4OVDA

Crystal structure of a putative peptidoglycan glycosyltransferase from atopobium parvulum dsm 20469
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
511
structure length
422
Chain Sequence
NDIVLHARRGTIYDRNGNVLAMSVDCKNNTKRVYPYGNVGVQILGFVNADNEGASGLEYYYNDILAGTNGHMISNITEAQNGQDIVLSIDIELQKKAEEQLTAAVKDFEAKQGGSIMAMNPRTGEIYAAASYPLPDFVDYESLNLKLVSSIYEPGSVFKVITTSIGVDNNLFGPNSTFNIPTELQVGDNKVTDDDWRTSAMDMSVREMLRRSSNVGMAFLETQLIGDKRFAEGIDKFGIGHTTGIDFPGEATGIVRSLDQYEGPTGGNMAFGQGLAIPFIQVIRAYTAVANKGTMVTPHFMVSKGGQEVSWPTKDVISSSTASAELDMMTTVVKEGTGVRAGIYGYTVAGKTGTGQQVVEETGSYGENSGFVASFCGIVNPSESDLMVYVGLNDTHQLASQSAAVVFSQFAKDAATRLNIQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a putative peptidoglycan glycosyltransferase from Atopobium parvulum DSM 20469
rcsb
source organism Atopobium parvulum
molecule tags Transferase
molecule keywords Peptidoglycan glycosyltransferase
total genus 119
structure length 422
sequence length 511
ec nomenclature ec 2.4.1.129: Peptidoglycan glycosyltransferase.
pdb deposition date 2014-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
A PF03717 PBP_dimer Penicillin-binding Protein dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4ovdA03
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4ovdA02
3.90.1310.10 Alpha Beta Alpha-Beta Complex Penicillin-binding protein 2a (Domain 2) Penicillin-binding protein 2a (Domain 2) 4ovdA01
2CC1A 1K57A 2UWXA 2ZC4B 3DW0A 5E2HA 4DXCA 1BLCA 4CJNA 5DF7A 3S22A 3BYDA 3VP1A 2XK1A 4E3MA 1FR1A 4EQIA 2WK0A 1FCNA 3TOIA 1DJBA 3BFDA 3PBOA 4OOMA 3ZG8B 5FQKA 3MKEA 1XX2A 2XFTA 3GSGA 4U0XA 3C5AA 3VMAA 1HZOA 4PM5A 2HP9A 4EUZA 1K4EA 4WZ5C 2WGWB 2EX6A 2Y2PA 4WMCD 3PBRA 5FI6A 5HAIA 5F1FA 1O07A 2ZC3B 5FQIA 1Q2QA 5A92A 5DF8A 1GHIA 4QB8A 3HVFA 3N4IA 4DF6A 3G31A 3HLBA 3VOYA 4KZ8A 2ZMAA 3NI9A 4KZBA 5AQ9A 4LENA 4DRTA 2Y91A 2Y59A 2ZLYA 3FZCA 4GDNA 4ZJ1A 1ZG6A 3D4FA 2I72A 5EE8A 4X68A 1IKIA 5FAPA 4GB7A 5FASA 4LCMA 1K56D 3G2YA 4S2MA 4MEZA 3DTMA 1EROA 1O7EA 3O3VA 3ISGA 4N1XA 1JVJA 3RJUA 3PAGA 3C4OA 1W7FA 4KZ7A 4E3JA 2JE5A 4KQRA 4B4ZA 4S2IA 4XXRA 5CRFA 1BUEA 2HDRA 3NBLA 1FSWA 1PIOA 2HDSA 1YMSA 5A91A 4OPZA 2ZD8A 2WGWA 2Y2IA 4HEFA 4LV0A 3N6IA 2ZC3A 2WYXA 1E25A 1TDGA 1RCJA 2Y2KA 3MZEA 5HARA 1GHMA 3ZFZA 4EBLA 1YQSA 2Z2LA 3M6HA 3OPRA 3N7WA 4QY6A 4E6XA 5FQQA 1K55C 1Y54A 2WGVA 1NJ4A 4PMAA 2ZQDA 4R3JA 2XGNA 1KVLA 4N1HA 1E4DA 5D3OA 4DE2A 4PM9A 3UPOA 4DDYA 3CJMA 1BT5A 2XLNA 3LO7A 4FH4A 4X6TA 4X53A 4P85A 3AGFA 4HESA 2PU2A 4R4RA 3W4PA 2R9XA 3MXRA 4GD8A 1ESUA 3N8RA 2WKHA 1SDEA 2XD1A 3BM6A 3FV7A 3IXBA 3GR2A 4OLGA 1ZKJA 1L0DA 5FATA 5HFOA 1BLHA 2H0TA 5EVID 1ONHA 3C7UA 2Z2LB 3E2LA 3SH7A 1K54C 4JXSA 3UE0A 3S1YA 3FKWA 4KENB 4YINA 3A3FA 4ZJ3A 5DTSA 2QMIA 2G2WA 1GCEA 1XKZA 4MNRA 1CI9A 2FFFB 4Q8IA 1MWSA 4S2NA 4OOLA 2HP5A 1LL9A 1XPBA 4GN2A 5KMWA 4KZ9A 3Q7VB 3IXDA 5DTKA 4FH2A 3ZG5A 4RX2A 1KE0A 1G6AA 4QHCA 5EECA 1I2SA 2Y2OA 1HVBA 4KZ3A 5FQMA 1IYQA 3VP3A 3UPNA 1LI0A 1ALQA 3BECA 5A93A 2ZM0A 2WUQA 3LY3A 4F94A 1C3BA 3HBRA 3OCLA 4LV3A 3GMWA 1SHVA 1KE4A 1YLTA 1K56A 1KDSA 2EX8A 1QMEA 3BFFA 3IWQA 1BLSA 3MZDA 1I2WA 4OP8A 3SS3A 3A3IA 4OH0A 5M19A 3QNCA 4JPMA 4WELA 1N4OA 5M1AA 3HLGA 1EWZA 2BLSA 2EFXA 4EWFA 4H8RA 1S6RA 1QMFA 4E3KA 5CERA 5CTMA 1IEMA 1VM1A 4DXBA 3Q7VA 3DWZA 3BFGA 5GLAA 1KGFA 5GL9A 3GVBA 1ES2A 2OLVA 4EBPA 1CEGA 1BTLA 4A5RA 4PM6A 4OLDA 4B88A 3RXWA 3VSLA 3AGEA 4QY5A 1GHPA 1YMXA 5EOEA 1EI5A 3G4PA 5E43A 2R9WA 4BL3A 2RL3A 1E3UA 1K57C 1RGYA 2IWCA 3ITBA 3VP0A 1DJAA 3HLEA 4IVIA 3V3RA 4JXVA 1MWTA 1MKIA 4GKUA 3FWLA 3SS4A 3PAEA 2ZQ7A 3UDXA 3A3EA 2V1ZA 3WS4A 5CEBA 3C7VA 4R23A 1YLYA 3UNWA 4JLFA 5G18A 5J8XA 4OPRA 4UAAA 3M2JA 3IF6C 5HW3A 2ZC5B 3ZVWA 3N8LA 4BENA 1YM1A 1TDLA 2ZQ9A 3GQZA 4K0XA 4Y7PA 3VFHA 2VGKA 4R0QA 1LL5A 3MKFA 1W79A 4D2OA 1M40A 2J9OA 3NCKA 3FYZA 4UHUA 2PBYA 4ZTKA 5FDHA 3WRZA 2IWDA 3CMZA 3W4OA 2JBFA 2XR0A 5F83A 3V3SA 2XEPA 3ZG7B 4Z9QA 1K25A 3G2ZA 1YLZA 2ZQAA 4WBGA 3V39A 4S2JA 3ZG9B 1L2SA 3OZHA 1KE3A 3IWOA 2ZQ8A 5GHYA 1W8YA 3Q7ZA 1H8YA 3O86A 2Q9NA 4N9KA 3MBZA 3BFEA 3PTEA 4ZDXA 5EPHA 3LY4A 4QD4A 3ZNTA 4RX3A 2WAEA 3TG9A 1IKGA 2Y2JA 3Q82A 3N8SA 1H8ZA 4JXWA 1IYSA 3ITAA 5AQAA 3VSKA 4KQOA 1WYCA 2EXAA 4MBFA 4X69A 4OKPA 4E3OA 3IF5A 2EX9A 3BLSA 4KZ6A 1JWZA 3G30A 4IEDA 1YLWA 3BLMA 5AQBA 5U47A 5HL1A 3CG5A 2WAFA 2XQZA 4JBFA 1Q2PA 4C75A 5HAQA 1CK3A 4KZAA 2WGIA 2ZC7A 5FQJA 1MWRA 5F82A 4BQMA 1BSGA 1GA0A 3NIAA 1YLJA 1PWGA 1L0GA 1NZOA 3UO9A 2C5WB 2DNSA 3LEZA 1BLPA 4C3QA 4RVAA 4S2NC 5CHUA 2IWBA 4OVDA 1ONGA 5AQ7A 5TR7A 4U3TA 3UE3A 2J7VA 4BD0A 1VQQA 4NK3A 4EV4A 2WKIA 1LHYA 5E2FA 3NDEA 2EFUA 4LV2A 2DRWA 4JF4A 4KZ4A 4X56A 1OMEA 2X01A 3HL9A 3Q81A 4S2KA 1NXYA 1ESIA 5HAPA 3WS2A 5KSCA 3IWIA 4KZ5A 3VP2A 5JYOA 5JYPA 1NYYA 4KG5A 2Y2QA 2VGJA 1BULA 2JC7A 4P87A 1LI9A 4CPKA 5GLBA 5L2FA 4L0LA 3DWKA 1KGEA 2Y4AA 5CTNA 5E2EA 1NYMA 4JKTA 4JF5A 2Y2GA 1IYPA 3HLFA 3HREA 5CGXA 1SDNA 2P74A 1MPLA 1NY0A 3IT9A 3UY6A 4GDBA 5F1GA 2GDNA 4PPRA 3NDGA 4N92A 4WEJA 4JXGA 3AGDA 4S2PA 3ZNYA 2A49A 1N9BA 3VOZA 5KZHA 2OV5A 3NC8A 4DE0A 5FSRA 3ZVTA 5FI2A 3C4PA 1ES4A 1S0WA 4OP5A 3ZCZA 1AXBA 1YT4A 4Y0OA 1PW8A 3ZG0A 3I7JA 4DKIA 3P09A 2ZM2A 3UDFA 5TFQA 2BG1A 4IBXA 2H5SA 4LCLA 1KDWA 1FOFA 1K6SA 4GD6A 4KQQA 1IYOA 2ZJ9A 1PZPA 1XA1A 3TSGA 5EVIB 3IH9A 4RA7A 2XFSA 3IXGA 5CHJA 4E3LA 4YFMA 2PU4A 4OOYA 2V20A 3E2KA 1PWCA 3V50A 5A90A 1ZG4A 3GV9A 3Q07A 4R3BA 4OQ0A 4IBRA 3W8KA 2EX2A 2Q9MA 3Q1FA 3OPHA 3LCEA 4WYYA 4WZ5A 4ZJ2A 3M2KA 1U60A 3IH8A 3V5MA 5E2GA 4C6YA 1RGZA 3GTCA 1I5QA 1TEMA 4NETA 3UDIA 4WMCA 3MFDA 4UA9A 4WEKA 1ERQA 1DY6A 2EXBA 1CEFA 2Y2HA 3HUMA 3A3DA 4FSFA 5FI7A 4B4XA 3W4QA 1W8QA 5DTTA 4PM7A 2QPNA 3OCNA 1FR6A 4MBKA 2H0YA 3IF6A 2X71A 4BLMA 3WS0A 2XD5A 4IVKA 2Z2MB 1JTGA 1DJCA 4XUZA 2XH9A 5EOOA 1FCOA 3ZDJA 5CECA 4P6BA 3UE1A 5EVIA 1PI5A 3SS5A 4QU3A 4E3IA 2J8YA 5CXWA 1L0FA 1WE4A 3EQVA 3VFFA 1JTDA 2P9VB 3BRMA 4N9LA 1Z6FA 4OONA 3HLDA 5EVIC 3FKVA 4HBUA 1MXOA 5FQ9A 3O87A 3UPPA 2XDMA 3QHYA 1PYYA 2H10A 1MWUA 4BD1A 3PBTA 5CGSA 1GA9A 1ES3A 3ZHHA 3NY4A 3G34A 1L0EA 1KGGA 2A3UA 3CZDA 1XXMA 4GOGA 1E3UD 3SOIA 4ZAMA 4DE1A 5GHZA 4PM8A 1SCWA 5EUAA 1XP4A 4S2LA 2HPBA 5I94A 5DVAA 3RXXA 5GLDA 4JF6A 2Y2LA 1RP5A 2Y2MA 3IF6B 3PBNA 3S4XA 2ZQCA 4KG6A 2Z2MA 1G68A 2ZC6B 1J9MA 1MBLA 3WWXA 2E8IA 3HLCA 1PI4A 2P9VA 4WM9A 1K6RA 1CI8A 2DCFA 2HP6A 3HUOA 2C6WB 5GHXA 2WADA 1SKFA 4S2OA 4UA7A 3A3JA 1JWPA 1XGJA 2RCXA 2ZM8A 4K0WA 4LV1A 2HDUA 5TGFA 3WRTA 3OPLA 4R4SA 1NZUA 1XGIA 4U0TA 4ZBEA 1ES5A 5FAQA 1PZOA 2WKEA 3PBQA 4X55A 3MXSA 4WZ4A 1K55A 3JYIA 5GLCA 2XF3A 1JWVA 3OC2A 4R1GA 4Y0UA 4K91A 1NRFA 4HBTA 4O7DA 4UA6A 2JCHA 4XUXA 2QZ6A 5HX9A 4BJPA 4E3NA 4FD8A 1FQGA 3VP4A 1M6KA 4OPQA 4Y0TA 1KVMA 4ID4A 3IHAA 4GZBA 1XA7A 3HUNA 2OLUA 3WS5A 1HTZA 1IELA 1W5DA 3O88A 3SH9A 4E6WA 1ZC2A 1PW1A 3ZGAB 3IQAA 1K54A 2WZXA 4RYEA 2OSUA 3GRJA 2Y55A 3BFCA 5CHMA 4M3KA 5CGWA 3UN7A 2ZC4A 5FAOA 4FCFA 3HLWA 1FCMA 4OQGA 3G32A 3M6BA 4OQIA 2G2UA 4QJGA 1BZAA 1HD8A 1MY8A 3B3XA 4BL2A 5IHVA 3IXHA 1WYBA 4GNUA 4EBNA 2Y2NA 2X02A 5EVLA 5M18A 5FA7A 5CEDA 4OQHA 1YLPA 4DE3A 2WZZA 3MZFA 5BOHA 3SH8A 1ERMA 3BEBA 4DDSA 2B5RA 4KG2A 3PBSA 4P0MA 1H5XA 1TVFA 2J9PA 1PWDA 2FFYA 1K38A 3P98A 3G35A 1FSYA 3OPPA 4MLLA 4OPYA 5KSHA 2V2FF 1LLBA 1K4FA 4MBHA 2HDQA 3IHBA 5DF9A 3QNBA 3WS1A 3EQUA
chains in the Genus database with same CATH superfamily
3BY8A 4R38A 3DW0A 5HZHA 4CJNA 3KSIA 4EQIA 2O99A 3GSGA 5I5LA 5F6AA 2WGWB 5F1FA 3S7NA 2ZC3B 3CUEA 4L9FA 1TS7A 5A92A 5DF8A 4QB8A 3N4IA 1LSXA 3F1PB 1XFQA 3LIAA 3NI9A 2L0WA 1VETB 2Y59A 3FZCA 3D4FA 3L9KA 5FAPA 4Y2FA 4S2MA 1G5UA 4MEZA 3QP2A 1O7EA 3ISGA 2W3EA 3R7WB 1T1CA 4KZ7A 1S1YA 4KQRA 4S2IA 2HDRA 4F3LB 1FIKA 2HDSA 4PHTA 2WGWA 4LV0A 3N6IA 1SZVA 3UB7A 1F98A 2WYXA 1E25A 3E0YA 5AVFA 2OWJA 2K7SA 1GSWA 4EBLA 1YQSA 3M6HA 1Y54A 4R3JA 4PMAA 2W1TA 2ZQDA 3T50A 4DJ2A 4EEUA 2V1BA 3B33A 3MR0A 3CJMA 3NHQA 3T1QB 4CLCA 1NWZA 4MDZA 3PR6A 1H8MA 2VGLS 2R9XA 3MXRA 2M7VA 1ESUA 2WKHA 1SDEA 4Q0IA 3MJQA 1L0DA 5EVID 1ONHA 3IS2B 1ZTUA 3FKWA 1H0MA 4ZJ3A 5DTSA 2QMIA 3NOPC 1XKZA 4Q8IA 3D3OA 5KMWA 1T1AA 4RX2A 1G6AA 5IS1A 3VP3A 4I5SA 5AVEA 2IA2A 2ZM0A 3DBAA 4P6ZM 5HDDA 3HBRA 3V67A 3IS2A 1SHVA 3LFVA 4OP8A 4GW9A 3A3IA 3BQAA 4WELA 4EWFA 2EFXA 3PXPA 2HJEA 1QMFA 4MMNA 5CTMA 4DXBA 1H3QA 4DJ3A 5GLAA 4MN5A 2QWSA 4NG2A 1CEGA 1BTLA 4WUJA 4A5RA 4OLDA 4B88A 3AGEA 1V9YA 2J3TD 5E43A 1K57C 2IWCA 3ITBA 4NXFA 1MWTA 1MKIA 5DKKA 2JHEA 3FWLA 1YSQA 3UDXA 3WS4A 2V1ZA 5TBMA 1YLYA 5J8XA 4UAAA 3M2JA 5HW3A 2ZC5B 3QP6A 4Y7PA 1LL5A 3MKFA 2PBYA 2VJWA 4I3IA 3W4OA 2XEPA 3ZG7B 5J7EA 1K25A 3G2ZA 4WBGA 3H9WA 2DMWA 1KE3A 3IWOA 4N9KA 3MBZA 4ZDXA 5EPHA 5TBMB 2WAEA 3TG9A 1P0ZA 3N8SA 1H8ZA 4UQIM 1WYCA 2HJ9C 3IF5A 3UMEA 3IX8A 3BLMA 5HDCA 2ZC7A 5DKLA 5FQJA 3LI9A 5F82A 4BQMA 4UQIS 2V8FA 3NIAA 1PWGA 4R6LA 3UO9A 2M1CA 5CHUA 4OVDA 3LIDA 2CMNA 4BBTA 4CQHA 2EFUA 2PAVP 1G28A 1OTIA 4KZ4A 4X56A 3HL9A 4S2KA 1NXYA 5HAPA 5KSCA 3IWIA 2PD7A 2ZBBA 1BYWA 1LI9A 4ME4A 2Y8HA 5GLBA 2Y4AA 2V8CA 4RQ9A 3LR0A 3NECA 3OLOA 4Y5FA 3HREA 1SDNA 1MPLA 4GDBA 5L07A 3ZNYA 1N9LA 5KZHA 1UGUA 2OV5A 5FSRA 3JVVA 4Y0OA 3ZG0A 4DKIA 2QJ7A 3CPTA 4HI4A 3P09A 4HH2A 5TFQA 2BG1A 4LCLA 3LGOA 1FOFA 4XT2A 4EU0A 1IYOA 2ZJ9A 5DJTA 4YFMA 3T1SA 3IBJA 1ZG4A 3Q07A 2EX2A 3Q1FA 2PT7A 4WYYA 3M2KA 3UDIA 4DN0A 1ERQA 4FSFA 1CEFA 3A3DA 4HJ6A 3W4QA 2QPNA 1FR6A 1XJ2A 2R78A 2X71A 4IVKA 2Z2MB 1JTGA 5EOOA 3ZDJA 5IU1A 3UE1A 4D60A 2J8YA 1L0FA 1WE4A 1JTDA 2P9VB 4N9LA 1Z6FA 4HBUA 4GHIB 3H82B 4G3KA 5CGSA 1XJ3A 3G34A 4MCWA 3MF0A 2A3UA 1XXMA 2I9VA 4Y3IA 4M4XA 3E98A 3HCYA 2M7UA 5DVAA 4JF6A 3PBNA 3IF6B 3S4XA 1T18A 2E8IA 3ULFA 3VE3A 3HUOA 1SKFA 2VK3A 2HDUA 4QWOA 4U0TA 3NULA 2HGVA 3CLOA 3JYIA 3LI8A 1JWVA 5HWWA 4K91A 4UA6A 2JCHA 2QZ6A 4KUOA 3FC7A 3F1OA 4Y0TA 1KVMA 2PRFA 4ID4A 1DRMA 4O01A 1MKMA 4GZBA 3UE6A 3IQAA 3LR5A 2O9AA 5CHMA 3MQOA 5CGWA 2ZC4A 4FCFA 3HLWA 1FCMA 3QP4A 2ZOIA 3IXHA 2B18A 4EW7A 2Y2NA 2X02A 5EVLA 3TJZC 4OQHA 1Y28A 1VHMA 2WZZA 3MZFA 3SH8A 3BEBA 4P0MA 3PBSA 1H5XA 3P98A 1FSYA 4WN5A 2HDQA 3IHBA 5CX7A 5DFXA 3WS1A 4DXCA 5E2HA 2WK0A 1FCNA 2JKRM 1DJBA 4OOMA 3PBOA 3ZG8B 2A24A 3C2WA 1XX2A 4EUZA 2INWA 4WZ5C 2EX6A 2Y2PA 2GX5A 3PBRA 5FI6A 1V9ZA 5FQIA 1Q2QA 3HVFA 4GDNA 1ZG6A 2W1TB 2I72A 3DTMA 1EROA 1AWIA 1MZUA 1W7FA 3C4OA 1J3WA 3T4OA 4B4ZA 4XXRA 3NBLA 1PIOA 1YMSA 2Y2IA 2ZC3A 1UWNX 3ICYA 1IOUA 2Y2KA 3BQ8A 5EM1A 1OTDA 5FQQA 1NJ4A 4O8GA 3E4QA 1T19A 1E4DA 3LIFA 4PM9A 5IT5A 4DDYA 1CQAA 1OTAA 2VV8A 4X6TA 4X53A 4P85A 4YNRA 4R4RA 2PU2A 4F3LA 4GD8A 2GNXA 3N8RA 3FV7A 2FZ0A 3B47A 1BLHA 2H0TA 2GZAA 2Z2LB 1K54C 3A3FA 4JGRA 4LRYC 4S2NA 4OOLA 2HP5A 1LL9A 4HJ4A 3Q7VB 2JKTI 3OBFA 3K2NA 5EECA 4Z1WA 3VE4A 2A2LA 4KZ3A 2BASA 3TRCA 2WUQA 3W2ZA 1OPXA 1S4RA 3U4LP 4LV3A 3GMWA 1YLTA 1KDSA 1VEUB 3MZDA 2V0WA 3QNCA 4JPMA 2BLSA 1S6RA 1IEMA 2VEAA 2B95A 4WLAA 1KGFA 3S7PA 3GDIA 2O9BA 2AVXA 3VSLA 3G4PA 2R9WA 4BL3A 2V1AA 3HLEA 4IVIA 3V3RA 3S7OA 3FPWA 4GKUA 5F69A 3SS4A 2ZQ7A 1LT0A 4X1MA 2ZQ9A 1CJFA 3GQZA 4LFUA 3T4QA 4D2OA 2J9OA 1X0OA 2KLIA 4EUVA 1ACFA 4CLCD 3DAVA 1YLZA 2ZQAA 4NEED 3V39A 3ZG9B 1L2SA 2ZQ8A 5GHYA 1W8YA 4Y17A 3T4KA 3Q7ZA 2O0YA 1D1JA 3LY4A 4QD4A 3ZNTA 1UWPX 3Q82A 3S7QA 2JN7A 1IYSA 3VSKA 4KQOA 4FUWA 4KZ6A 1S67L 5AQBA 2WAFA 3TW8A 1BSGA 1GA0A 2DNSA 3LEZA 3LICA 4NXGA 4S2NC 4HOIA 1ONGA 4L9GA 3OOVA 4LV2A 4JF4A 3VOLA 2X01A 1OMEA 4QPRA 2QJ5A 5JYOA 3T4SA 5FEGA 4CPKA 5L2FA 4L0LA 1KGEA 5CTNA 4JF5A 3HLFA 2J3TC 3IT9A 3EEHA 4PPRA 4WEJA 5LBRA 2J80A 2L1MA 3ZVTA 5FI2A 3C4PA 3F1NA 1S0WA 4OP5A 2ZM2A 4KQQA 1XA1A 3TSGA 3IH9A 3KYZA 3IXGA 4OOYA 2JKRI 4IHQA 3FPVA 4OQ0A 3OPHA 2JKTM 1U60A 5E2GA 1RGZA 3GTCA 1I5QA 4NETA 2PR6A 2LB9A 4I38A 1DY6A 3HUMA 2Y2HA 5FI7A 5FL3A 5DTTA 4PM7A 3IF6A 3WS0A 4XT2B 2VLGA 4EXOA 2EWVA 3P01A 5TJJA 4KQDA 3T1XA 3FKVA 3O87A 3QHYA 2H10A 4MN6A 1MWUA 3KSGA 1P97A 1KGGA 3CZDA 4GOGA 1OTEA 5EUAA 4S2LA 4BBUA 2HPBA 3RXXA 5GLDA 3IX3A 2Y2LA 2Y2MA 4KG6A 2P9VA 5GHXA 1D7EA 3A3JA 1JWPA 2RCXA 2ZM8A 4LV1A 4K0WA 4JGQA 4GLQA 3OPLA 3EEAA 1XGIA 4ZBEA 3H82A 5FAQA 2WKEA 4X55A 3PBQA 1K55A 2XSSA 3OC2A 4HBTA 4ARZB 4O7DA 4FTXA 2KDKA 4XUXA 1VB6A 3MFXA 5HX9A 2EA9A 4FD8A 1FQGA 3VP4A 3C8CA 3IHAA 1YSPA 2OLUA 4B93A 1IELA 2VA0A 3O88A 4NXEA 1ZC2A 3O5YA 3ZGAB 1K54A 2WZXA 2Y55A 3BFCA 4DMZA 3H7WA 1OT9A 4NXBA 3UN7A 2HF6A 5HL6A 1EW0A 4OQGA 4QJGA 2G2UA 1HD8A 2PYPA 1MY8A 1YAXA 4ARZA 5IHVA 2P08A 5G4YA 5M18A 3CITA 3LUQA 2VV7A 5HD3A 3CAXA 1ERMA 4DDSA 2B5RA 1OT6A 1TVFA 3UB9A 2J9PA 1PWDA 1K38A 4L9EA 3MQQA 3G35A 4MLLA 4OPYA 2V2FF 2WKPA 2P7JA 4MBHA 3QNBA 2UWXA 1BLCA 2ZOHA 5DF7A 4E3MA 3BYDA 4X1LA 3VP1A 1FR1A 3PHYA 3BFDA 5FQKA 4U0XA 4WF0A 5HAIA 4HQAA 3MSHA 1O07A 4WL9A 1GHIA 2ZL1A 3G31A 3HLBA 3EOIA 4B9OA 4KZ8A 2ZMAA 4KZBA 1TS6A 4LENA 4DRTA 4CLCC 4BWIA 4ZJ1A 5EE8A 4X68A 1IKIA 4GB7A 3G2YA 4HIAA 1Z09A 3CUEC 1JVJA 3RJUA 3KSHA 3PAGA 4E3JA 3K3CA 2JE5A 1BUEA 1FSWA 4HEFA 1HLUP 5C5KA 3NJAA 1SKOB 3OPRA 3N7WA 2WGVA 5G4ZA 5D3OA 4DE2A 3UPOA 3EWKA 3C38A 4KUKA 3LO7A 4HESA 3W4PA 2XD1A 3BM6A 3GR2A 4IJGA 5FATA 3UE0A 3E2LA 1VEUA 3NOTC 3T4LA 2G2WA 1GCEA 4MNRA 4R3AA 1MWSA 2PBDP 4GN2A 3R4KA 4KZ9A 3IXDA 5K5BA 1KE0A 5HD5A 1TF1A 1GSVA 1HVBA 5FQMA 5F5YA 1LI0A 2W3GA 3BECA 3LY3A 3QP8A 3RTYA 4F94A 1C3BA 5F68A 1KE4A 1K56A 2EX8A 1QMEA 3BFFA 3SS3A 1I2WA 2XRNA 4P6ZS 1N4OA 4H8RA 5HPIA 4E3KA 5CERA 2MJ6A 3Q7VA 3PYPA 3DWZA 3BFGA 4H6JB 1ES2A 2OLVA 4EBPA 4LGWA 1GHPA 1YMXA 2RL3A 1E3UA 3CWFA 4AFIA 4JXVA 4EQ1A 3DTIA 4PKYG 3A3EA 4R23A 4OPRA 3ZVWA 3N8LA 4BENA 1NLYA 1TDLA 1YM1A 4K0XA 3VFHA 2WKRA 2Q0OA 2VGKA 4ZTKA 3CMZA 3FG8A 2JBFA 1H8YA 3BFEA 3PTEA 2Y2JA 1NLZA 4JXWA 3ITAA 4X69A 4MBFA 4K08A 1F2KA 2EX9A 3BLSA 1JWZA 3G30A 3LR4A 4IEDA 1YLWA 1KOUA 5HL1A 2XQZA 1K0KA 2OAQ1 1CK3A 4KZAA 2WGIA 1N9OA 1YLJA 1CF0A 2VKSA 1NZOA 1JNUA 2VX8A 4Q0JA 5MC7A 4GJ4A 4BD0A 1VQQA 4EV4A 3TE8A 2G7UA 2DRWA 4YWZA 3Q81A 1XJ6A 3WS2A 4KZ5A 5JYPA 1NYYA 2Y2QA 1BULA 4P87A 3IX4A 4JKTA 1NYMA 2Y2GA 5CGXA 2P74A 1NY0A 2PHYA 5F1GA 5L10A 2GDNA 4N92A 3LEQA 1N9NA 3AGDA 4S2PA 3NC8A 1ES4A 3ZCZA 4JGPA 1YT4A 1PW8A 1ODVA 3UDFA 2W3FA 4IBXA 2H5SA 4GS9A 2QKPA 4GD6A 2V9AA 4RA7A 2XFSA 2OOLA 4EESA 5HWTA 5CHJA 4E3LA 3IBRA 1PWCA 3GV9A 2Q9MA 2J3WA 3V5MA 4C6YA 3F1NB 4I3AA 3RFBA 4WMCA 3MFDA 2W1RA 2O9CA 4CLCE 2EXBA 4B4XA 3OCNA 4MBKA 2H0YA 3P7NA 4GS9B 1A0KA 4BLMA 1OTBA 2XD5A 1IFQA 1FCOA 1MC0A 2HV1A 5CECA 3MMHA 3SS5A 4QU3A 4HJ3A 1G6OA 4JGOA 4E04A 5HSQA 3HLDA 1MXOA 5FQ9A 2VZWA 1T1BA 2KX6A 4BD1A 1GA9A 1ES3A 3ZHHA 2HZ5A 1PFLA 1E3UD 3SOIA 4ZAMA 4PM8A 2H28A 4NKPA 1XP4A 3QP5A 4EEPA 3BW6A 1RP5A 3UB5P 3C30A 2ZC6B 1L3LA 1MBLA 5EV0A 1PI4A 4ETXA 1CI8A 2HP6A 5L8MA 2WADA 4S2OA 1XGJA 3G6OA 5TGFA 3H7WB 3WRTA 3LIBA 4R4SA 1ZHHB 1PZOA 2PD8A 3VV4A 3MXSA 3SW1A 4WZ4A 4HNBA 4UEYA 2XF3A 4R1GA 4Y0UA 1DP9A 1TS8A 5FEFA 4HP9A 3UMDA 4BJPA 3BY9A 4E3NA 4OPQA 3RH8B 1XA7A 3WS5A 3SH9A 4RYEA 2OSUA 3A0RA 2V0UA 3GRJA 2ZMVA 4M3KA 5FAOA 3G32A 1BZAA 5HDSA 5J4EA 3B3XA 4BL2A 2A24B 4BMWA 1S66L 4EBNA 5DFYA 4GCZA 5BOHA 4KG2A 2FFYA 3OPPA 3EGDC 2NUPC 5EM0A 1LLBA 2B02A 4LPZA 2BTFP 5DF9A 2CC1A 1K57A 2ZC4B 4EETB 3S22A 2XK1A 3TOIA 3MKEA 2XFTA 3DTKA 3VMAA 3C5AA 1HZOA 4PM5A 2W0NA 2HP9A 1K4EA 5DJUA 4WMCD 4EERA 3HJKA 4DF6A 1LSWA 4IUHA 3VOYA 5AQ9A 3U2AA 2Y91A 2ZLYA 5FASA 4LCMA 1K56D 3CI6A 3LR3A 3O3VA 4N1XA 4CLCB 2W3DA 5EVEA 5CRFA 5A91A 4OPZA 2ZD8A 1TDGA 1RCJA 3F1PA 3MZEA 2WKQA 5HARA 1GHMA 3ZFZA 2Z2LA 4O0PA 4QY6A 4E6XA 1K55C 1PNEA 2XGNA 1KVLA 4N1HA 4X25A 2PR5A 1BT5A 2PDRA 2XLNA 3R7WA 4FH4A 3MS6A 3AGFA 3BJNA 2D01A 3IXBA 4OLGA 1ZKJA 5HFOA 3SZTA 1SKOA 3C7UA 3SH7A 4HY8A 4JXSA 3S1YA 4KENB 4YINA 4LLOB 1CI9A 2FFFB 3NOUC 4R70A 1XPBA 5DTKA 4FH2A 3ZG5A 1TS0A 4H6JA 3A0SA 4QHCA 1I2SA 1DP8A 2Y2OA 3LIEA 3CHWP 4ESPA 1IYQA 3UPNA 1ALQA 5A93A 5L09A 3OCLA 2K31A 3DTEA 3IWQA 1BLSA 3T4TA 4OH0A 5M19A 5M1AA 3HLGA 1EWZA 1VM1A 3EGXC 1GSXA 3UB8A 5GL9A 3GVBA 1Y4OA 3A0VA 4PAUA 4PM6A 3B42A 1YPRA 2D02A 3RXWA 4HHDA 4QY5A 5EOEA 1EI5A 1RGYA 3VP0A 1DJAA 3UB6A 4IUKA 2EWWA 1OJ5A 3PAEA 5CEBA 3C7VA 3UNWA 4JLFA 5G18A 3IF6C 5FDSA 2JKFA 1F9IA 4R0QA 1W79A 1M40A 2Y79A 3NCKA 3KSFA 3FYZA 4UHUA 5FDHA 3WRZA 2IWDA 2XR0A 5F83A 3V3SA 4Z9QA 3ZYTA 4Y15A 4S2JA 3OZHA 3O86A 2Q9NA 4HH3A 2Z6CA 4RX3A 1IKGA 5AQAA 1DP6A 4E3OA 2EXAA 4OKPA 2L4RA 3K3DA 5U47A 3CG5A 2YKFA 2Z6DA 4JBFA 1Q2PA 4C75A 5HAQA 1MWRA 1P9RA 1L0GA 2C5WB 2ACGA 3E4PA 1W63M 3KYQA 2FH5A 1BLPA 4C3QA 4RVAA 2JKGA 2IWBA 2XROA 1W63Q 5AQ7A 5TR7A 4U3TA 3UE3A 5HPFA 2J7VA 4NK3A 2WKIA 1LHYA 5E2FA 3NDEA 4PKYA 5A8BA 1S1ZA 5KIZA 3E4OA 1ESIA 1PRQA 3CPTB 3VP2A 4KG5A 2VGJA 2JC7A 4FOFA 3DWKA 3D9YA 2QYBA 5E2EA 3HJIA 2PYRA 2W3HA 1IYPA 1WA9A 3UY6A 4HP4A 3KX0X 3NDGA 4JXGA 3T1RA 2A49A 1N9BA 3VOZA 2VV6A 3BWLA 4DE0A 3D72A 1AXBA 1YKDA 2LB5A 3I7JA 4Y13A 4I3JA 4LRZE 1KDWA 1K6SA 1PZPA 2OAP1 5EVIB 2E8JA 1NRJA 2PU4A 1OJGA 2V20A 3E2KA 3V50A 5A90A 1LSVA 4R3BA 4IBRA 3W8KA 3LCEA 4WZ5A 4ZJ2A 3T12B 3IH8A 1TEMA 4BBVA 4WEKA 4UA9A 1W8QA 1XFNA 2XA7M 2YKHA 4XUZA 1DJCA 2KOIA 2XH9A 4P6BA 5EVIA 1PI5A 4E3IA 5CXWA 3EQVA 2VGLM 3VFFA 3BRMA 4OONA 5EVIC 5EFWA 3UPPA 2XDMA 1PYYA 4ZRRA 2XA7S 3PBTA 3NY4A 1L0EA 4DE1A 5GHZA 1SCWA 5I94A 1P9WA 2ZQCA 3KYEA 2Z2MA 1G68A 1J9MA 2K2NA 3WWXA 3QP1A 3HLCA 4YOFA 4WM9A 1K6RA 3LYXA 1F5MA 2DCFA 2UV0E 2C6WB 4UA7A 3ZQ5A 4GHIA 1NZUA 1LL8A 1ES5A 3KO6A 5GLCA 2NUTC 3JVUA 1NRFA 3GECA 4G3VA 2P04A 1M6KA 3JPUA 3T4JA 4I39A 5J3WA 1S4SA 1XJ4A 3HUNA 1HTZA 3MQ0A 1W5DA 4E6WA 1D06A 2W27A 1PW1A 4Q0HA 2GJ3A 4G3WA 2QHKA 4LRXC 4OQIA 3M6BA 5AJGA 1FILA 2ZMFA 1WYBA 4GNUA 5FA7A 5CEDA 1YLPA 3F1OB 4DE3A 2ZL1B 3L7HA 5HWVA 4II7A 2OWHA 1TD5A 3MXQA 5KSHA 1VETA 1K4FA 1STZA 4MN7A 4ETZA 3EQUA
chains in the Genus database with same CATH topology
2CC1A 1K57A 2UWXA 2ZC4B 3DW0A 5E2HA 4DXCA 1BLCA 4CJNA 5DF7A 3S22A 3BYDA 3VP1A 2XK1A 4E3MA 1FR1A 4EQIA 2WK0A 1FCNA 3TOIA 1DJBA 3BFDA 3PBOA 4OOMA 3ZG8B 5FQKA 3MKEA 1XX2A 2XFTA 3GSGA 4U0XA 3C5AA 3VMAA 1HZOA 4PM5A 2HP9A 4EUZA 1K4EA 4WZ5C 2WGWB 2EX6A 2Y2PA 4WMCD 3PBRA 5FI6A 5HAIA 5F1FA 1O07A 2ZC3B 5FQIA 1Q2QA 5A92A 5DF8A 1GHIA 4QB8A 3HVFA 3N4IA 4DF6A 3G31A 3HLBA 3VOYA 4KZ8A 2ZMAA 3NI9A 4KZBA 5AQ9A 4LENA 4DRTA 2Y91A 2Y59A 2ZLYA 3FZCA 4GDNA 4ZJ1A 1ZG6A 3D4FA 2I72A 5EE8A 4X68A 1IKIA 5FAPA 4GB7A 5FASA 4LCMA 1K56D 3G2YA 4S2MA 4MEZA 3DTMA 1EROA 1O7EA 3O3VA 3ISGA 4N1XA 1JVJA 3RJUA 3PAGA 3C4OA 1W7FA 4KZ7A 4E3JA 2JE5A 4KQRA 4B4ZA 4S2IA 4XXRA 5CRFA 1BUEA 2HDRA 3NBLA 1FSWA 1PIOA 2HDSA 1YMSA 5A91A 4OPZA 2ZD8A 2WGWA 2Y2IA 4HEFA 4LV0A 3N6IA 2ZC3A 2WYXA 1E25A 1TDGA 1RCJA 2Y2KA 3MZEA 5HARA 1GHMA 3ZFZA 4EBLA 1YQSA 2Z2LA 3M6HA 3OPRA 3N7WA 4QY6A 4E6XA 5FQQA 1K55C 1Y54A 2WGVA 1NJ4A 4PMAA 2ZQDA 4R3JA 2XGNA 1KVLA 4N1HA 1E4DA 5D3OA 4DE2A 4PM9A 3UPOA 4DDYA 3CJMA 1BT5A 2XLNA 3LO7A 4FH4A 4X6TA 4X53A 4P85A 3AGFA 4HESA 2PU2A 4R4RA 3W4PA 2R9XA 3MXRA 4GD8A 1ESUA 3N8RA 2WKHA 1SDEA 2XD1A 3BM6A 3FV7A 3IXBA 3GR2A 4OLGA 1ZKJA 1L0DA 5FATA 5HFOA 1BLHA 2H0TA 5EVID 1ONHA 3C7UA 2Z2LB 3E2LA 3SH7A 1K54C 4JXSA 3UE0A 3S1YA 3FKWA 4KENB 4YINA 3A3FA 4ZJ3A 5DTSA 2QMIA 2G2WA 1GCEA 1XKZA 4MNRA 1CI9A 2FFFB 4Q8IA 1MWSA 4S2NA 4OOLA 2HP5A 1LL9A 1XPBA 4GN2A 5KMWA 4KZ9A 3Q7VB 3IXDA 5DTKA 4FH2A 3ZG5A 4RX2A 1KE0A 1G6AA 4QHCA 5EECA 1I2SA 2Y2OA 1HVBA 4KZ3A 5FQMA 1IYQA 3VP3A 3UPNA 1LI0A 1ALQA 3BECA 5A93A 2ZM0A 2WUQA 3LY3A 4F94A 1C3BA 3HBRA 3OCLA 4LV3A 3GMWA 1SHVA 1KE4A 1YLTA 1K56A 1KDSA 2EX8A 1QMEA 3BFFA 3IWQA 1BLSA 3MZDA 1I2WA 4OP8A 3SS3A 3A3IA 4OH0A 5M19A 3QNCA 4JPMA 4WELA 1N4OA 5M1AA 3HLGA 1EWZA 2BLSA 2EFXA 4EWFA 4H8RA 1S6RA 1QMFA 4E3KA 5CERA 5CTMA 1IEMA 1VM1A 4DXBA 3Q7VA 3DWZA 3BFGA 5GLAA 1KGFA 5GL9A 3GVBA 1ES2A 2OLVA 4EBPA 1CEGA 1BTLA 4A5RA 4PM6A 4OLDA 4B88A 3RXWA 3VSLA 3AGEA 4QY5A 1GHPA 1YMXA 5EOEA 1EI5A 3G4PA 5E43A 2R9WA 4BL3A 2RL3A 1E3UA 1K57C 1RGYA 2IWCA 3ITBA 3VP0A 1DJAA 3HLEA 4IVIA 3V3RA 4JXVA 1MWTA 1MKIA 4GKUA 3FWLA 3SS4A 3PAEA 2ZQ7A 3UDXA 3A3EA 2V1ZA 3WS4A 5CEBA 3C7VA 4R23A 1YLYA 3UNWA 4JLFA 5G18A 5J8XA 4OPRA 4UAAA 3M2JA 3IF6C 5HW3A 2ZC5B 3ZVWA 3N8LA 4BENA 1YM1A 1TDLA 2ZQ9A 3GQZA 4K0XA 4Y7PA 3VFHA 2VGKA 4R0QA 1LL5A 3MKFA 1W79A 4D2OA 1M40A 2J9OA 3NCKA 3FYZA 4UHUA 2PBYA 4ZTKA 5FDHA 3WRZA 2IWDA 3CMZA 3W4OA 2JBFA 2XR0A 5F83A 3V3SA 2XEPA 3ZG7B 4Z9QA 1K25A 3G2ZA 1YLZA 2ZQAA 4WBGA 3V39A 4S2JA 3ZG9B 1L2SA 3OZHA 1KE3A 3IWOA 2ZQ8A 5GHYA 1W8YA 3Q7ZA 1H8YA 3O86A 2Q9NA 4N9KA 3MBZA 3BFEA 3PTEA 4ZDXA 5EPHA 3LY4A 4QD4A 3ZNTA 4RX3A 2WAEA 3TG9A 1IKGA 2Y2JA 3Q82A 3N8SA 1H8ZA 4JXWA 1IYSA 3ITAA 5AQAA 3VSKA 4KQOA 1WYCA 2EXAA 4MBFA 4X69A 4OKPA 4E3OA 3IF5A 2EX9A 3BLSA 4KZ6A 1JWZA 3G30A 4IEDA 1YLWA 3BLMA 5AQBA 5U47A 5HL1A 3CG5A 2WAFA 2XQZA 4JBFA 1Q2PA 4C75A 5HAQA 1CK3A 4KZAA 2WGIA 2ZC7A 5FQJA 1MWRA 5F82A 4BQMA 1BSGA 1GA0A 3NIAA 1YLJA 1PWGA 1L0GA 1NZOA 3UO9A 2C5WB 2DNSA 3LEZA 1BLPA 4C3QA 4RVAA 4S2NC 5CHUA 2IWBA 4OVDA 1ONGA 5AQ7A 5TR7A 4U3TA 3UE3A 2J7VA 4BD0A 1VQQA 4NK3A 4EV4A 2WKIA 1LHYA 5E2FA 3NDEA 2EFUA 4LV2A 2DRWA 4JF4A 4KZ4A 4X56A 1OMEA 2X01A 3HL9A 3Q81A 4S2KA 1NXYA 1ESIA 5HAPA 3WS2A 5KSCA 3IWIA 4KZ5A 3VP2A 5JYOA 5JYPA 1NYYA 4KG5A 2Y2QA 2VGJA 1BULA 2JC7A 4P87A 1LI9A 4CPKA 5GLBA 5L2FA 4L0LA 3DWKA 1KGEA 2Y4AA 5CTNA 5E2EA 1NYMA 4JKTA 4JF5A 2Y2GA 1IYPA 3HLFA 3HREA 5CGXA 1SDNA 2P74A 1MPLA 1NY0A 3IT9A 3UY6A 4GDBA 5F1GA 2GDNA 4PPRA 3NDGA 4N92A 4WEJA 4JXGA 3AGDA 4S2PA 3ZNYA 2A49A 1N9BA 3VOZA 5KZHA 2OV5A 3NC8A 4DE0A 5FSRA 3ZVTA 5FI2A 3C4PA 1ES4A 1S0WA 4OP5A 3ZCZA 1AXBA 1YT4A 4Y0OA 1PW8A 3ZG0A 3I7JA 4DKIA 3P09A 2ZM2A 3UDFA 5TFQA 2BG1A 4IBXA 2H5SA 4LCLA 1KDWA 1FOFA 1K6SA 4GD6A 4KQQA 1IYOA 2ZJ9A 1PZPA 1XA1A 3TSGA 5EVIB 3IH9A 4RA7A 2XFSA 3IXGA 5CHJA 4E3LA 4YFMA 2PU4A 4OOYA 2V20A 3E2KA 1PWCA 3V50A 5A90A 1ZG4A 3GV9A 3Q07A 4R3BA 4OQ0A 4IBRA 3W8KA 2EX2A 2Q9MA 3Q1FA 3OPHA 3LCEA 4WYYA 4WZ5A 4ZJ2A 3M2KA 1U60A 3IH8A 3V5MA 5E2GA 4C6YA 1RGZA 3GTCA 1I5QA 1TEMA 4NETA 3UDIA 4WMCA 3MFDA 4UA9A 4WEKA 1ERQA 1DY6A 2EXBA 1CEFA 2Y2HA 3HUMA 3A3DA 4FSFA 5FI7A 4B4XA 3W4QA 1W8QA 5DTTA 4PM7A 2QPNA 3OCNA 1FR6A 4MBKA 2H0YA 3IF6A 2X71A 4BLMA 3WS0A 2XD5A 4IVKA 2Z2MB 1JTGA 1DJCA 4XUZA 2XH9A 5EOOA 1FCOA 3ZDJA 5CECA 4P6BA 3UE1A 5EVIA 1PI5A 3SS5A 4QU3A 4E3IA 2J8YA 5CXWA 1L0FA 1WE4A 3EQVA 3VFFA 1JTDA 2P9VB 3BRMA 4N9LA 1Z6FA 4OONA 3HLDA 5EVIC 3FKVA 4HBUA 1MXOA 5FQ9A 3O87A 3UPPA 2XDMA 3QHYA 1PYYA 2H10A 1MWUA 4BD1A 3PBTA 5CGSA 1GA9A 1ES3A 3ZHHA 3NY4A 3G34A 1L0EA 1KGGA 2A3UA 3CZDA 1XXMA 4GOGA 1E3UD 3SOIA 4ZAMA 4DE1A 5GHZA 4PM8A 1SCWA 5EUAA 1XP4A 4S2LA 2HPBA 5I94A 5DVAA 3RXXA 5GLDA 4JF6A 2Y2LA 1RP5A 2Y2MA 3IF6B 3PBNA 3S4XA 2ZQCA 4KG6A 2Z2MA 1G68A 2ZC6B 1J9MA 1MBLA 3WWXA 2E8IA 3HLCA 1PI4A 2P9VA 4WM9A 1K6RA 1CI8A 2DCFA 2HP6A 3HUOA 2C6WB 5GHXA 2WADA 1SKFA 4S2OA 4UA7A 3A3JA 1JWPA 1XGJA 2RCXA 2ZM8A 4K0WA 4LV1A 2HDUA 5TGFA 3WRTA 3OPLA 4R4SA 1NZUA 1XGIA 4U0TA 4ZBEA 1ES5A 5FAQA 1PZOA 2WKEA 3PBQA 4X55A 3MXSA 4WZ4A 1K55A 3JYIA 5GLCA 2XF3A 1JWVA 3OC2A 4R1GA 4Y0UA 4K91A 1NRFA 4HBTA 4O7DA 4UA6A 2JCHA 4XUXA 2QZ6A 5HX9A 4BJPA 4E3NA 4FD8A 1FQGA 3VP4A 1M6KA 4OPQA 4Y0TA 1KVMA 4ID4A 3IHAA 4GZBA 1XA7A 3HUNA 2OLUA 3WS5A 1HTZA 1IELA 1W5DA 3O88A 3SH9A 4E6WA 1ZC2A 1PW1A 3ZGAB 3IQAA 1K54A 2WZXA 4RYEA 2OSUA 3GRJA 2Y55A 3BFCA 5CHMA 4M3KA 5CGWA 3UN7A 2ZC4A 5FAOA 4FCFA 3HLWA 1FCMA 4OQGA 3G32A 3M6BA 4OQIA 2G2UA 4QJGA 1BZAA 1HD8A 1MY8A 3B3XA 4BL2A 5IHVA 3IXHA 1WYBA 4GNUA 4EBNA 2Y2NA 2X02A 5EVLA 5M18A 5FA7A 5CEDA 4OQHA 1YLPA 4DE3A 2WZZA 3MZFA 5BOHA 3SH8A 1ERMA 3BEBA 4DDSA 2B5RA 4KG2A 3PBSA 4P0MA 1H5XA 1TVFA 2J9PA 1PWDA 2FFYA 1K38A 3P98A 3G35A 1FSYA 3OPPA 4MLLA 4OPYA 5KSHA 2V2FF 1LLBA 1K4FA 4MBHA 2HDQA 3IHBA 5DF9A 3QNBA 3WS1A 3EQUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CC1 A;  1K57 A;  2UWX A;  2ZC4 B;  3DW0 A;  5E2H A;  4DXC A;  1BLC A;  4CJN A;  5DF7 A;  3S22 A;  3BYD A;  3VP1 A;  2XK1 A;  4E3M A;  1FR1 A;  4EQI A;  2WK0 A;  1FCN A;  3TOI A;  1DJB A;  3BFD A;  3PBO A;  4OOM A;  3ZG8 B;  5FQK A;  3MKE A;  1XX2 A;  2XFT A;  3GSG A;  4U0X A;  3C5A A;  3VMA A;  1HZO A;  4PM5 A;  2HP9 A;  4EUZ A;  1K4E A;  4WZ5 C;  2WGW B;  2EX6 A;  2Y2P A;  4WMC D;  3PBR A;  5FI6 A;  5HAI A;  5F1F A;  1O07 A;  2ZC3 B;  5FQI A;  1Q2Q A;  5A92 A;  5DF8 A;  1GHI A;  4QB8 A;  3HVF A;  3N4I A;  4DF6 A;  3G31 A;  3HLB A;  3VOY A;  4KZ8 A;  2ZMA A;  3NI9 A;  4KZB A;  5AQ9 A;  4LEN A;  4DRT A;  2Y91 A;  2Y59 A;  2ZLY A;  3FZC A;  4GDN A;  4ZJ1 A;  1ZG6 A;  3D4F A;  2I72 A;  5EE8 A;  4X68 A;  1IKI A;  5FAP A;  4GB7 A;  5FAS A;  4LCM A;  1K56 D;  3G2Y A;  4S2M A;  4MEZ A;  3DTM A;  1ERO A;  1O7E A;  3O3V A;  3ISG A;  4N1X A;  1JVJ A;  3RJU A;  3PAG A;  3C4O A;  1W7F A;  4KZ7 A;  4E3J A;  2JE5 A;  4KQR A;  4B4Z A;  4S2I A;  4XXR A;  5CRF A;  1BUE A;  2HDR A;  3NBL A;  1FSW A;  1PIO A;  2HDS A;  1YMS A;  5A91 A;  4OPZ A;  2ZD8 A;  2WGW A;  2Y2I A;  4HEF A;  4LV0 A;  3N6I A;  2ZC3 A;  2WYX A;  1E25 A;  1TDG A;  1RCJ A;  2Y2K A;  3MZE A;  5HAR A;  1GHM A;  3ZFZ A;  4EBL A;  1YQS A;  2Z2L A;  3M6H A;  3OPR A;  3N7W A;  4QY6 A;  4E6X A;  5FQQ A;  1K55 C;  1Y54 A;  2WGV A;  1NJ4 A;  4PMA A;  2ZQD A;  4R3J A;  2XGN A;  1KVL A;  4N1H A;  1E4D A;  5D3O A;  4DE2 A;  4PM9 A;  3UPO A;  4DDY A;  3CJM A;  1BT5 A;  2XLN A;  3LO7 A;  4FH4 A;  4X6T A;  4X53 A;  4P85 A;  3AGF A;  4HES A;  2PU2 A;  4R4R A;  3W4P A;  2R9X A;  3MXR A;  4GD8 A;  1ESU A;  3N8R A;  2WKH A;  1SDE A;  2XD1 A;  3BM6 A;  3FV7 A;  3IXB A;  3GR2 A;  4OLG A;  1ZKJ A;  1L0D A;  5FAT A;  5HFO A;  1BLH A;  2H0T A;  5EVI D;  1ONH A;  3C7U A;  2Z2L B;  3E2L A;  3SH7 A;  1K54 C;  4JXS A;  3UE0 A;  3S1Y A;  3FKW A;  4KEN B;  4YIN A;  3A3F A;  4ZJ3 A;  5DTS A;  2QMI A;  2G2W A;  1GCE A;  1XKZ A;  4MNR A;  1CI9 A;  2FFF B;  4Q8I A;  1MWS A;  4S2N A;  4OOL A;  2HP5 A;  1LL9 A;  1XPB A;  4GN2 A;  5KMW A;  4KZ9 A;  3Q7V B;  3IXD A;  5DTK A;  4FH2 A;  3ZG5 A;  4RX2 A;  1KE0 A;  1G6A A;  4QHC A;  5EEC A;  1I2S A;  2Y2O A;  1HVB A;  4KZ3 A;  5FQM A;  1IYQ A;  3VP3 A;  3UPN A;  1LI0 A;  1ALQ A;  3BEC A;  5A93 A;  2ZM0 A;  2WUQ A;  3LY3 A;  4F94 A;  1C3B A;  3HBR A;  3OCL A;  4LV3 A;  3GMW A;  1SHV A;  1KE4 A;  1YLT A;  1K56 A;  1KDS A;  2EX8 A;  1QME A;  3BFF A;  3IWQ A;  1BLS A;  3MZD A;  1I2W A;  4OP8 A;  3SS3 A;  3A3I A;  4OH0 A;  5M19 A;  3QNC A;  4JPM A;  4WEL A;  1N4O A;  5M1A A;  3HLG A;  1EWZ A;  2BLS A;  2EFX A;  4EWF A;  4H8R A;  1S6R A;  1QMF A;  4E3K A;  5CER A;  5CTM A;  1IEM A;  1VM1 A;  4DXB A;  3Q7V A;  3DWZ A;  3BFG A;  5GLA A;  1KGF A;  5GL9 A;  3GVB A;  1ES2 A;  2OLV A;  4EBP A;  1CEG A;  1BTL A;  4A5R A;  4PM6 A;  4OLD A;  4B88 A;  3RXW A;  3VSL A;  3AGE A;  4QY5 A;  1GHP A;  1YMX A;  5EOE A;  1EI5 A;  3G4P A;  5E43 A;  2R9W A;  4BL3 A;  2RL3 A;  1E3U A;  1K57 C;  1RGY A;  2IWC A;  3ITB A;  3VP0 A;  1DJA A;  3HLE A;  4IVI A;  3V3R A;  4JXV A;  1MWT A;  1MKI A;  4GKU A;  3FWL A;  3SS4 A;  3PAE A;  2ZQ7 A;  3UDX A;  3A3E A;  2V1Z A;  3WS4 A;  5CEB A;  3C7V A;  4R23 A;  1YLY A;  3UNW A;  4JLF A;  5G18 A;  5J8X A;  4OPR A;  4UAA A;  3M2J A;  3IF6 C;  5HW3 A;  2ZC5 B;  3ZVW A;  3N8L A;  4BEN A;  1YM1 A;  1TDL A;  2ZQ9 A;  3GQZ A;  4K0X A;  4Y7P A;  3VFH A;  2VGK A;  4R0Q A;  1LL5 A;  3MKF A;  1W79 A;  4D2O A;  1M40 A;  2J9O A;  3NCK A;  3FYZ A;  4UHU A;  2PBY A;  4ZTK A;  5FDH A;  3WRZ A;  2IWD A;  3CMZ A;  3W4O A;  2JBF A;  2XR0 A;  5F83 A;  3V3S A;  2XEP A;  3ZG7 B;  4Z9Q A;  1K25 A;  3G2Z A;  1YLZ A;  2ZQA A;  4WBG A;  3V39 A;  4S2J A;  3ZG9 B;  1L2S A;  3OZH A;  1KE3 A;  3IWO A;  2ZQ8 A;  5GHY A;  1W8Y A;  3Q7Z A;  1H8Y A;  3O86 A;  2Q9N A;  4N9K A;  3MBZ A;  3BFE A;  3PTE A;  4ZDX A;  5EPH A;  3LY4 A;  4QD4 A;  3ZNT A;  4RX3 A;  2WAE A;  3TG9 A;  1IKG A;  2Y2J A;  3Q82 A;  3N8S A;  1H8Z A;  4JXW A;  1IYS A;  3ITA A;  5AQA A;  3VSK A;  4KQO A;  1WYC A;  2EXA A;  4MBF A;  4X69 A;  4OKP A;  4E3O A;  3IF5 A;  2EX9 A;  3BLS A;  4KZ6 A;  1JWZ A;  3G30 A;  4IED A;  1YLW A;  3BLM A;  5AQB A;  5U47 A;  5HL1 A;  3CG5 A;  2WAF A;  2XQZ A;  4JBF A;  1Q2P A;  4C75 A;  5HAQ A;  1CK3 A;  4KZA A;  2WGI A;  2ZC7 A;  5FQJ A;  1MWR A;  5F82 A;  4BQM A;  1BSG A;  1GA0 A;  3NIA A;  1YLJ A;  1PWG A;  1L0G A;  1NZO A;  3UO9 A;  2C5W B;  2DNS A;  3LEZ A;  1BLP A;  4C3Q A;  4RVA A;  4S2N C;  5CHU A;  2IWB A;  4OVD A;  1ONG A;  5AQ7 A;  5TR7 A;  4U3T A;  3UE3 A;  2J7V A;  4BD0 A;  1VQQ A;  4NK3 A;  4EV4 A;  2WKI A;  1LHY A;  5E2F A;  3NDE A;  2EFU A;  4LV2 A;  2DRW A;  4JF4 A;  4KZ4 A;  4X56 A;  1OME A;  2X01 A;  3HL9 A;  3Q81 A;  4S2K A;  1NXY A;  1ESI A;  5HAP A;  3WS2 A;  5KSC A;  3IWI A;  4KZ5 A;  3VP2 A;  5JYO A;  5JYP A;  1NYY A;  4KG5 A;  2Y2Q A;  2VGJ A;  1BUL A;  2JC7 A;  4P87 A;  1LI9 A;  4CPK A;  5GLB A;  5L2F A;  4L0L A;  3DWK A;  1KGE A;  2Y4A A;  5CTN A;  5E2E A;  1NYM A;  4JKT A;  4JF5 A;  2Y2G A;  1IYP A;  3HLF A;  3HRE A;  5CGX A;  1SDN A;  2P74 A;  1MPL A;  1NY0 A;  3IT9 A;  3UY6 A;  4GDB A;  5F1G A;  2GDN A;  4PPR A;  3NDG A;  4N92 A;  4WEJ A;  4JXG A;  3AGD A;  4S2P A;  3ZNY A;  2A49 A;  1N9B A;  3VOZ A;  5KZH A;  2OV5 A;  3NC8 A;  4DE0 A;  5FSR A;  3ZVT A;  5FI2 A;  3C4P A;  1ES4 A;  1S0W A;  4OP5 A;  3ZCZ A;  1AXB A;  1YT4 A;  4Y0O A;  1PW8 A;  3ZG0 A;  3I7J A;  4DKI A;  3P09 A;  2ZM2 A;  3UDF A;  5TFQ A;  2BG1 A;  4IBX A;  2H5S A;  4LCL A;  1KDW A;  1FOF A;  1K6S A;  4GD6 A;  4KQQ A;  1IYO A;  2ZJ9 A;  1PZP A;  1XA1 A;  3TSG A;  5EVI B;  3IH9 A;  4RA7 A;  2XFS A;  3IXG A;  5CHJ A;  4E3L A;  4YFM A;  2PU4 A;  4OOY A;  2V20 A;  3E2K A;  1PWC A;  3V50 A;  5A90 A;  1ZG4 A;  3GV9 A;  3Q07 A;  4R3B A;  4OQ0 A;  4IBR A;  3W8K A;  2EX2 A;  2Q9M A;  3Q1F A;  3OPH A;  3LCE A;  4WYY A;  4WZ5 A;  4ZJ2 A;  3M2K A;  1U60 A;  3IH8 A;  3V5M A;  5E2G A;  4C6Y A;  1RGZ A;  3GTC A;  1I5Q A;  1TEM A;  4NET A;  3UDI A;  4WMC A;  3MFD A;  4UA9 A;  4WEK A;  1ERQ A;  1DY6 A;  2EXB A;  1CEF A;  2Y2H A;  3HUM A;  3A3D A;  4FSF A;  5FI7 A;  4B4X A;  3W4Q A;  1W8Q A;  5DTT A;  4PM7 A;  2QPN A;  3OCN A;  1FR6 A;  4MBK A;  2H0Y A;  3IF6 A;  2X71 A;  4BLM A;  3WS0 A;  2XD5 A;  4IVK A;  2Z2M B;  1JTG A;  1DJC A;  4XUZ A;  2XH9 A;  5EOO A;  1FCO A;  3ZDJ A;  5CEC A;  4P6B A;  3UE1 A;  5EVI A;  1PI5 A;  3SS5 A;  4QU3 A;  4E3I A;  2J8Y A;  5CXW A;  1L0F A;  1WE4 A;  3EQV A;  3VFF A;  1JTD A;  2P9V B;  3BRM A;  4N9L A;  1Z6F A;  4OON A;  3HLD A;  5EVI C;  3FKV A;  4HBU A;  1MXO A;  5FQ9 A;  3O87 A;  3UPP A;  2XDM A;  3QHY A;  1PYY A;  2H10 A;  1MWU A;  4BD1 A;  3PBT A;  5CGS A;  1GA9 A;  1ES3 A;  3ZHH A;  3NY4 A;  3G34 A;  1L0E A;  1KGG A;  2A3U A;  3CZD A;  1XXM A;  4GOG A;  1E3U D;  3SOI A;  4ZAM A;  4DE1 A;  5GHZ A;  4PM8 A;  1SCW A;  5EUA A;  1XP4 A;  4S2L A;  2HPB A;  5I94 A;  5DVA A;  3RXX A;  5GLD A;  4JF6 A;  2Y2L A;  1RP5 A;  2Y2M A;  3IF6 B;  3PBN A;  3S4X A;  2ZQC A;  4KG6 A;  2Z2M A;  1G68 A;  2ZC6 B;  1J9M A;  1MBL A;  3WWX A;  2E8I A;  3HLC A;  1PI4 A;  2P9V A;  4WM9 A;  1K6R A;  1CI8 A;  2DCF A;  2HP6 A;  3HUO A;  2C6W B;  5GHX A;  2WAD A;  1SKF A;  4S2O A;  4UA7 A;  3A3J A;  1JWP A;  1XGJ A;  2RCX A;  2ZM8 A;  4K0W A;  4LV1 A;  2HDU A;  5TGF A;  3WRT A;  3OPL A;  4R4S A;  1NZU A;  1XGI A;  4U0T A;  4ZBE A;  1ES5 A;  5FAQ A;  1PZO A;  2WKE A;  3PBQ A;  4X55 A;  3MXS A;  4WZ4 A;  1K55 A;  3JYI A;  5GLC A;  2XF3 A;  1JWV A;  3OC2 A;  4R1G A;  4Y0U A;  4K91 A;  1NRF A;  4HBT A;  4O7D A;  4UA6 A;  2JCH A;  4XUX A;  2QZ6 A;  5HX9 A;  4BJP A;  4E3N A;  4FD8 A;  1FQG A;  3VP4 A;  1M6K A;  4OPQ A;  4Y0T A;  1KVM A;  4ID4 A;  3IHA A;  4GZB A;  1XA7 A;  3HUN A;  2OLU A;  3WS5 A;  1HTZ A;  1IEL A;  1W5D A;  3O88 A;  3SH9 A;  4E6W A;  1ZC2 A;  1PW1 A;  3ZGA B;  3IQA A;  1K54 A;  2WZX A;  4RYE A;  2OSU A;  3GRJ A;  2Y55 A;  3BFC A;  5CHM A;  4M3K A;  5CGW A;  3UN7 A;  2ZC4 A;  5FAO A;  4FCF A;  3HLW A;  1FCM A;  4OQG A;  3G32 A;  3M6B A;  4OQI A;  2G2U A;  4QJG A;  1BZA A;  1HD8 A;  1MY8 A;  3B3X A;  4BL2 A;  5IHV A;  3IXH A;  1WYB A;  4GNU A;  4EBN A;  2Y2N A;  2X02 A;  5EVL A;  5M18 A;  5FA7 A;  5CED A;  4OQH A;  1YLP A;  4DE3 A;  2WZZ A;  3MZF A;  5BOH A;  3SH8 A;  1ERM A;  3BEB A;  4DDS A;  2B5R A;  4KG2 A;  3PBS A;  4P0M A;  1H5X A;  1TVF A;  2J9P A;  1PWD A;  2FFY A;  1K38 A;  3P98 A;  3G35 A;  1FSY A;  3OPP A;  4MLL A;  4OPY A;  5KSH A;  2V2F F;  1LLB A;  1K4F A;  4MBH A;  2HDQ A;  3IHB A;  5DF9 A;  3QNB A;  3WS1 A;  3EQU A; 
#chains in the Genus database with same CATH topology
 3BY8 A;  4R38 A;  3DW0 A;  5HZH A;  4CJN A;  3KSI A;  4EQI A;  2O99 A;  3GSG A;  5I5L A;  5F6A A;  2WGW B;  5F1F A;  3S7N A;  2ZC3 B;  3CUE A;  4L9F A;  1TS7 A;  5A92 A;  5DF8 A;  4QB8 A;  3N4I A;  1LSX A;  3F1P B;  1XFQ A;  3LIA A;  3NI9 A;  2L0W A;  1VET B;  2Y59 A;  3FZC A;  3D4F A;  3L9K A;  5FAP A;  4Y2F A;  4S2M A;  1G5U A;  4MEZ A;  3QP2 A;  1O7E A;  3ISG A;  2W3E A;  3R7W B;  1T1C A;  4KZ7 A;  1S1Y A;  4KQR A;  4S2I A;  2HDR A;  4F3L B;  1FIK A;  2HDS A;  4PHT A;  2WGW A;  4LV0 A;  3N6I A;  1SZV A;  3UB7 A;  1F98 A;  2WYX A;  1E25 A;  3E0Y A;  5AVF A;  2OWJ A;  2K7S A;  1GSW A;  4EBL A;  1YQS A;  3M6H A;  1Y54 A;  4R3J A;  4PMA A;  2W1T A;  2ZQD A;  3T50 A;  4DJ2 A;  4EEU A;  2V1B A;  3B33 A;  3MR0 A;  3CJM A;  3NHQ A;  3T1Q B;  4CLC A;  1NWZ A;  4MDZ A;  3PR6 A;  1H8M A;  2VGL S;  2R9X A;  3MXR A;  2M7V A;  1ESU A;  2WKH A;  1SDE A;  4Q0I A;  3MJQ A;  1L0D A;  5EVI D;  1ONH A;  3IS2 B;  1ZTU A;  3FKW A;  1H0M A;  4ZJ3 A;  5DTS A;  2QMI A;  3NOP C;  1XKZ A;  4Q8I A;  3D3O A;  5KMW A;  1T1A A;  4RX2 A;  1G6A A;  5IS1 A;  3VP3 A;  4I5S A;  5AVE A;  2IA2 A;  2ZM0 A;  3DBA A;  4P6Z M;  5HDD A;  3HBR A;  3V67 A;  3IS2 A;  1SHV A;  3LFV A;  4OP8 A;  4GW9 A;  3A3I A;  3BQA A;  4WEL A;  4EWF A;  2EFX A;  3PXP A;  2HJE A;  1QMF A;  4MMN A;  5CTM A;  4DXB A;  1H3Q A;  4DJ3 A;  5GLA A;  4MN5 A;  2QWS A;  4NG2 A;  1CEG A;  1BTL A;  4WUJ A;  4A5R A;  4OLD A;  4B88 A;  3AGE A;  1V9Y A;  2J3T D;  5E43 A;  1K57 C;  2IWC A;  3ITB A;  4NXF A;  1MWT A;  1MKI A;  5DKK A;  2JHE A;  3FWL A;  1YSQ A;  3UDX A;  3WS4 A;  2V1Z A;  5TBM A;  1YLY A;  5J8X A;  4UAA A;  3M2J A;  5HW3 A;  2ZC5 B;  3QP6 A;  4Y7P A;  1LL5 A;  3MKF A;  2PBY A;  2VJW A;  4I3I A;  3W4O A;  2XEP A;  3ZG7 B;  5J7E A;  1K25 A;  3G2Z A;  4WBG A;  3H9W A;  2DMW A;  1KE3 A;  3IWO A;  4N9K A;  3MBZ A;  4ZDX A;  5EPH A;  5TBM B;  2WAE A;  3TG9 A;  1P0Z A;  3N8S A;  1H8Z A;  4UQI M;  1WYC A;  2HJ9 C;  3IF5 A;  3UME A;  3IX8 A;  3BLM A;  5HDC A;  2ZC7 A;  5DKL A;  5FQJ A;  3LI9 A;  5F82 A;  4BQM A;  4UQI S;  2V8F A;  3NIA A;  1PWG A;  4R6L A;  3UO9 A;  2M1C A;  5CHU A;  4OVD A;  3LID A;  2CMN A;  4BBT A;  4CQH A;  2EFU A;  2PAV P;  1G28 A;  1OTI A;  4KZ4 A;  4X56 A;  3HL9 A;  4S2K A;  1NXY A;  5HAP A;  5KSC A;  3IWI A;  2PD7 A;  2ZBB A;  1BYW A;  1LI9 A;  4ME4 A;  2Y8H A;  5GLB A;  2Y4A A;  2V8C A;  4RQ9 A;  3LR0 A;  3NEC A;  3OLO A;  4Y5F A;  3HRE A;  1SDN A;  1MPL A;  4GDB A;  5L07 A;  3ZNY A;  1N9L A;  5KZH A;  1UGU A;  2OV5 A;  5FSR A;  3JVV A;  4Y0O A;  3ZG0 A;  4DKI A;  2QJ7 A;  3CPT A;  4HI4 A;  3P09 A;  4HH2 A;  5TFQ A;  2BG1 A;  4LCL A;  3LGO A;  1FOF A;  4XT2 A;  4EU0 A;  1IYO A;  2ZJ9 A;  5DJT A;  4YFM A;  3T1S A;  3IBJ A;  1ZG4 A;  3Q07 A;  2EX2 A;  3Q1F A;  2PT7 A;  4WYY A;  3M2K A;  3UDI A;  4DN0 A;  1ERQ A;  4FSF A;  1CEF A;  3A3D A;  4HJ6 A;  3W4Q A;  2QPN A;  1FR6 A;  1XJ2 A;  2R78 A;  2X71 A;  4IVK A;  2Z2M B;  1JTG A;  5EOO A;  3ZDJ A;  5IU1 A;  3UE1 A;  4D60 A;  2J8Y A;  1L0F A;  1WE4 A;  1JTD A;  2P9V B;  4N9L A;  1Z6F A;  4HBU A;  4GHI B;  3H82 B;  4G3K A;  5CGS A;  1XJ3 A;  3G34 A;  4MCW A;  3MF0 A;  2A3U A;  1XXM A;  2I9V A;  4Y3I A;  4M4X A;  3E98 A;  3HCY A;  2M7U A;  5DVA A;  4JF6 A;  3PBN A;  3IF6 B;  3S4X A;  1T18 A;  2E8I A;  3ULF A;  3VE3 A;  3HUO A;  1SKF A;  2VK3 A;  2HDU A;  4QWO A;  4U0T A;  3NUL A;  2HGV A;  3CLO A;  3JYI A;  3LI8 A;  1JWV A;  5HWW A;  4K91 A;  4UA6 A;  2JCH A;  2QZ6 A;  4KUO A;  3FC7 A;  3F1O A;  4Y0T A;  1KVM A;  2PRF A;  4ID4 A;  1DRM A;  4O01 A;  1MKM A;  4GZB A;  3UE6 A;  3IQA A;  3LR5 A;  2O9A A;  5CHM A;  3MQO A;  5CGW A;  2ZC4 A;  4FCF A;  3HLW A;  1FCM A;  3QP4 A;  2ZOI A;  3IXH A;  2B18 A;  4EW7 A;  2Y2N A;  2X02 A;  5EVL A;  3TJZ C;  4OQH A;  1Y28 A;  1VHM A;  2WZZ A;  3MZF A;  3SH8 A;  3BEB A;  4P0M A;  3PBS A;  1H5X A;  3P98 A;  1FSY A;  4WN5 A;  2HDQ A;  3IHB A;  5CX7 A;  5DFX A;  3WS1 A;  4DXC A;  5E2H A;  2WK0 A;  1FCN A;  2JKR M;  1DJB A;  4OOM A;  3PBO A;  3ZG8 B;  2A24 A;  3C2W A;  1XX2 A;  4EUZ A;  2INW A;  4WZ5 C;  2EX6 A;  2Y2P A;  2GX5 A;  3PBR A;  5FI6 A;  1V9Z A;  5FQI A;  1Q2Q A;  3HVF A;  4GDN A;  1ZG6 A;  2W1T B;  2I72 A;  3DTM A;  1ERO A;  1AWI A;  1MZU A;  1W7F A;  3C4O A;  1J3W A;  3T4O A;  4B4Z A;  4XXR A;  3NBL A;  1PIO A;  1YMS A;  2Y2I A;  2ZC3 A;  1UWN X;  3ICY A;  1IOU A;  2Y2K A;  3BQ8 A;  5EM1 A;  1OTD A;  5FQQ A;  1NJ4 A;  4O8G A;  3E4Q A;  1T19 A;  1E4D A;  3LIF A;  4PM9 A;  5IT5 A;  4DDY A;  1CQA A;  1OTA A;  2VV8 A;  4X6T A;  4X53 A;  4P85 A;  4YNR A;  4R4R A;  2PU2 A;  4F3L A;  4GD8 A;  2GNX A;  3N8R A;  3FV7 A;  2FZ0 A;  3B47 A;  1BLH A;  2H0T A;  2GZA A;  2Z2L B;  1K54 C;  3A3F A;  4JGR A;  4LRY C;  4S2N A;  4OOL A;  2HP5 A;  1LL9 A;  4HJ4 A;  3Q7V B;  2JKT I;  3OBF A;  3K2N A;  5EEC A;  4Z1W A;  3VE4 A;  2A2L A;  4KZ3 A;  2BAS A;  3TRC A;  2WUQ A;  3W2Z A;  1OPX A;  1S4R A;  3U4L P;  4LV3 A;  3GMW A;  1YLT A;  1KDS A;  1VEU B;  3MZD A;  2V0W A;  3QNC A;  4JPM A;  2BLS A;  1S6R A;  1IEM A;  2VEA A;  2B95 A;  4WLA A;  1KGF A;  3S7P A;  3GDI A;  2O9B A;  2AVX A;  3VSL A;  3G4P A;  2R9W A;  4BL3 A;  2V1A A;  3HLE A;  4IVI A;  3V3R A;  3S7O A;  3FPW A;  4GKU A;  5F69 A;  3SS4 A;  2ZQ7 A;  1LT0 A;  4X1M A;  2ZQ9 A;  1CJF A;  3GQZ A;  4LFU A;  3T4Q A;  4D2O A;  2J9O A;  1X0O A;  2KLI A;  4EUV A;  1ACF A;  4CLC D;  3DAV A;  1YLZ A;  2ZQA A;  4NEE D;  3V39 A;  3ZG9 B;  1L2S A;  2ZQ8 A;  5GHY A;  1W8Y A;  4Y17 A;  3T4K A;  3Q7Z A;  2O0Y A;  1D1J A;  3LY4 A;  4QD4 A;  3ZNT A;  1UWP X;  3Q82 A;  3S7Q A;  2JN7 A;  1IYS A;  3VSK A;  4KQO A;  4FUW A;  4KZ6 A;  1S67 L;  5AQB A;  2WAF A;  3TW8 A;  1BSG A;  1GA0 A;  2DNS A;  3LEZ A;  3LIC A;  4NXG A;  4S2N C;  4HOI A;  1ONG A;  4L9G A;  3OOV A;  4LV2 A;  4JF4 A;  3VOL A;  2X01 A;  1OME A;  4QPR A;  2QJ5 A;  5JYO A;  3T4S A;  5FEG A;  4CPK A;  5L2F A;  4L0L A;  1KGE A;  5CTN A;  4JF5 A;  3HLF A;  2J3T C;  3IT9 A;  3EEH A;  4PPR A;  4WEJ A;  5LBR A;  2J80 A;  2L1M A;  3ZVT A;  5FI2 A;  3C4P A;  3F1N A;  1S0W A;  4OP5 A;  2ZM2 A;  4KQQ A;  1XA1 A;  3TSG A;  3IH9 A;  3KYZ A;  3IXG A;  4OOY A;  2JKR I;  4IHQ A;  3FPV A;  4OQ0 A;  3OPH A;  2JKT M;  1U60 A;  5E2G A;  1RGZ A;  3GTC A;  1I5Q A;  4NET A;  2PR6 A;  2LB9 A;  4I38 A;  1DY6 A;  3HUM A;  2Y2H A;  5FI7 A;  5FL3 A;  5DTT A;  4PM7 A;  3IF6 A;  3WS0 A;  4XT2 B;  2VLG A;  4EXO A;  2EWV A;  3P01 A;  5TJJ A;  4KQD A;  3T1X A;  3FKV A;  3O87 A;  3QHY A;  2H10 A;  4MN6 A;  1MWU A;  3KSG A;  1P97 A;  1KGG A;  3CZD A;  4GOG A;  1OTE A;  5EUA A;  4S2L A;  4BBU A;  2HPB A;  3RXX A;  5GLD A;  3IX3 A;  2Y2L A;  2Y2M A;  4KG6 A;  2P9V A;  5GHX A;  1D7E A;  3A3J A;  1JWP A;  2RCX A;  2ZM8 A;  4LV1 A;  4K0W A;  4JGQ A;  4GLQ A;  3OPL A;  3EEA A;  1XGI A;  4ZBE A;  3H82 A;  5FAQ A;  2WKE A;  4X55 A;  3PBQ A;  1K55 A;  2XSS A;  3OC2 A;  4HBT A;  4ARZ B;  4O7D A;  4FTX A;  2KDK A;  4XUX A;  1VB6 A;  3MFX A;  5HX9 A;  2EA9 A;  4FD8 A;  1FQG A;  3VP4 A;  3C8C A;  3IHA A;  1YSP A;  2OLU A;  4B93 A;  1IEL A;  2VA0 A;  3O88 A;  4NXE A;  1ZC2 A;  3O5Y A;  3ZGA B;  1K54 A;  2WZX A;  2Y55 A;  3BFC A;  4DMZ A;  3H7W A;  1OT9 A;  4NXB A;  3UN7 A;  2HF6 A;  5HL6 A;  1EW0 A;  4OQG A;  4QJG A;  2G2U A;  1HD8 A;  2PYP A;  1MY8 A;  1YAX A;  4ARZ A;  5IHV A;  2P08 A;  5G4Y A;  5M18 A;  3CIT A;  3LUQ A;  2VV7 A;  5HD3 A;  3CAX A;  1ERM A;  4DDS A;  2B5R A;  1OT6 A;  1TVF A;  3UB9 A;  2J9P A;  1PWD A;  1K38 A;  4L9E A;  3MQQ A;  3G35 A;  4MLL A;  4OPY A;  2V2F F;  2WKP A;  2P7J A;  4MBH A;  3QNB A;  2UWX A;  1BLC A;  2ZOH A;  5DF7 A;  4E3M A;  3BYD A;  4X1L A;  3VP1 A;  1FR1 A;  3PHY A;  3BFD A;  5FQK A;  4U0X A;  4WF0 A;  5HAI A;  4HQA A;  3MSH A;  1O07 A;  4WL9 A;  1GHI A;  2ZL1 A;  3G31 A;  3HLB A;  3EOI A;  4B9O A;  4KZ8 A;  2ZMA A;  4KZB A;  1TS6 A;  4LEN A;  4DRT A;  4CLC C;  4BWI A;  4ZJ1 A;  5EE8 A;  4X68 A;  1IKI A;  4GB7 A;  3G2Y A;  4HIA A;  1Z09 A;  3CUE C;  1JVJ A;  3RJU A;  3KSH A;  3PAG A;  4E3J A;  3K3C A;  2JE5 A;  1BUE A;  1FSW A;  4HEF A;  1HLU P;  5C5K A;  3NJA A;  1SKO B;  3OPR A;  3N7W A;  2WGV A;  5G4Z A;  5D3O A;  4DE2 A;  3UPO A;  3EWK A;  3C38 A;  4KUK A;  3LO7 A;  4HES A;  3W4P A;  2XD1 A;  3BM6 A;  3GR2 A;  4IJG A;  5FAT A;  3UE0 A;  3E2L A;  1VEU A;  3NOT C;  3T4L A;  2G2W A;  1GCE A;  4MNR A;  4R3A A;  1MWS A;  2PBD P;  4GN2 A;  3R4K A;  4KZ9 A;  3IXD A;  5K5B A;  1KE0 A;  5HD5 A;  1TF1 A;  1GSV A;  1HVB A;  5FQM A;  5F5Y A;  1LI0 A;  2W3G A;  3BEC A;  3LY3 A;  3QP8 A;  3RTY A;  4F94 A;  1C3B A;  5F68 A;  1KE4 A;  1K56 A;  2EX8 A;  1QME A;  3BFF A;  3SS3 A;  1I2W A;  2XRN A;  4P6Z S;  1N4O A;  4H8R A;  5HPI A;  4E3K A;  5CER A;  2MJ6 A;  3Q7V A;  3PYP A;  3DWZ A;  3BFG A;  4H6J B;  1ES2 A;  2OLV A;  4EBP A;  4LGW A;  1GHP A;  1YMX A;  2RL3 A;  1E3U A;  3CWF A;  4AFI A;  4JXV A;  4EQ1 A;  3DTI A;  4PKY G;  3A3E A;  4R23 A;  4OPR A;  3ZVW A;  3N8L A;  4BEN A;  1NLY A;  1TDL A;  1YM1 A;  4K0X A;  3VFH A;  2WKR A;  2Q0O A;  2VGK A;  4ZTK A;  3CMZ A;  3FG8 A;  2JBF A;  1H8Y A;  3BFE A;  3PTE A;  2Y2J A;  1NLZ A;  4JXW A;  3ITA A;  4X69 A;  4MBF A;  4K08 A;  1F2K A;  2EX9 A;  3BLS A;  1JWZ A;  3G30 A;  3LR4 A;  4IED A;  1YLW A;  1KOU A;  5HL1 A;  2XQZ A;  1K0K A;  2OAQ 1;  1CK3 A;  4KZA A;  2WGI A;  1N9O A;  1YLJ A;  1CF0 A;  2VKS A;  1NZO A;  1JNU A;  2VX8 A;  4Q0J A;  5MC7 A;  4GJ4 A;  4BD0 A;  1VQQ A;  4EV4 A;  3TE8 A;  2G7U A;  2DRW A;  4YWZ A;  3Q81 A;  1XJ6 A;  3WS2 A;  4KZ5 A;  5JYP A;  1NYY A;  2Y2Q A;  1BUL A;  4P87 A;  3IX4 A;  4JKT A;  1NYM A;  2Y2G A;  5CGX A;  2P74 A;  1NY0 A;  2PHY A;  5F1G A;  5L10 A;  2GDN A;  4N92 A;  3LEQ A;  1N9N A;  3AGD A;  4S2P A;  3NC8 A;  1ES4 A;  3ZCZ A;  4JGP A;  1YT4 A;  1PW8 A;  1ODV A;  3UDF A;  2W3F A;  4IBX A;  2H5S A;  4GS9 A;  2QKP A;  4GD6 A;  2V9A A;  4RA7 A;  2XFS A;  2OOL A;  4EES A;  5HWT A;  5CHJ A;  4E3L A;  3IBR A;  1PWC A;  3GV9 A;  2Q9M A;  2J3W A;  3V5M A;  4C6Y A;  3F1N B;  4I3A A;  3RFB A;  4WMC A;  3MFD A;  2W1R A;  2O9C A;  4CLC E;  2EXB A;  4B4X A;  3OCN A;  4MBK A;  2H0Y A;  3P7N A;  4GS9 B;  1A0K A;  4BLM A;  1OTB A;  2XD5 A;  1IFQ A;  1FCO A;  1MC0 A;  2HV1 A;  5CEC A;  3MMH A;  3SS5 A;  4QU3 A;  4HJ3 A;  1G6O A;  4JGO A;  4E04 A;  5HSQ A;  3HLD A;  1MXO A;  5FQ9 A;  2VZW A;  1T1B A;  2KX6 A;  4BD1 A;  1GA9 A;  1ES3 A;  3ZHH A;  2HZ5 A;  1PFL A;  1E3U D;  3SOI A;  4ZAM A;  4PM8 A;  2H28 A;  4NKP A;  1XP4 A;  3QP5 A;  4EEP A;  3BW6 A;  1RP5 A;  3UB5 P;  3C30 A;  2ZC6 B;  1L3L A;  1MBL A;  5EV0 A;  1PI4 A;  4ETX A;  1CI8 A;  2HP6 A;  5L8M A;  2WAD A;  4S2O A;  1XGJ A;  3G6O A;  5TGF A;  3H7W B;  3WRT A;  3LIB A;  4R4S A;  1ZHH B;  1PZO A;  2PD8 A;  3VV4 A;  3MXS A;  3SW1 A;  4WZ4 A;  4HNB A;  4UEY A;  2XF3 A;  4R1G A;  4Y0U A;  1DP9 A;  1TS8 A;  5FEF A;  4HP9 A;  3UMD A;  4BJP A;  3BY9 A;  4E3N A;  4OPQ A;  3RH8 B;  1XA7 A;  3WS5 A;  3SH9 A;  4RYE A;  2OSU A;  3A0R A;  2V0U A;  3GRJ A;  2ZMV A;  4M3K A;  5FAO A;  3G32 A;  1BZA A;  5HDS A;  5J4E A;  3B3X A;  4BL2 A;  2A24 B;  4BMW A;  1S66 L;  4EBN A;  5DFY A;  4GCZ A;  5BOH A;  4KG2 A;  2FFY A;  3OPP A;  3EGD C;  2NUP C;  5EM0 A;  1LLB A;  2B02 A;  4LPZ A;  2BTF P;  5DF9 A;  2CC1 A;  1K57 A;  2ZC4 B;  4EET B;  3S22 A;  2XK1 A;  3TOI A;  3MKE A;  2XFT A;  3DTK A;  3VMA A;  3C5A A;  1HZO A;  4PM5 A;  2W0N A;  2HP9 A;  1K4E A;  5DJU A;  4WMC D;  4EER A;  3HJK A;  4DF6 A;  1LSW A;  4IUH A;  3VOY A;  5AQ9 A;  3U2A A;  2Y91 A;  2ZLY A;  5FAS A;  4LCM A;  1K56 D;  3CI6 A;  3LR3 A;  3O3V A;  4N1X A;  4CLC B;  2W3D A;  5EVE A;  5CRF A;  5A91 A;  4OPZ A;  2ZD8 A;  1TDG A;  1RCJ A;  3F1P A;  3MZE A;  2WKQ A;  5HAR A;  1GHM A;  3ZFZ A;  2Z2L A;  4O0P A;  4QY6 A;  4E6X A;  1K55 C;  1PNE A;  2XGN A;  1KVL A;  4N1H A;  4X25 A;  2PR5 A;  1BT5 A;  2PDR A;  2XLN A;  3R7W A;  4FH4 A;  3MS6 A;  3AGF A;  3BJN A;  2D01 A;  3IXB A;  4OLG A;  1ZKJ A;  5HFO A;  3SZT A;  1SKO A;  3C7U A;  3SH7 A;  4HY8 A;  4JXS A;  3S1Y A;  4KEN B;  4YIN A;  4LLO B;  1CI9 A;  2FFF B;  3NOU C;  4R70 A;  1XPB A;  5DTK A;  4FH2 A;  3ZG5 A;  1TS0 A;  4H6J A;  3A0S A;  4QHC A;  1I2S A;  1DP8 A;  2Y2O A;  3LIE A;  3CHW P;  4ESP A;  1IYQ A;  3UPN A;  1ALQ A;  5A93 A;  5L09 A;  3OCL A;  2K31 A;  3DTE A;  3IWQ A;  1BLS A;  3T4T A;  4OH0 A;  5M19 A;  5M1A A;  3HLG A;  1EWZ A;  1VM1 A;  3EGX C;  1GSX A;  3UB8 A;  5GL9 A;  3GVB A;  1Y4O A;  3A0V A;  4PAU A;  4PM6 A;  3B42 A;  1YPR A;  2D02 A;  3RXW A;  4HHD A;  4QY5 A;  5EOE A;  1EI5 A;  1RGY A;  3VP0 A;  1DJA A;  3UB6 A;  4IUK A;  2EWW A;  1OJ5 A;  3PAE A;  5CEB A;  3C7V A;  3UNW A;  4JLF A;  5G18 A;  3IF6 C;  5FDS A;  2JKF A;  1F9I A;  4R0Q A;  1W79 A;  1M40 A;  2Y79 A;  3NCK A;  3KSF A;  3FYZ A;  4UHU A;  5FDH A;  3WRZ A;  2IWD A;  2XR0 A;  5F83 A;  3V3S A;  4Z9Q A;  3ZYT A;  4Y15 A;  4S2J A;  3OZH A;  3O86 A;  2Q9N A;  4HH3 A;  2Z6C A;  4RX3 A;  1IKG A;  5AQA A;  1DP6 A;  4E3O A;  2EXA A;  4OKP A;  2L4R A;  3K3D A;  5U47 A;  3CG5 A;  2YKF A;  2Z6D A;  4JBF A;  1Q2P A;  4C75 A;  5HAQ A;  1MWR A;  1P9R A;  1L0G A;  2C5W B;  2ACG A;  3E4P A;  1W63 M;  3KYQ A;  2FH5 A;  1BLP A;  4C3Q A;  4RVA A;  2JKG A;  2IWB A;  2XRO A;  1W63 Q;  5AQ7 A;  5TR7 A;  4U3T A;  3UE3 A;  5HPF A;  2J7V A;  4NK3 A;  2WKI A;  1LHY A;  5E2F A;  3NDE A;  4PKY A;  5A8B A;  1S1Z A;  5KIZ A;  3E4O A;  1ESI A;  1PRQ A;  3CPT B;  3VP2 A;  4KG5 A;  2VGJ A;  2JC7 A;  4FOF A;  3DWK A;  3D9Y A;  2QYB A;  5E2E A;  3HJI A;  2PYR A;  2W3H A;  1IYP A;  1WA9 A;  3UY6 A;  4HP4 A;  3KX0 X;  3NDG A;  4JXG A;  3T1R A;  2A49 A;  1N9B A;  3VOZ A;  2VV6 A;  3BWL A;  4DE0 A;  3D72 A;  1AXB A;  1YKD A;  2LB5 A;  3I7J A;  4Y13 A;  4I3J A;  4LRZ E;  1KDW A;  1K6S A;  1PZP A;  2OAP 1;  5EVI B;  2E8J A;  1NRJ A;  2PU4 A;  1OJG A;  2V20 A;  3E2K A;  3V50 A;  5A90 A;  1LSV A;  4R3B A;  4IBR A;  3W8K A;  3LCE A;  4WZ5 A;  4ZJ2 A;  3T12 B;  3IH8 A;  1TEM A;  4BBV A;  4WEK A;  4UA9 A;  1W8Q A;  1XFN A;  2XA7 M;  2YKH A;  4XUZ A;  1DJC A;  2KOI A;  2XH9 A;  4P6B A;  5EVI A;  1PI5 A;  4E3I A;  5CXW A;  3EQV A;  2VGL M;  3VFF A;  3BRM A;  4OON A;  5EVI C;  5EFW A;  3UPP A;  2XDM A;  1PYY A;  4ZRR A;  2XA7 S;  3PBT A;  3NY4 A;  1L0E A;  4DE1 A;  5GHZ A;  1SCW A;  5I94 A;  1P9W A;  2ZQC A;  3KYE A;  2Z2M A;  1G68 A;  1J9M A;  2K2N A;  3WWX A;  3QP1 A;  3HLC A;  4YOF A;  4WM9 A;  1K6R A;  3LYX A;  1F5M A;  2DCF A;  2UV0 E;  2C6W B;  4UA7 A;  3ZQ5 A;  4GHI A;  1NZU A;  1LL8 A;  1ES5 A;  3KO6 A;  5GLC A;  2NUT C;  3JVU A;  1NRF A;  3GEC A;  4G3V A;  2P04 A;  1M6K A;  3JPU A;  3T4J A;  4I39 A;  5J3W A;  1S4S A;  1XJ4 A;  3HUN A;  1HTZ A;  3MQ0 A;  1W5D A;  4E6W A;  1D06 A;  2W27 A;  1PW1 A;  4Q0H A;  2GJ3 A;  4G3W A;  2QHK A;  4LRX C;  4OQI A;  3M6B A;  5AJG A;  1FIL A;  2ZMF A;  1WYB A;  4GNU A;  5FA7 A;  5CED A;  1YLP A;  3F1O B;  4DE3 A;  2ZL1 B;  3L7H A;  5HWV A;  4II7 A;  2OWH A;  1TD5 A;  3MXQ A;  5KSH A;  1VET A;  1K4F A;  1STZ A;  4MN7 A;  4ETZ A;  3EQU A; 
#chains in the Genus database with same CATH homology
 2CC1 A;  1K57 A;  2UWX A;  2ZC4 B;  3DW0 A;  5E2H A;  4DXC A;  1BLC A;  4CJN A;  5DF7 A;  3S22 A;  3BYD A;  3VP1 A;  2XK1 A;  4E3M A;  1FR1 A;  4EQI A;  2WK0 A;  1FCN A;  3TOI A;  1DJB A;  3BFD A;  3PBO A;  4OOM A;  3ZG8 B;  5FQK A;  3MKE A;  1XX2 A;  2XFT A;  3GSG A;  4U0X A;  3C5A A;  3VMA A;  1HZO A;  4PM5 A;  2HP9 A;  4EUZ A;  1K4E A;  4WZ5 C;  2WGW B;  2EX6 A;  2Y2P A;  4WMC D;  3PBR A;  5FI6 A;  5HAI A;  5F1F A;  1O07 A;  2ZC3 B;  5FQI A;  1Q2Q A;  5A92 A;  5DF8 A;  1GHI A;  4QB8 A;  3HVF A;  3N4I A;  4DF6 A;  3G31 A;  3HLB A;  3VOY A;  4KZ8 A;  2ZMA A;  3NI9 A;  4KZB A;  5AQ9 A;  4LEN A;  4DRT A;  2Y91 A;  2Y59 A;  2ZLY A;  3FZC A;  4GDN A;  4ZJ1 A;  1ZG6 A;  3D4F A;  2I72 A;  5EE8 A;  4X68 A;  1IKI A;  5FAP A;  4GB7 A;  5FAS A;  4LCM A;  1K56 D;  3G2Y A;  4S2M A;  4MEZ A;  3DTM A;  1ERO A;  1O7E A;  3O3V A;  3ISG A;  4N1X A;  1JVJ A;  3RJU A;  3PAG A;  3C4O A;  1W7F A;  4KZ7 A;  4E3J A;  2JE5 A;  4KQR A;  4B4Z A;  4S2I A;  4XXR A;  5CRF A;  1BUE A;  2HDR A;  3NBL A;  1FSW A;  1PIO A;  2HDS A;  1YMS A;  5A91 A;  4OPZ A;  2ZD8 A;  2WGW A;  2Y2I A;  4HEF A;  4LV0 A;  3N6I A;  2ZC3 A;  2WYX A;  1E25 A;  1TDG A;  1RCJ A;  2Y2K A;  3MZE A;  5HAR A;  1GHM A;  3ZFZ A;  4EBL A;  1YQS A;  2Z2L A;  3M6H A;  3OPR A;  3N7W A;  4QY6 A;  4E6X A;  5FQQ A;  1K55 C;  1Y54 A;  2WGV A;  1NJ4 A;  4PMA A;  2ZQD A;  4R3J A;  2XGN A;  1KVL A;  4N1H A;  1E4D A;  5D3O A;  4DE2 A;  4PM9 A;  3UPO A;  4DDY A;  3CJM A;  1BT5 A;  2XLN A;  3LO7 A;  4FH4 A;  4X6T A;  4X53 A;  4P85 A;  3AGF A;  4HES A;  2PU2 A;  4R4R A;  3W4P A;  2R9X A;  3MXR A;  4GD8 A;  1ESU A;  3N8R A;  2WKH A;  1SDE A;  2XD1 A;  3BM6 A;  3FV7 A;  3IXB A;  3GR2 A;  4OLG A;  1ZKJ A;  1L0D A;  5FAT A;  5HFO A;  1BLH A;  2H0T A;  5EVI D;  1ONH A;  3C7U A;  2Z2L B;  3E2L A;  3SH7 A;  1K54 C;  4JXS A;  3UE0 A;  3S1Y A;  3FKW A;  4KEN B;  4YIN A;  3A3F A;  4ZJ3 A;  5DTS A;  2QMI A;  2G2W A;  1GCE A;  1XKZ A;  4MNR A;  1CI9 A;  2FFF B;  4Q8I A;  1MWS A;  4S2N A;  4OOL A;  2HP5 A;  1LL9 A;  1XPB A;  4GN2 A;  5KMW A;  4KZ9 A;  3Q7V B;  3IXD A;  5DTK A;  4FH2 A;  3ZG5 A;  4RX2 A;  1KE0 A;  1G6A A;  4QHC A;  5EEC A;  1I2S A;  2Y2O A;  1HVB A;  4KZ3 A;  5FQM A;  1IYQ A;  3VP3 A;  3UPN A;  1LI0 A;  1ALQ A;  3BEC A;  5A93 A;  2ZM0 A;  2WUQ A;  3LY3 A;  4F94 A;  1C3B A;  3HBR A;  3OCL A;  4LV3 A;  3GMW A;  1SHV A;  1KE4 A;  1YLT A;  1K56 A;  1KDS A;  2EX8 A;  1QME A;  3BFF A;  3IWQ A;  1BLS A;  3MZD A;  1I2W A;  4OP8 A;  3SS3 A;  3A3I A;  4OH0 A;  5M19 A;  3QNC A;  4JPM A;  4WEL A;  1N4O A;  5M1A A;  3HLG A;  1EWZ A;  2BLS A;  2EFX A;  4EWF A;  4H8R A;  1S6R A;  1QMF A;  4E3K A;  5CER A;  5CTM A;  1IEM A;  1VM1 A;  4DXB A;  3Q7V A;  3DWZ A;  3BFG A;  5GLA A;  1KGF A;  5GL9 A;  3GVB A;  1ES2 A;  2OLV A;  4EBP A;  1CEG A;  1BTL A;  4A5R A;  4PM6 A;  4OLD A;  4B88 A;  3RXW A;  3VSL A;  3AGE A;  4QY5 A;  1GHP A;  1YMX A;  5EOE A;  1EI5 A;  3G4P A;  5E43 A;  2R9W A;  4BL3 A;  2RL3 A;  1E3U A;  1K57 C;  1RGY A;  2IWC A;  3ITB A;  3VP0 A;  1DJA A;  3HLE A;  4IVI A;  3V3R A;  4JXV A;  1MWT A;  1MKI A;  4GKU A;  3FWL A;  3SS4 A;  3PAE A;  2ZQ7 A;  3UDX A;  3A3E A;  2V1Z A;  3WS4 A;  5CEB A;  3C7V A;  4R23 A;  1YLY A;  3UNW A;  4JLF A;  5G18 A;  5J8X A;  4OPR A;  4UAA A;  3M2J A;  3IF6 C;  5HW3 A;  2ZC5 B;  3ZVW A;  3N8L A;  4BEN A;  1YM1 A;  1TDL A;  2ZQ9 A;  3GQZ A;  4K0X A;  4Y7P A;  3VFH A;  2VGK A;  4R0Q A;  1LL5 A;  3MKF A;  1W79 A;  4D2O A;  1M40 A;  2J9O A;  3NCK A;  3FYZ A;  4UHU A;  2PBY A;  4ZTK A;  5FDH A;  3WRZ A;  2IWD A;  3CMZ A;  3W4O A;  2JBF A;  2XR0 A;  5F83 A;  3V3S A;  2XEP A;  3ZG7 B;  4Z9Q A;  1K25 A;  3G2Z A;  1YLZ A;  2ZQA A;  4WBG A;  3V39 A;  4S2J A;  3ZG9 B;  1L2S A;  3OZH A;  1KE3 A;  3IWO A;  2ZQ8 A;  5GHY A;  1W8Y A;  3Q7Z A;  1H8Y A;  3O86 A;  2Q9N A;  4N9K A;  3MBZ A;  3BFE A;  3PTE A;  4ZDX A;  5EPH A;  3LY4 A;  4QD4 A;  3ZNT A;  4RX3 A;  2WAE A;  3TG9 A;  1IKG A;  2Y2J A;  3Q82 A;  3N8S A;  1H8Z A;  4JXW A;  1IYS A;  3ITA A;  5AQA A;  3VSK A;  4KQO A;  1WYC A;  2EXA A;  4MBF A;  4X69 A;  4OKP A;  4E3O A;  3IF5 A;  2EX9 A;  3BLS A;  4KZ6 A;  1JWZ A;  3G30 A;  4IED A;  1YLW A;  3BLM A;  5AQB A;  5U47 A;  5HL1 A;  3CG5 A;  2WAF A;  2XQZ A;  4JBF A;  1Q2P A;  4C75 A;  5HAQ A;  1CK3 A;  4KZA A;  2WGI A;  2ZC7 A;  5FQJ A;  1MWR A;  5F82 A;  4BQM A;  1BSG A;  1GA0 A;  3NIA A;  1YLJ A;  1PWG A;  1L0G A;  1NZO A;  3UO9 A;  2C5W B;  2DNS A;  3LEZ A;  1BLP A;  4C3Q A;  4RVA A;  4S2N C;  5CHU A;  2IWB A;  4OVD A;  1ONG A;  5AQ7 A;  5TR7 A;  4U3T A;  3UE3 A;  2J7V A;  4BD0 A;  1VQQ A;  4NK3 A;  4EV4 A;  2WKI A;  1LHY A;  5E2F A;  3NDE A;  2EFU A;  4LV2 A;  2DRW A;  4JF4 A;  4KZ4 A;  4X56 A;  1OME A;  2X01 A;  3HL9 A;  3Q81 A;  4S2K A;  1NXY A;  1ESI A;  5HAP A;  3WS2 A;  5KSC A;  3IWI A;  4KZ5 A;  3VP2 A;  5JYO A;  5JYP A;  1NYY A;  4KG5 A;  2Y2Q A;  2VGJ A;  1BUL A;  2JC7 A;  4P87 A;  1LI9 A;  4CPK A;  5GLB A;  5L2F A;  4L0L A;  3DWK A;  1KGE A;  2Y4A A;  5CTN A;  5E2E A;  1NYM A;  4JKT A;  4JF5 A;  2Y2G A;  1IYP A;  3HLF A;  3HRE A;  5CGX A;  1SDN A;  2P74 A;  1MPL A;  1NY0 A;  3IT9 A;  3UY6 A;  4GDB A;  5F1G A;  2GDN A;  4PPR A;  3NDG A;  4N92 A;  4WEJ A;  4JXG A;  3AGD A;  4S2P A;  3ZNY A;  2A49 A;  1N9B A;  3VOZ A;  5KZH A;  2OV5 A;  3NC8 A;  4DE0 A;  5FSR A;  3ZVT A;  5FI2 A;  3C4P A;  1ES4 A;  1S0W A;  4OP5 A;  3ZCZ A;  1AXB A;  1YT4 A;  4Y0O A;  1PW8 A;  3ZG0 A;  3I7J A;  4DKI A;  3P09 A;  2ZM2 A;  3UDF A;  5TFQ A;  2BG1 A;  4IBX A;  2H5S A;  4LCL A;  1KDW A;  1FOF A;  1K6S A;  4GD6 A;  4KQQ A;  1IYO A;  2ZJ9 A;  1PZP A;  1XA1 A;  3TSG A;  5EVI B;  3IH9 A;  4RA7 A;  2XFS A;  3IXG A;  5CHJ A;  4E3L A;  4YFM A;  2PU4 A;  4OOY A;  2V20 A;  3E2K A;  1PWC A;  3V50 A;  5A90 A;  1ZG4 A;  3GV9 A;  3Q07 A;  4R3B A;  4OQ0 A;  4IBR A;  3W8K A;  2EX2 A;  2Q9M A;  3Q1F A;  3OPH A;  3LCE A;  4WYY A;  4WZ5 A;  4ZJ2 A;  3M2K A;  1U60 A;  3IH8 A;  3V5M A;  5E2G A;  4C6Y A;  1RGZ A;  3GTC A;  1I5Q A;  1TEM A;  4NET A;  3UDI A;  4WMC A;  3MFD A;  4UA9 A;  4WEK A;  1ERQ A;  1DY6 A;  2EXB A;  1CEF A;  2Y2H A;  3HUM A;  3A3D A;  4FSF A;  5FI7 A;  4B4X A;  3W4Q A;  1W8Q A;  5DTT A;  4PM7 A;  2QPN A;  3OCN A;  1FR6 A;  4MBK A;  2H0Y A;  3IF6 A;  2X71 A;  4BLM A;  3WS0 A;  2XD5 A;  4IVK A;  2Z2M B;  1JTG A;  1DJC A;  4XUZ A;  2XH9 A;  5EOO A;  1FCO A;  3ZDJ A;  5CEC A;  4P6B A;  3UE1 A;  5EVI A;  1PI5 A;  3SS5 A;  4QU3 A;  4E3I A;  2J8Y A;  5CXW A;  1L0F A;  1WE4 A;  3EQV A;  3VFF A;  1JTD A;  2P9V B;  3BRM A;  4N9L A;  1Z6F A;  4OON A;  3HLD A;  5EVI C;  3FKV A;  4HBU A;  1MXO A;  5FQ9 A;  3O87 A;  3UPP A;  2XDM A;  3QHY A;  1PYY A;  2H10 A;  1MWU A;  4BD1 A;  3PBT A;  5CGS A;  1GA9 A;  1ES3 A;  3ZHH A;  3NY4 A;  3G34 A;  1L0E A;  1KGG A;  2A3U A;  3CZD A;  1XXM A;  4GOG A;  1E3U D;  3SOI A;  4ZAM A;  4DE1 A;  5GHZ A;  4PM8 A;  1SCW A;  5EUA A;  1XP4 A;  4S2L A;  2HPB A;  5I94 A;  5DVA A;  3RXX A;  5GLD A;  4JF6 A;  2Y2L A;  1RP5 A;  2Y2M A;  3IF6 B;  3PBN A;  3S4X A;  2ZQC A;  4KG6 A;  2Z2M A;  1G68 A;  2ZC6 B;  1J9M A;  1MBL A;  3WWX A;  2E8I A;  3HLC A;  1PI4 A;  2P9V A;  4WM9 A;  1K6R A;  1CI8 A;  2DCF A;  2HP6 A;  3HUO A;  2C6W B;  5GHX A;  2WAD A;  1SKF A;  4S2O A;  4UA7 A;  3A3J A;  1JWP A;  1XGJ A;  2RCX A;  2ZM8 A;  4K0W A;  4LV1 A;  2HDU A;  5TGF A;  3WRT A;  3OPL A;  4R4S A;  1NZU A;  1XGI A;  4U0T A;  4ZBE A;  1ES5 A;  5FAQ A;  1PZO A;  2WKE A;  3PBQ A;  4X55 A;  3MXS A;  4WZ4 A;  1K55 A;  3JYI A;  5GLC A;  2XF3 A;  1JWV A;  3OC2 A;  4R1G A;  4Y0U A;  4K91 A;  1NRF A;  4HBT A;  4O7D A;  4UA6 A;  2JCH A;  4XUX A;  2QZ6 A;  5HX9 A;  4BJP A;  4E3N A;  4FD8 A;  1FQG A;  3VP4 A;  1M6K A;  4OPQ A;  4Y0T A;  1KVM A;  4ID4 A;  3IHA A;  4GZB A;  1XA7 A;  3HUN A;  2OLU A;  3WS5 A;  1HTZ A;  1IEL A;  1W5D A;  3O88 A;  3SH9 A;  4E6W A;  1ZC2 A;  1PW1 A;  3ZGA B;  3IQA A;  1K54 A;  2WZX A;  4RYE A;  2OSU A;  3GRJ A;  2Y55 A;  3BFC A;  5CHM A;  4M3K A;  5CGW A;  3UN7 A;  2ZC4 A;  5FAO A;  4FCF A;  3HLW A;  1FCM A;  4OQG A;  3G32 A;  3M6B A;  4OQI A;  2G2U A;  4QJG A;  1BZA A;  1HD8 A;  1MY8 A;  3B3X A;  4BL2 A;  5IHV A;  3IXH A;  1WYB A;  4GNU A;  4EBN A;  2Y2N A;  2X02 A;  5EVL A;  5M18 A;  5FA7 A;  5CED A;  4OQH A;  1YLP A;  4DE3 A;  2WZZ A;  3MZF A;  5BOH A;  3SH8 A;  1ERM A;  3BEB A;  4DDS A;  2B5R A;  4KG2 A;  3PBS A;  4P0M A;  1H5X A;  1TVF A;  2J9P A;  1PWD A;  2FFY A;  1K38 A;  3P98 A;  3G35 A;  1FSY A;  3OPP A;  4MLL A;  4OPY A;  5KSH A;  2V2F F;  1LLB A;  1K4F A;  4MBH A;  2HDQ A;  3IHB A;  5DF9 A;  3QNB A;  3WS1 A;  3EQU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...