CXDH 1HQ4A 3U2SB 1QBLH 4NCC2 3O2VL 3PHQA 3CVHA 1AXTL 5GGVL 4JFZL 4XVTL 4OUUB 2RGSA 1VGKB 1Z2KA 2DLGA 3LRSB 4M6NL 1YEKH 2COQA 5MI0B 2NX5D 3SDYL 4DGIL 3TZVC 2W0LA 2R0ZL 2Y07L 3JV5A 3GSQB 3QWQB 3KJ6L 2NXYD 1D5MB 2UZIL 3OJMB 3X3GL 5D71L 5EZJB 3CXDL 3MBXH 4OD1H 1NH6A 3MR9A 3GSRB 3C60D 3MV01 4N5ED 3AC0A 4EUPB 4JRXA 1U8IB 1YEKL 5F1OB 4QHLB 2CJUH 4G8GD 3G6DH 1WBXB 3SN6N 5T1KA 4PGEB 4EBQH 1CQKA 3DIFA 1NL0H 3DO7B 4YXHH 1C1EH 2AKRB 3HA0A 5DUPH 2EXYC 4OD1L 4UOW0 4MHHI 1PX3A 1XF4B 1Q94B 3IT8D 3MRBB 3WIIH 5INDB 4Z7WA 3OB8A 5I6XC 3U7WL 3HZVB 4Y19D 2DD8H 2CJUL 3KGRA 1TTGA 4XP4H 1M05B 2VE6B 4KI5C 1CF8H 3TO4C 3UAJD 4H1LH 5EOTA 3T0ED 4EBQL 1NL0L 5ALCH 5F9AC 1UB6B 3VFNB 4PBVC 1KC5H 3RWFA 1Z0MA 2HJKB 3MRNB 4PJCA 5KG9A 3QH3B 4JFOA 4QHNA 3WIIL 4CVZA 2A2QT 3MRPB 4I1NB 3AAZA 5FO9A 4WTXA 5KSUA 4U1SA 1FAIH 1HE7A 3G08A 2CLRA 1CVRA 2DD8L 2X1WL 1CK0H 1NMAH 4I2XA 1ORQA 4XP4L 3MRHA 1CF8L 2HAZA 3VA2C 3NCEB 2G2RB 4NO3A 5ALCL 1EUTA 5DMYA 4JRYE 1N5AA 5JUEL 3RUGB 1J1XH 5D2LE 1U93A 3EJJX 5I0DA 3GSVA 2GKIA 4P5MA 3KPQB 5E9DB 1FAIL 2ITCB 5D7IB 4EN3D 1AJ7H 4HK0A 1CK0L 1BBJA 1EVUA 1T03H 1QQDA 3SGDI 3K8LA 1INDL 2YPKA 3UTSB 4IRSC 1MWAB 1OSPH 3MNVB 3KAAA 2LU3A 5C71A 3QDJB 2WUCH 1AXIB 5IBUB 4P2OD 5IUSA 4L8DA 1J1XL 3O6FB 2MNUA 4H26B 2HRPL 2NR6D 4NKIH 4QRUA 4RAVB 4U7KA 4AG4H 4LQ1A 1U6AH 3I84A 1AJ7L 1RSFA 2APVA 4WUUE 3P4MA 1RPQA 1SJVA 3VFPB 4R0LB 3VWKD 1OSPL 1HDMA 2C3XA 5IFJA 1U3HC 2WUCL 4JJHA 5FKAB 4WJ5B 3MUHL 4NKIL 2V7HB 1QFOA 2NZ9D 2DLHA 4AG4L 1U6AL 4OKVB 5EU7C 3V6ZB 2F53A 1BFOA 1X7QA 5HD8D 2BNQE 3DV4B 3QJFB 5CD5D 2R2BA 2VLRE 1NEUA 4OZGF 1Z9LA 4ONFL 3GMQA 1V05A 3QO1B 1U2HA 3QJHA 2MTPA 5I75C 5CINH 1PLGH 1S9VB 1W72A 2AXGA 2C3HA 1YEJH 1AO7A 4HKJA 5DMKA 5E6IC 4CVWA 2BNRE 4XMLH 2EICA 1ZS8B 3WIFA 2OLDA 2G75B 4PJIB 5B39B 4PJXF 3QNYB 3LV3B 5IMLB 1JI2A 1JI1A 4M4RA 2XTJD 3HE6D 3JWOH 4PP1C 3UZVB 3RL1A 4X9GA 4G9DA 4CL7A 1A6UH 1H3GA 1GGCH 5CINL 1PLGL 3LQAC 4ZAKA 5T5NG 1YEJL 4UU9A 3O45A 3BEVB 1EIBA 3EOBA 1NCWH 3NCCB 5MENB 2WW8A 4JFQB 4J2XA 1F02I 4Z7UB 3GK8L 5H35A 1CFVL 4JEGB 4JQXA 1FPTH 3BPOC 4HAGA 4LU5L 1FZKA 3TA3B 5DMGD 2FIRT 3MGOB 2YMXH 4FTVD 2EO1A 4MX7A 3KPNB 3B9VA 1QHOA 4DVBA 4S10A 4Y5XA 1NFDF 3QZWA 1HOCB 2NXZB 1NCWL 1UXWA 1BM3L 1HH6A 2IBZY 5BXFA 3TT1L 3DGGB 1BF2A 4BELD 1CGVA 5BS0E 4OT1H 4PJ9A 3JWDC 4WW2C 4G9FA 3HUJE 4YZFE 3ILQC 2ICEB 3O4LE 2AK4E 1FPTL 4HQQH 4PJFF 4WFHD 2GEEA 4LCUA 3GFUA 3B2UC 4TNWK 1KTDB 2YMXL 4NOBA 1E6JH 4Y4FD 5D1QB 2OTPA 5HXMA 3EOAB 4IHOA 1MFAH 5HYSB 1WAAF 1IAOA 1EFXB 5EUOB 2FIKA 3WFZA 2YOCA 3NFSH 5FHBL 2I27N 3HPJA 4OT1L 1VKXB 4YAQB 1A3LH 1CDHA 1GVIA 4YGAB 1HXMB 5H8DA 5ACLA 3PWPA 4KXZH 1KB9J 1TQCC 3B9KC 4PJAE 5I8EA 1DQQA 5IVZB 2BFVH 2BCKB 1MFAL 1BFTA 1MIEH 2HJFB 2X4TB 3CC5A 4P46B 5T5FH 5I73C 1HCFX 1FNGB 1LO4H 3LB6D 5T1DH 3OWEA 4ONGH 2AEPH 3QB7C 1OQXA 3LVEA 3MRIB 3HLAA 4FQXA 1Q9LB 4E5XA 4JAMB 3QHZH 3NPSB 5EN2A 5GGSB 3CVIH 4ZSOB 4QHKI 1IL1B 3VCLA 3NCFB 3RVTC 3SE9H 3PGFH 1XF3A 1HK6A 1BLNA 2BFVL 4EJ1C 2QQKL 1QFPA 1AP2B 5CZXC 4PTUA 5T5FL 1LO4L 1NGQH 4Z7VE 1HH9B 2R4SL 2QQNH 4ONGL 4PJ7B 4NN6C 3BGMA 2E9BA 5CJ8A 2ICCA 3WDHA 1OGAD 3F7YB 4JRXD 3QHZL 3QCTH 4Y16C 5T1LD 3HMXL 3DX7B 3EYUH 3FT4A 3RNQA 3CVIL 4R7DA 4X5WB 1YMMB 3SE9L 3PGFL 1FJ1B 5D72H 1HHKB 4LAQL 3RIAF 2KKQA 5B4MC 1ACZA 3VD3A 2YD9A 4M9OA 1LO0L 2I60H 1GZPA 3LQMA 4LLWB 5SX4H 3JXAA 4X8XA 4QGYA 2QQNL 4LDEB 1K2DB 1MCFA 2AJYH 4JGMA 4DKEH 5C0FA 1L7IL 4YGVB 4JO2H 5IK3B 4ODSH 1AGCA 3BQUA 3EYUL 1CXKA 1VESA 2UUDH 1TXKA 3PWJA 5D72L 4I8DA 4NBZB 2O61A 2DWDB 4UV7H 3LKPA 3TFKC 3QFDA 3P11H 2I60L 35C8H 2BY2A 4QRRA 2X4RA 2YC1B 5HHNB 2XPGA 5F7KC 3VWJA 3JVGC 3ZKMC 4POYA 3VGGA 2AJYL 3PWLA 4LCIH 4YIQB 4DKEL 1BZ7B 4QRTA 2V9TA 4ODSL 2H2SC 3L95B 2V7NB 5F9DC 2ENSA 1QFWI 5I1KH 3IXTA 3GMNB 1CDIA 1P4LB 5C09A 4UV7L 5DK2A 4V1DB 4ERSH 4M3KB 3P11L 4ZS7H 2BXZA 35C8L 4WV1A 3CLFL 1T5WB 2ZUQC 2ED9A 2VUYA 1R3KA 3WLBA 1TVHB 4FZEH 1NCUA 5EO0A 4LCIL 5C0RH 3FB8A 3P30L 4FXGA 4V2CB 2LFGA 2W59A 4L4TA 4AMKL 1EK3A 4NNYB 5I1KL 4FXKA 5JDSB 4JO3H 3QUYA 4QT5B 2F54A 3H0TB 3UTZB 1Y6NR 3NZ8B 1KN2H 3I6KA 2ID5A 4OF7A 1UWGH 2X1XR 4ZS7L 3DVIA 2W0FB 4APQC 4BJLA 5E6YA 1JPTL 4R8WL 4PV8A 3UCRA 5FB8A 1QO3B 1YECH 3HE7A 4U05A 5C0RL 3QUKB 2VISA 2CGRL 4MSWB 3B9DA 4HFUH 1OPGH 3QIBB 1CFTA 4CW1A 4JO3L 1E28A 3KXFD 1UWGL 3MRLA 3PV6A 4HUKB 1T2JA 3B3IA 3BP6B 3LQZB 4XVUC 1T66D 4XPGH 3UTPD 1WWCA 2YA1A 4Y5YC 1AFVH 4HUVB 2Q6WA 3HC0B 1YECL 5BW7A 2Z8WC 4W4NA 2Z91A 2VIRB 3HTLX 2F53D 4G6AC 4WRLA 4HFUL 5JPMA 1ZT1A 1OPGL 5H37G 3LD8B 2X4QB 5DXWA 2NNAA 1RJZA 4KZEH 4OGAD 4FQCH 3KYOA 5DFVD 3D1MC 3KJ4C 4XPGL 1NLBH 5FUZH 5IVOA 1U2CA 5IVNA 4PJDE 2A6IA 1JHTA 1AFVL 1XGYH 2UWEF 4CUCA 1T1ZA 2CIKA 4NIKB 1AO7D 5H94B 5ITFA 5LBSH 4POUB 1KPUA 2XXCB 4PB0L 4XHJD 2IEPA 2VDLH 1LNUA 1HI6A 1GC1C 3U9PH 2LABA 2X4NB 3BDYH 5FUCC 5IQ9A 3VD4A 1XGPA 5TQ0H 2APFA 4JN2B 3LZFH 4FQCL 1SJXA 4NT6B 5FM5O 1OCWL 2EE3A 1FGVH 1NLBL 3BX7C 3O9WA 4XC1H 3UTTB 3SDAD 1RULH 1XGYL 3VXSA 1T1WA 2VL5A 3D0LA 3VXTA 3M45A 3LS4H 4R2GC 5LBSL 2PYEE 4GRLC 1X5KA 5D2NA 4MXQD 5D93B 4XWOC 3U9PL 1RURH 4ISVA 1ZHNA 2VL4A 3FB5B 1JWSB 2I9LA 3MLYH 3LDBB 5TQ0L 3LQAH 4O00A 2ZNXA 3QQ4B 1UM4H 3VFWB 2EZ0C 4M43H 4YHOH 1I7TA 4XC1L 3QYCA 5E2VH 2R4RH 1RULL 2KL6A 3LS4L 2DQIL 2WLYA 3TP4A 1IJ9A 5HYFA 3OX8A 4GG6E 3NIFE 2PO6D 4A2MA 4QXGH 3WS6C 2J3SA 4JREB 4NC0B 2BVQB 4KKCC 5KAQF 4V2BA 1DLHA 4PJ9D 3WFEH 4G9FD 4CN1A 1DVFB 3LQAL 3TN0C 2EDEA 4MNQA 2CLVA 2W60B 1UM4L 4FFYL 1V7MH 3TJEH 4M43L 4MJ5A 1MPAL 1S7QA 4YHOL 3MJ8A 4YHMH 2OYPA 5E2VL 5F7YC 2R4RL 4ZTOH 3U4BL 3MREB 1RZ8B 2NY1D 3C09C 3TIDB 4HZLB 3JWDH 4GO6B 1KLGB 4XBEH 1G7JA 3RWEA 4KRLB 2NY4B 1CFSA 4QXGL 2GTWB 4JPWH 2A6DA 3CZJA 5D9SB 4WWID 4R4BA 1DBBH 2DQTH 4HUMB 5CBEA 1URLA 2R39A 5DR5H 1F2XK 3RKDD 4LIQE 3T4YA 1S5IH 4X7EC 1T04A 1V7ML 3TJEL 4XP5H 2E7MA 1NUNB 2XI9A 4YHML 4OLUL 3D39A 4XB8A 4ZTOL 2QSTA 1K4CB 1P4IH 1HHJB 1RK0B 3MZGB 3JWDL 4XBEL 3QEQB 2PYFA 4GKSB 3LRHA 4ELME 1KJ2A 2EYRA 5EORH 3SDXF 5D7SH 3DX9A 4JPWL 2EIDA 1DBBL 2NTSP 2DQTL 4FQXD 2VH5H 3N85H 4HSQA 4Y5VA 5DR5L 4NKOB 4UILH 1TETH 5D1ZC 4F8QA 3K7UA 3M17A 5EZLA 1S7SA 1VEOA 5K9KB 1S5IL 3T3MF 4Z0XA 4QY8B 5INCB 4XP5L 1LILA 2W65A 1PKQE 5IWLA 4M5YH 3FQTA 1OTTC 4YH6A 1ITCA 3DVNB 1MUJA 2DKSA 4XH2A 3RDTC 5D7SL 3C5SB 2CLZA 5HHXL 2V2WA 2MHAB 4NC1E 4W6XB 3V4UH 5H2BA 1OT1A 4PJ5B 4CNIB 1HZHH 2VH5L 3MRRA 3N85L 3TJHC 4UILL 3ZT7A 4OFPA 2W07A 1CGSH 1R5IA 1FH5H 1NFDB 4M5YL 1UWEH 1ZVSB 4B53A 4QF1A 3QQ3B 4Z8FL 4F57H 1T22A 3G6AB 2PXYB 3FFDA 3ZE1E 2RAMA 2H26B 2VN7A 4PY8I 5CJQH 3VXRB 2APTA 2OQJB 3RGVA 3V4UL 4AIXA 4PJFB 2VQUA 1EO5A 3P9MB 1I1YB 5ETUA 8FABB 5I8CB 5L2KB 3DRQA 4JRYA 1WTLA 2XN9D 2GCYB 5D2LA 5DT1H 3DMMB 3LEXB 3GRWA 5E70A 4C59B 4W70A 5C07E 2IALB 1QLFA 3EJZD 5C6WH 1BQLL 1RUQL 4F57L 2D7OA 3EFFA 5CBAB 1KLUA 3BUYA 4HHAB 4X8JA 3QDGE 1W0YT 4QRRD 4RFEA 5EZOH 2FJGB 3ORJA 3VWJD 3MGTB 3G04A 2FX8L 1S7WA 3OKMB 5IHUH 3SGKA 4MA1B 1T5XA 1JNLH 3ARBB 5JQ6H 3D2UA 3SQBA 3CXHJ 3MJ7B 5IG7A 2ZSVA 2H32H 4W4OC 4WUUA 1FLTX 5CP7B 4BKLB 5HDLA 2ICES 1Z5LB 3G5ZB 1S7RA 3IAPA 2VXVL 5CAYB 5EZOL 2VUOA 3MCKA 4ORGB 3FTGB 4UDUB 4O2FB 1ZGLB 4PG9A 4Z0BH 3S35X 3OXSB 3FFCE 4GAGH 1U3JA 3IF1A 3U46A 1YUHA 2FO4A 1CICA 4HEME 4L4TD 3CX5K 5JQ6L 2W9LA 4ZFGL 1HWGB 5C9JB 2ZNWA 1DUYA 2F54D 4UT7H 2D7PA 3BFOA 3H42H 2JKXA 2BSRB 3EO9H 2KQNA 5CP3H 1S5HA 5DJ0A 2BNQA 1HEZA 4ETYA 3WN5C 2YD7A 1YNLL 1TLKA 2C7UA 5CMAB 4LF3B 3CFIC 2DDQH 2VLRA 3BWUC 3UTQB 3HE7D 1R3JB 4JFDD 4Z0BL 2DYPB 5EBMA 3HZKB 2OI9B 3SGDH 1MQ8A 4GAGL 4HC1L 5GIRA 5IBTL 1M4KA 1A1OA 1UXSB 1BOGA 1A6WL 4UT7L 5ACZA 5IM7A 5GSRA 3QSKB 4D8PB 5ESVB 3H42L 3U0PA 4G43A 4WU7A 3U30C 1G9MC 4OZHE 5D7JA 4ZUTA 5GPRA 4Z78B 3GBNL 2QR0B 3LS5H 2BXYA 2Q86A 2DDQL 4PRPD 3IFOA 3BXNA 4LVOC 1JF6A 4J3TA 3L3DB 5HGAA 1JL8A 3MLTB 5DQ9B 3RZCC 5DO2C 5GRUL 1H15B 4Z7OE 4NQSB 3C5ZD 2ZOLB 4LLYA 1HSBA 4ZAKC 3WFHB 2H8PB 3DYMA 5DJCA 1TJHH 3ALXA 5C0AE 2FYYB 4JG0H 2VDPL 1D6VH 3GSNB 4NPYA 4HWNA 4P23B 4PY7B 4JKKA 4AT6B 4N8VB 2ADFH 1JV5B 1NC4A 2X70A 3PWNA 1EEQA 1MJJB 3IXAB 1EO7A 2YRLA 3EYFB 3T3PE 1YY9D 5I71B 4OIBA 3QIUD 5BS0A 1YQVH 1A5FL 3BAEL 3HUJA 3VXSD 1W2KT 4JR9H 4KV5F 4NKQB 3O4LA 2AK4A 4JG0L 4XTRD 2C4FT 1D6VL 1ND0A 1KJVA 3QXVA 2FHBA 3QXTA 5EH1A 4PJHE 4FHBD 4PR5A 2NLJA 1OAUH 2X41A 2PW1B 2F19L 1WBZA 4RGOH 2EKJA 4ZUSA 3DXAB 4KK8D 1MJ8H 3AS3A 3FO1B 2H3NA 4DN4H 5F3HB 5F9JB 3PQYE 4MQXD 2VMFA 1YQVL 3TYFA 4RZCA 4HPYH 4ZPTA 5IB5B 2D7TH 3KPOB 5DD5H 4NO0D 2DQJH 5D7KD 4PJAA 4NQDE 2W0KA 3NCYP 1I1FA 4U1HB 5DQJA 1OAUL 4RGOL 4XPFH 1KTLA 3CX2A 3T2PA 4ZUVB 4S0SD 4DN4L 4YHIA 3HR6A 1HQRB 2CRIA 1TQBB 4JDVA 4I9WD 3ZDZF 2DWEB 4EDXB 2R0WH 5I1CH 3FQRA 4HPYL 3IJHA 1YMHB 1YEGH 4N9GB 3PDDA 5DD5L 5LKNA 1KN4H 4YBLC 4QKXB 2DQJL 3S36X 1JN6B 2JLLA 4JZOA 4OCSH 1OD7A 1VDGA 4XPFL 4LVEA 4UV4L 4RAUA 4JB9H 4Z7VA 4Z7WF 1MH5B 2BRRL 5DJDB 3HAEB 2NY6C 3GMPB 3TPUA 4FP8L 5KBNC 3HI6H 2R0WL 2DQFA 1YEGL 1KN4L 4K55A 1IAII 2CKBA 1N6QH 3HMWH 2LVEA 1I8LA 4ZFZB 5J13C 4H25B 1F4YH 5SV3A 2R9HD 1Y0LA 4S1RL 4PJCF 1OB1B 5B8CB 1RZ7H 3K81A 4IIQB 5CIPH 1VA9A 5KSVA 3CVHL 2YUVA 1BFVH 3ZE2F 4FQQA 2PNDA 5GSVB 5I1GH 3KPSB 1JZ2A 4MA7H 5HYQB 1FFQA 1K4DA 3FRPA 1N6QL 2ESVE 3HMWL 4B7IA 3QQ9C 2FX7H 4G42B 2AJUH 2D9QB 4OTXH 1ZT7A 2J8UB 2Z31A 3R4DA 2APBA 3BQUC 5JMOC 3VE0A 3VI4F 4H20H 2ICWB 5EU3B 1BECA 1BFVL 3W0WE 4UDTA 3N1PC 2W9EH 5I1GL 4XB7A 1IGMH 1YN6A 5DJ8A 4BK4A 1AD9A 2XQBH 1CL7L 1MLBB 3CDCA 3K46A 4OTXL 3RGVD 4U49A 4UIMB 3FRPG 4UTBH 1MRDH 4JANB 4N0RA 5D6CA 4I4WA 1B88A 5FDWB 5DRXB 4DZ8A 4OZFB 4KHTH 3T65A 2W9EL 4DKFH 4D0DA 1FFPB 3RTQA 4KGJA 5BJTB 1Q9WA 2V2XA 3PXHA 4WI9A 1H0DA 4MD0B 3RWJB 4HMDA 4ZFOA 5DHXB 1F90L 2XQBL 3GBMH 5D1XB 5IMMA 4CU6A 1LK2B 5C0DB 4A6YB 2OR7A 4UTBL 1IGFH 4C57C 1IBGH 3LH2L 3K8KA 5C6TL 1A0QH 5GGTH 2R23B 4HS3B 3VRIA 3D2UD 4F3FB 3O6LH 3GHEH 5B3JF 3IDYB 3PL6C 1MLCA 4WUUD 3UO1H 1MCNA 4KUCD 3GO1H 1D5XB 4KTEL 1WSST 3P9WB 3GBML 4WHCA 2FJHB 2OTUA 3RY6C 3MJ9A 5T5NF 4NN7B 2A77H 3SDCB 2GW5A 4F80A 2CDGA 3DVFA 3R06A 1QFWH 5JOFB 1I3RB 1AY1L 1CICD 3PE9A 2O5YH 2BERA 2ERJB 2HFFB 3MROB 1A0QL 1FQ9C 3BPNC 4NQUA 3O6LL 1O5DT 3GHEL 2GJZB 1GGIL 4PRHE 1A22B 2QADD 2C4FU 3UO1L 5L2JB 1WF5A 1TITA 3GO1L 4D9QD 5GS0H 3O4OC 5BW7C 4PD4J 1UACH 4H88H 1EXUA 3MRDB 2Z9TA 4OLWH 2HG5A 2VLRD 3B43A 3ZKQD 2B8OT 3GI9H 3CFJB 1AI1L 2JTDA 2O5YL 1DBMH 3U0TA 4PP1D 4RDQG 4RFOH 5EUKB 2X1OA 2XT1B 2IPUG 1FN4B 5IEKA 1N0XH 4F7TA 3G6JB 5DD3L 2BNRD 3ZLQC 3VG9C 2WZPD 5FV1L 2AK1H 4PRDA 5E5RB 4P2OB 4O58H 5GS0L 1PDKA 3L3GA 5EA0H 1F4HA 5HI5D 4H88L 4JKLA 4OLWL 4JN1H 4F7MA 4YHPB 3CPLA 3ECBB 5LCVH 5EC2B 1G6VK 3MLXH 3GI9L 4FG6C 1DBML 1U8PA 3V5HB 1ZHLB 2W1NA 1SM3H 4J12A 3AS0A 1G9MH 5HHPB 5L8LB 1OGTA 2I9TB 1N0XL 2PYEA 5E2JA 1EBPA 4ONHA 4KJYA 3O9WC 4D0BA 4J8RA 4O58L 1AH1A 3MUJA 1UEMA 5E4IA 5EA0L 1HYSD 3EYSL 3MJ6A 5ADPL 2VLJB 5TPWH 3VFRB 3WNKA 4QHUA 4OD2B 1ZWIB 2IAMA 3MLXL 3FT2A 3S3JA 5MEQA 1HHIA 5EWIL 3OKNB 1KNOB 1FDLH 2VLLA 1W72L 3FZUC 1NC4D 2HKHL 1GJIA 1BBDL 4GG6A 2LAAA 4X6FA 2IH1A 4MCZB 2EH7H 1KOAA 1I8KA 1JUFA 3SJVB 3NZHL 5BS0D 4TNVK 5TPWL 2BOBA 3O4LD 2AK4D 3UMTA 5FECB 3L7FB 4Y4HA 3P4NA 3BIKB 1I1AD 3GJEB 1K6QH 1S78D 2WWMC 4QOKB 4LEOB 5D4QA 6FABH 2QSCH 4P48A 4UB0L 1MHPH 4WW1A 3FOMA 2D9CA 1G7PA 3RUGE 3TO2B 3HPLA 1G84A 3NH7H 1XGQB 3MRGB 4NFBA 3TBYA 5L0QB 1TJGH 5E9DE 3IFNH 3MODL 5D7IE 4MXWH 5CJ5A 4RIRA 4XPAH 1A1NB 3REWB 3V6BR 1TCRA 3H7BA 4XZUB 2GYSA 3UTSE 2EC8A 4TTDD 1B4JH 6FABL 2QSCL 4J23A 3QI9C 4K3JH 4XCNA 4DFIA 1MHPL 5IV2B 4ELMA 1MHHA 1YNTA 2J5LB 3QDJE 4XAKD 4Q6IC 1TFHA 3NH7L 1UT9A 1NJ9A 1WZMA 4RISH 1QACA 4FTVB 2ZG2A 5HHMD 2G9HA 3MA7A 4DUXA 4JFEB 2E7LC 3IJSB 4XPAL 3ZKNC 2OL3A 4HW6A 1MRCH 5DJYB 5JPNA 3ZO0A 1PKQA 3ILPB 1FVDB 4Y5VC 1Y6MR 1BQHA 3S96A 1B4JL 2X89A 4LQFH 4K3JL 1XR8B 4C83B 2ADGB 4K7FB 3BEWB 3KHQA 3OKYA 1QYGH 4KRMB 5IWLC 4RISL 4Z76A 4ODTL 4XCYA 2NTFB 1PY4A 3F7PC 4I5BA 1FNEA 2BVYA 4U1IB 5EOQH 3V0VB 3EBAA 1EGJA 1IC5H 1MRCL 5TDOA 4HLZG 3MJGX 3PWUA 1G9EA 4LQFL 1ZAGA 1MCKA 1I85C 2XWBA 1C7SA 1BQHG 4WTWA 4XWGH 5DQDL 4OF0A 1QYGL 3DSNA 3FB6B 1ES0A 4BZYA 3D25A 1G6RA 1GYAA 1EMTH 1UC6A 4XI5D 3QUXB 3BVNA 5EOQL 4TOYH 3OXRA 4KRNA 3ROOB 3WNMA 3ZDYE 4J4PA 3MUY1 5CKAA 4JM2C 3EZJB 2AGJH 4PJIE 4M8QB 2D7QA 1T80A 2NY2D 1HXYA 2Z31D 1S7XA 2XNAA 5J1AB 1T1XB 1JTOA 3QG6A 4WEMB 1JPSH 1KB5H 3Q3GA 3QDGA 2AJZB 1IT9H 4XWGL 1QRKA 5FGBA 4YXLL 4GAJL 3C8DA 3VFSB 2Q87A 3U7YL 2NY0C 4UIKL 4NYLA 4K9EH 2AGJL 3H9SA 4W6YB 4LLMB 3GMMB 4M1DH 3STZB 4EXKA 5MENE 3WO3B 4AM0A 4HJGA 2ATKA 2GT9A 4Z7UE 4Z5RA 1A4KB 1OGAB 4XBGB 4TULH 3PP3K 1EPFA 1I9IH 5T1LB 2YD8A 2AJ3A 4X6EA 3BH9B 3VFTA 3H9ZA 1SEBA 3RTQD 3GSUA 3FFCA 4QTHB 2NW2B 5GRVL 1SJHB 4K9EL 1ZA6A 1UZ8B 3PHSA 4M1DL 3V4VH 1A6VH 5FYKH 4DGYL 4PGBB 3O3DA 2NYYD 1O7SA 2RJMA 1I9IL 3UC0L 4K23H 4MJ6B 3RY5A 3VXQB 3JV4A 4OUOA 5DHVH 3VI3F 3S88H 1VFBB 2DICA 1ED3A 5EPMB 5BCAA 3G5XB 3DX8A 5DTFB 4K8RC 4OJFH 1DFBH 5EUOE 2F9BT 1MOEA 3V4VL 5FYKL 1BGXH 4WWKA 3QUZC 4R96A 4OAWB 1NCTA 1I8IB 4FRWA 4HUUB 2X2YA 3L5HA 3SO5A 4TTGA 4I18B 2UY6A 1IILE 3QUMA 1MFNA 2O5ZH 5DJAB 1SY6A 1MI5B 4MDIB 4YO0A 4CBPA 4OJFL 3RWIB 1UA6H 1IGYB 4U1KB 2EIZB 3EJYC 4ZMAT 4U6TA 3H9HB 5D6DA 2NQCA 2FBOJ 4B41A 4H5SB 2CIIA 3CFBA 5T1MB 2X09A 5A2LH 4G8FB 1D3CA 3RBGA 5EBGA 4ZSOE 4NQVB 4Z9KB 3B6SA 1N5YH 1BREA 2F5BL 2BHUA 5C0AA 1BPVA 4N0FA 5LAXB 1J1OH 5I16A 5E5MB 3C2SA 1CXHA 4R2GD 3GBLA 1KG0B 1OW0A 4GXUM 1UA6L 4GRMA 2Q76B 4PJ7E 1I7UA 4KC3B 4AIOA 4MA3B 1NLDH 4FFWD 1VACB 3NABH 3OPZH 3DVGA 5SX5K 4X4YB 4LCYB 5KSAA 1PEZA 1OAQL 2UYLB 1OTUC 3IFPB 1N5YL 1YMME 1KACB 1LD9B 5C0CB 3PIQB 3WUZA 1S9XB 3H6JA 4JY4A 2PYED 3W39A 3KXFB 4KTYA 1F3RB 4PJHA 2V5TA 4OCRH 3DUHA 3STBA 5E2WL 3SPVA 4ZQKB 3BD5A 1NLDL 1MVFA 1BAFH 3NABL 1NAMA 3OPZL 5KVFH 2IAMD 1H5BB 3V52H 4NSKB 3F12A 1ZOXA 3PQYA 3QULA 4B0MM 3EOTH 2C1PA 2OZ4H 2B39A 5HDQH 3OKKB 1L0YA 4NQDA 4YK4B 5DZLA 3RVVD 3HFMH 4OCRL 1KPRA 3L3KB 3L7EB 3DARA 1QA9A 3BWAA 4HIEB 2A74B 3LMJH 4CJ1A 1SEQL 2VWEE 2VDRH 4NQXA 5IB1A 5FYJU 5JO5A 1YQ2A 2Q3ZA 3O41B 2HTLC 5KVFL 4Y4HD 5F21B 1QEWB 3RHWF 4LLAA 3EOTL 1YNKH 1T3FB 2A6JB 4V1DE 5JDJA 2B1AL 1XZ0A 3O8XC 1JZ5A 2KPNA 3DBXA 3HFML 1JNNH 4L5FH 3SDAB 2VDRL 4DTGH 3ZYJA 1RK1A 1WFNA 2ZCKL 2DJSA 4NUJB 1DLFH 4R26H 4HUWB 2F5AL 5D1ZD 3VXNB 1WBYB 4HUXB 5ESQA 3RGHA 3VFOA 1YNKL 2WIMA 3KR3H 1OVZA 1MY7A 1XEDA 4M3JA 5JHDB 4D9LL 1T7VA 4GAYB 4LCCC 4PJ8A 5I18L 4Y4KB 1JNNL 3DSFH 4NN5B 5F3BA 3V0WH 4DTGL 4IRJB 1FL3A 4QGTA 2CH8A 5HGBB 4MD5B 1I8LC 2IWGA 3LN4B 3DHMA 4KKLD 1K8IB 4XMKH 3ROLA 3OMZA 4YC2B 3RBSA 2X89D 3KR3L 4S1QL 4YEFA 1KJ2H 2V9RA 3NCJH 5DRZB 2ESVA 1OSZA 1EHAA 1INEH 3DSFL 4XGZA 1CT8B 3EYOB 5D2LF 3V0WL 4EZMA 3UDWA 1PQZB 2YWZA 3WNPA 2ATPA 3W0WA 4PY8J 1XFPA 1OAKH 4IDJH 4PLNC 3L3HB 4XMKL 2E5EA 2ZSWA 4UNVA 1JPGB 1K5NB 1CZ8H 3AS2A 3OR7A 4U1LA 1LE5B 1KJ2L 3NCJL 5AG9A 3EO1A 1LO2H 4JM4H 1TIUA 4MQ7A 1INEL 4M62L 3S4SG 3PG2A 2IJ0C 2CK0H 4R3SB 7FABH 5BRZB 3AXLB 4J4PD 4M03A 5JXAH 1CDBA 3IJYA 4IDJL 4P5KA 5CEYA 5C1MB 5IMKA 4GUPB 5C07D 4KUCF 4W81A 5IGXL 1W0WB 2DOCA 1JWUB 3K1DA 5HPOA 2O26U 1V3MA 3MLWL 1NDMB 1LO2L 4WI8A 4S2SB 4MAYA 5IF0A 2Z35B 4HH9A 3D87B 3UTTE 3TLRA 1A9BA 4M1GL 2CK0L 5HY9A 3WNLA 3HC3H 2DAVA 4PBXA 2E7CA 4J3XA 3DLQR 4GMTH 3GRWH 3OKDA 1PG7L 3AREA 4FQ1H 1B9ZA 3AFLA 3NCMA 4KKBC 4UQ3A 3MYZA 4ENEC 1RZGA 3KPMA 1T20A 4O5LH 4XNXL 4YQXH 2ZWLT 3FFCD 2VXQH 2XQYG 3LN9A 4RFNC 4GMTL 3GRWL 1P5VA 5EO9B 2VZSA 4FQ1L 2XZQL 4PRHA 1EFQA 3L5WB 3IDXH 5C8JB 1IZJA 3GJFK 3U2SA 5KW9H 2HT2C 4YDLC 2XN9B 4JLRB 3DHJA 4OUUA 1OQOA 2EXWC 4X5XB 1AGFB 1VGKA 4ZXBB 1NUFA 2CQVA 4EXPX 4YQXL 5E56A 3VDBA 4UAOB 3N1MC 4LARL 1HKFA 2VXQL 1MQKH 2HLFC 2CUHA 4P4KB 1ADQH 3GSQA 1KCRH 3MV8B 4MS8D 2DLIA 5CWSB 5I74B 1D5MA 1BWMA 3IDXL 2BVTA 4KQ3L 4WWKD 1JGUH 3N50A 1P6FA 25C8H 1TTUA 5KW9L 1FRGH 3LY6A 4RNRB 3GSRA 2EDYA 4K8RH 2HVJB 1U8IA 3BN9C 4U0RC 2OK0L 3QEQE 1MQKL 3WHE0 1XF1A 3N1QC 1WBXA 1KCRL 1RAMA 5L6YL 1RIUH 3EYVA 4PGEA 3D18B 4NNPH 3VMNA 3DO7A 4MJIB 1I7RB 3FAXA 1JGUL 5E4EC 3W11D 1KEGL 1FRGL 3K0WA 3HUJF 4AIZB 1XF4A 5J57B 1Q94A 4YZFF 5C0BD 2VDQH 3MRBA 3OAUL 5GS2D 5INDA 2FX9H 2V5YA 3OR6B 2O5XL 1B3JA 3NBNA 3HZVA 4YE4H 2FD6H 3F65A 4N0CC 4RGMB 4EUPG 2VE6A 3PP3H 1P7KB 4U3XA 1RIUL 4LSQH 4PJ5E 1UB6A 3VFNA 2WBJB 4JFDB 5DSCB 2HLAA 3ELAT 2HJKA 1YEFL 2I25N 3MRNA 3QH3A 4NZJA 5DJXB 4EOWH 5KSAD 1A6AB 1FC2D 2VDQL 1Y18B 3MRPA 4YDJB 4AENB 1T0NB 1NFDE 5BV7C 4YE4L 5F7NC 3VXPB 1X5FA 4PJAF 1ZLUK 3IVKB 3EIFA 5F6IC 1Y6KR 1SBSH 1NBZB 4JY6B 1BVLB 3VXRE 2G2RA 4LSQL 4PJFE 2ITDB 5L2KE 2LTQC 3P4OB 4EOWL 3DROB 1ULVA 3PQYD 1WAAE 1INQB 3KPQA 5E9DA 3T1FB 2ITCA 5D7IA 4Q9RH 5TE4L 1ROWA 3V5DB 1EZVX 3QO0B 3WXVL 4HWUA 4R4NC 5HBBA 4PIRF 4NQDD 1E0OB 3UTSA 3E1F1 4HXBH 4TNWF 4U4BA 3NIDE 2HT4C 4Z7VF 1WJ3A 1HN1A 1U91B 1JFQH 2WAHA 3QDJA 3GIVB 3CDGB 4N1CA 3O6FA 3HZMB 2PTVA 4RAVA 3BKYH 4KWUA 4KKAC 1Q9OB 4MVBC 4PV9B 1G0DA 2V5RA 5A40E 1RUMH 1W8OA 4NO5B 3VFPA 1XGRB 4R0LA 4HX1B 1N59B 2J8OA 4FXLA 1JFQL 5EOCL 5J3HD 2OP4H 4NZRH 5FKAA 3ARDB 2SEBB 4WJ5A 4DW2H 3LCYA 3C6LD 5I15H 1V3LA 2V7HA 3BKYL 1SYVB 3FCTB 4OKVA 3QXDB 5IEHB 2E6QA 4PJ8D 5E7BA 3QJFA 4D0CB 7CGTA 1S8DB 2BVEA 2M8XA 4IMKA 1RV6X 2DKMA 2YPVH 2OP4L 3BKML 4BQCA 2FEEL 1G9NC 3QO1A 4NO0B 4DW2L 4UOJA 5I15L 3BE1H 4PJEA 3T1WA 1S9VA 3TZVB 4XCFH 2W91A 3NFPB 4OLZH 1A6PA 1ZS8A 3M07A 1U8LB 4PRAB 2G75A 2CKBH 4PJIA 4F9LC 5B39A 3QNYA 3WMSA 3LV3A 2HJLB 1UKQA 4XNUL 1BWWA 1S3KL 1RY7B 2E8YA 1K8DB 2YPVL 2C9AA 1QR4A 1ZGLM 4G3YH 3G5VB 1A64A 5MEPB 3BE1L 3MRQA 2CPCA 4DK6A 3GHBH 4XCFL 4NKMA 4OLZL 1RZIB 3BEVA 4JPKL 3BH8B 2CKBL 4NP4L 5MENA 4JFQA 4BSVB 4L8SB 15C8H 4GRWH 4Z7UA 5J12C 5B39G 3QRGH 3FQWA 5EIIB 5TE7H 3BPCB 3TA3A 1H3VA 4WI3A 4G3YL 5I6XB 4EVNA 3TH2T 4L9LC 3MGOA 2DJUA 3MMEB 1I4FB 4UBDC 4KROD 1PAMA 4RMTA 1PY9A 3GHBL 1R5VB 3PL6D 5AYQA 1HOCA 3FQNB 4N8CH 4MAYD 4RDQF 5TQ2H 3DGGA 5IJKA 1F8TL 4KJWC 2WBKA 4RQQB 4WHTB 2ICEA 3QRGL 1EEYB 5TE7L 4F7CB 3PV7A 5I1HH 3MGAA 4XBPB 5D1QA 3SE4A 1ZVYA 1PYWB 4M9PA 4POZC 3EOAA 4O9HH 5HYSA 1MAKA 2J1KA 4OCXH 3DXAE 3N9GH 4NJ9H 4FABL 3QPQD 4X98B 5EUOA 3O3AB 2GHWB 1KGCE 2YK1H 1VKXA 4YAQA 4Y89A 5AD0B 2ARJB 4KK5C 3NN8B 1HXMA 4PJDF 1F00I 5D7LA 3TBWB 3CH8A 1ZT4B 1J8HB 1KLFA 1JGDB 3OHXB 4YHNB 1RUKH 5I1HL 5J4MA 1S7TB 5IVZA 4PRHD 2BCKA 4O9HL 2FZ3B 5JW4Q 4P46A 2X4TA 4ZFOL 3N9GL 4ZTPL 3BJLA 3BPLC 4IRSB 1A3RH 2QV2A 5BVJB 5E00B 2DM7A 5HYSG 3MJ9H 3MRIA 5IROA 1Q9LA 4EIZC 4JAMA 5JLZA 5GGSA 1NBVH 5ERWB 4ZSOA 1IL1A 5D6DC 5E1HB 1RUKL 4FG6D 1HSAB 1DBAH 3KLHC 1AP2A 5CJOH 32C2B 4TRPH 1D9KC 1RHFA 2OSLB 1T2QH 1HH9A 4PJ7A 3VXOB 3MJ9L 4QCIB 1U3HB 3F7YA 4X4XA 1OW0C 2EEAA