4OVDA

Crystal structure of a putative peptidoglycan glycosyltransferase from atopobium parvulum dsm 20469
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
511
structure length
422
Chain Sequence
b'NDIVLHARRGTIYDRNGNVLAMSVDCKNNTKRVYPYGNVGVQILGFVNADNEGASGLEYYYNDILAGTNGHMISNITEAQNGQDIVLSIDIELQKKAEEQLTAAVKDFEAKQGGSIMAMNPRTGEIYAAASYPLPDFVDYESLNLKLVSSIYEPGSVFKVITTSIGVDNNLFGPNSTFNIPTELQVGDNKVTDDDWRTSAMDMSVREMLRRSSNVGMAFLETQLIGDKRFAEGIDKFGIGHTTGIDFPGEATGIVRSLDQYEGPTGGNMAFGQGLAIPFIQVIRAYTAVANKGTMVTPHFMVSKGGQEVSWPTKDVISSSTASAELDMMTTVVKEGTGVRAGIYGYTVAGKTGTGQQVVEETGSYGENSGFVASFCGIVNPSESDLMVYVGLNDTHQLASQSAAVVFSQFAKDAATRLNIQP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidoglycan glycosyltransferase
publication title Crystal structure of a putative peptidoglycan glycosyltransferase from Atopobium parvulum DSM 20469
rcsb
source organism Atopobium parvulum
molecule tags Transferase
total genus 119
structure length 422
sequence length 511
ec nomenclature ec 2.4.1.129: Peptidoglycan glycosyltransferase.
pdb deposition date 2014-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
A PF03717 PBP_dimer Penicillin-binding Protein dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4ovdA03
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4ovdA02
3.90.1310.10 Alpha Beta Alpha-Beta Complex Penicillin-binding protein 2a (Domain 2) Penicillin-binding protein 2a (Domain 2) 4ovdA01
4JXGA 2BG1A 5TFQA 1GHMA 3W4OA 3ZVWA 5EVLA 2XK1A 2OLVA 1YMXA 3WS2A 2ZC3A 4KZ8A 4R3JA 2QMIA 2Y2QA 3UE3A 5KSCA 3IH9A 3CJMA 1J9MA 3CG5A 4UA9A 4K91A 1FSYA 2ZQ8A 1JWPA 4CJNA 1BLSA 2P9VA 5HL1A 2Z2MB 4WMCA 1L0DA 3G34A 3VP2A 4FD8A 1I5QA 4YFMA 1PWGA 1DJCA 2ZM0A 5IHVA 1CK3A 1XGIA 2JBFA 3C4OA 3AGDA 4O7DA 3Q81A 4K0XA 5FATA 3HREA 2HP9A 4LV2A 2WK0A 4EBLA 4OLGA 5HW3A 4WYYA 5GLDA 1K6RA 2VGJA 3QNBA 4OPRA 1H5XA 5DTSA 1NRFA 3UPNA 3VMAA 4CPKA 4E6WA 4U3TA 3WS1A 1GHPA 3V50A 2GDNA 3M2JA 3NC8A 4KZ4A 4EQIA 1BULA 3FKVA 5KZHA 3CZDA 4WM9A 4NETA 3ZG8B 3ZNYA 4MEZA 5HAPA 5CHMA 4B4ZA 2XF3A 1ONGA 2C6WB 4L0LA 4U0TA 4MLLA 3N8RA 3G35A 1NZUA 3MZDA 3TOIA 3GQZA 3Q07A 1PI5A 5EPHA 4WZ4A 1FQGA 5CTNA 3W4QA 3LY4A 4BL2A 1WE4A 1ES3A 4DE0A 3BFFA 4MBHA 4BLMA 5FQKA 1EROA 2J9PA 2WADA 4JF4A 5DVAA 1BUEA 3ZVTA 1E4DA 2FFYA 2H0TA 5FI7A 1ESIA 4P87A 3BFDA 1TVFA 2XGNA 1DJBA 1E3UD 1O7EA 3BECA 2HPBA 4FSFA 1ZG4A 3UE0A 2ZC4B 3FV7A 3G2YA 3HLEA 1I2SA 1MXOA 3HUOA 4KZ9A 1KE0A 3W8KA 3ZG9B 1K38A 2XEPA 4PM7A 4GN2A 4LV0A 1FR6A 5BOHA 1ESUA 1GA9A 2OSUA 3RXXA 1FSWA 2PU4A 1LLBA 4S2LA 1TDLA 2IWDA 5CGWA 5CERA 1SDNA 4ZJ3A 1MWSA 1PYYA 3ZNTA 3IHBA 3NI9A 4LCLA 4MBFA 1L0GA 1PZPA 1IEMA 3VP3A 2UWXA 1M40A 1WYBA 5FQ9A 4XXRA 1BT5A 2E8IA 1YLWA 3IF5A 3FYZA 2H0YA 1K57A 1QMEA 3HLGA 1ERQA 2G2UA 2RCXA 4GDNA 1KDSA 2JC7A 1YT4A 4KENB 5EVIB 1CI8A 1XA1A 5CRFA 5E2GA 1OMEA 3ISGA 1W8YA 3BFGA 2ZM8A 2XQZA 1IELA 1HVBA 1XGJA 3DW0A 2EX8A 5AQAA 3SH7A 2ZC5B 2Y2JA 4BD0A 3BEBA 3PAGA 2X02A 3C5AA 4GOGA 2WAEA 4R3BA 3UDFA 3HBRA 2ZM2A 1W8QA 5FI2A 2WZZA 3NIAA 5CHUA 3HLDA 1KE4A 5HARA 5A93A 1BTLA 3TSGA 3IH8A 5FQMA 3RJUA 4IVIA 2Q9NA 2ZC6B 3LO7A 4P0MA 1LHYA 3MZFA 2V20A 3JYIA 1TEMA 5EVID 4KZBA 4PM9A 5GHYA 2ZQCA 3BM6A 5FQQA 3ZCZA 4R1GA 2X71A 4S2JA 4BENA 1FOFA 2Z2LB 4GD6A 3Q7ZA 1IYPA 1IYQA 3BYDA 1HTZA 1ZG6A 3B3XA 5AQ7A 5GHZA 3V5MA 4PMAA 3ITAA 1BLHA 3SH9A 4QY6A 1MPLA 5M1AA 2XH9A 4KQQA 3MBZA 1XKZA 2XFTA 1YLPA 3ZDJA 2R9XA 4JLFA 5GL9A 1L0FA 3HLCA 4P6BA 4WEJA 5DTKA 3PBTA 3WWXA 4N1XA 2P74A 4OQHA 4K0WA 2B5RA 2Z2MA 5FSRA 4R23A 1U60A 1PIOA 2Y2KA 4HBTA 2A3UA 3NCKA 2I72A 3VSLA 3P98A 1GA0A 5HX9A 4GNUA 1JTGA 3VP0A 5M19A 3SS4A 1W79A 2XD5A 5CXWA 4QB8A 3VSKA 2EX6A 4KZ7A 2WGWB 4DF6A 4QY5A 4EUZA 4C3QA 3IF6C 1ES2A 3IWQA 1ES5A 4S2NA 3PAEA 2IWBA 1E3UA 4OONA 5DF7A 3MKFA 1RP5A 4E3IA 2Y4AA 1YLJA 2PBYA 3OPLA 2Y2NA 3IXDA 3IHAA 2WYXA 5FAOA 1WYCA 2HP5A 5TR7A 3ZG5A 4E6XA 3A3FA 1G68A 3C7VA 3VFHA 1LL5A 4X55A 3NDGA 4E3MA 3HUNA 2JCHA 4JF6A 1VQQA 3PTEA 3OZHA 5E2HA 4OLDA 4QHCA 5CGXA 3RXWA 3P09A 1JVJA 4IEDA 3GVBA 1S0WA 1K57C 2WGVA 1N9BA 1W7FA 1YQSA 4OQIA 5E2EA 4GDBA 4E3JA 4D2OA 4QU3A 2ZC4A 4FH2A 4E3LA 4S2OA 3SS3A 5HAIA 4EBNA 5CECA 5EECA 3Q1FA 3AGFA 4LV1A 4YINA 5M18A 3PBSA 1CI9A 4X53A 3Q7VB 3MZEA 5EOOA 5A90A 4Y0OA 2OV5A 1VM1A 2WUQA 4OP8A 4N1HA 2ZJ9A 1IKIA 4S2PA 4WELA 2RL3A 3O86A 1KVMA 3G31A 1YM1A 5F82A 4A5RA 1PWDA 3NY4A 4P85A 1I2WA 3GSGA 4HESA 2DNSA 4KZ5A 3UO9A 2J8YA 3HL9A 4X68A 1ERMA 1Y54A 1Q2PA 3G4PA 4EWFA 3BLSA 3WS4A 1FCMA 1MWUA 2J9OA 4JPMA 2A49A 4C6YA 4EBPA 2VGKA 2EFXA 3MFDA 5EVIA 3V39A 5L2FA 4X69A 3MXRA 1NJ4A 1KDWA 2WKHA 3IT9A 4S2IA 3PBOA 4N9LA 5FDHA 4N9KA 2Y2HA 3I7JA 2HDQA 3IF6B 3A3JA 4DE1A 3S22A 4KZ6A 3NBLA 1PZOA 2EXAA 4OQGA 4OPZA 4U0XA 3VP1A 4Y7PA 4BD1A 1IYOA 1KE3A 4M3KA 3LEZA 4LV3A 2R9WA 4GD8A 5F1FA 4E3OA 3BLMA 4MNRA 3FZCA 5AQ9A 3M6BA 3O88A 2Y2OA 3N7WA 1DY6A 1K4EA 2Y2PA 4KZ3A 5U47A 2Y2MA 3N8LA 3W4PA 1K54A 3O87A 1H8ZA 1Z6FA 5F1GA 4HEFA 4UA7A 4QJGA 2Z2LA 4GB7A 3GV9A 2HDRA 1ALQA 3G30A 3HVFA 5A92A 3LY3A 4DE3A 1JWZA 2XD1A 3WS5A 2Y59A 4BQMA 4ZJ1A 1NYYA 3UN7A 3Q82A 4OOMA 2EFUA 1NXYA 1MWRA 4F94A 4S2NC 5DTTA 4RA7A 2EX2A 2H5SA 1FR1A 3N4IA 4OH0A 2Y2IA 3ZG7B 4C75A 1SKFA 5GLCA 4RYEA 3PBNA 2XFSA 4JXSA 4R0QA 3VFFA 1H8YA 2Y55A 2WGIA 3ZGAB 1BSGA 3C4PA 3O3VA 4JF5A 4BL3A 4ZAMA 4IVKA 4OKPA 1LI9A 2IWCA 3PBQA 1O07A 2XDMA 2DCFA 3GRJA 1ES4A 4DE2A 1C3BA 5CEBA 4GZBA 5EUAA 4JXVA 3LCEA 4B4XA 1LL9A 4UA6A 3OPPA 2BLSA 4Y0TA 1HZOA 3EQUA 1K55A 2WGWA 4KG6A 4PM8A 4IBRA 5E43A 4JXWA 2ZQDA 4PM6A 3E2KA 1XP4A 2ZD8A 5F83A 1M6KA 3MKEA 1HD8A 3ZFZA 1PW1A 2J7VA 1W5DA 3HUMA 3TG9A 3ZHHA 1MY8A 3WS0A 3NDEA 3GMWA 2ZC7A 3G2ZA 4R4RA 2OLUA 4H8RA 4MBKA 4PPRA 1KGGA 2CC1A 3IWIA 5G18A 2V1ZA 4LENA 5E2FA 4WZ5A 1EI5A 1YLZA 2ZC3B 5JYOA 1K56D 1YLTA 2HDUA 4XUXA 1JTDA 1NY0A 1RGZA 3DTMA 3IXGA 2QPNA 3IXHA 5EOEA 4UAAA 3WRTA 3G32A 4UHUA 2ZLYA 2ZQ9A 5FAPA 1E25A 3IQAA 4DRTA 3SH8A 2P9VB 1BZAA 4KG5A 3UE1A 2QZ6A 2WAFA 3IWOA 1YMSA 1YLYA 3PBRA 5EVIC 1XXMA 1PWCA 1KVLA 3DWKA 3BFCA 4Q8IA 3OCNA 4KQOA 3GTCA 1GHIA 3CMZA 1QMFA 2DRWA 3Q7VA 3BFEA 4JKTA 3S4XA 5CHJA 5EE8A 3M2KA 5CEDA 1RGYA 5CGSA 1KGEA 1NYMA 4KG2A 2EXBA 1KGFA 3N8SA 4JBFA 3D4FA 4ZTKA 4OVDA 5GLBA 4EV4A 2G2WA 5J8XA 1PW8A 3OCLA 3UPPA 1CEGA 1XA7A 4WMCD 5KSHA 2ZQ7A 4PM5A 3IXBA 4XUZA 3OPRA 3ITBA 3ZG0A 1K54C 4NK3A 1NZOA 2ZQAA 4OOLA 1SDEA 4RX2A 4BJPA 3A3DA 1XPBA 3EQVA 1ZC2A 5A91A 4Z9QA 1Q2QA 5DF8A 1MKIA 1G6AA 3IF6A 2ZMAA 3UDIA 5FA7A 5JYPA 2JE5A 3N6IA 1K25A 3FWLA 5TGFA 4OQ0A 1TDGA 1LI0A 3GR2A 1EWZA 5FAQA 4OOYA 4ZBEA 4HBUA 1MWTA 4KZAA 3UDXA 4QD4A 3V3SA 4S2KA 4WBGA 2Y91A 4IBXA 1L2SA 1L0EA 3HLFA 4S2MA 2Y2LA 2XLNA 1N4OA 4FCFA 2WKIA 1BLPA 5KMWA 5FQIA 3WRZA 3OPHA 4OP5A 1JWVA 4OPQA 3S1YA 3SS5A 2FFFB 4E3KA 3VOZA 5HAQA 3QNCA 1K4FA 3C7UA 5CTMA 5GHXA 3SOIA 1CEFA 2X01A 4ZDXA 3BRMA 3VP4A 1K55C 5I94A 2HDSA 1SHVA 1FCOA 1K6SA 3M6HA 1ONHA 1ZKJA 4ID4A 4Y0UA 4E3NA 4DKIA 1SCWA 1XX2A 4OPYA 4RX3A 1MBLA 3HLWA 4LCMA 4X6TA 3V3RA 4X56A 3DWZA 2Y2GA 4DDSA 5AQBA 4WZ5C 3MXSA 5GLAA 4WEKA 1AXBA 1IKGA 3A3IA 5FI6A 1BLCA 4DDYA 4ZJ2A 3OC2A 1IYSA 2HP6A 3FKWA 4KQRA 1PI4A 4R4SA 4B88A 3HLBA 4FH4A 1K56A 3VOYA 1GCEA 2WZXA 2V2FF 2H10A 2Q9MA 3A3EA 3UY6A 5FASA 4RVAA 3UNWA 3QHYA 2C5WB 2EX9A 1DJAA 4N92A 5FQJA 2WKEA 1S6RA 5HFOA 1FCNA 4DXCA 1RCJA 3AGEA 3E2LA 4GKUA 2PU2A 2XR0A 5DF9A 4DXBA 3UPOA 5D3OA
chains in the Genus database with same CATH superfamily
5EM0A 3ZVWA 2ZC3A 2QMIA 3NOTC 5KSCA 2INWA 4Q0IA 1J9MA 3CG5A 4K91A 3RTYA 1L0DA 3G34A 1DJCA 1SZVA 1CK3A 1V9ZA 2O0YA 1NLZA 4O7DA 3Q81A 2O99A 3T4OA 4MN7A 3TJZC 4MDZA 3ZYTA 2VGJA 4BBUA 4HNBA 4CPKA 4U3TA 1S4RA 4NG2A 1SKOA 2PHYA 4BBVA 4B4ZA 1ONGA 3W2ZA 4L0LA 3SZTA 3SW1A 3G35A 1V9YA 3TOIA 1FILA 3Q07A 3W4QA 1WE4A 3T4KA 4B9OA 4WL9A 4EEPA 4DN0A 1E4DA 2FFYA 1ESIA 3BFDA 2XGNA 1E3UD 1O7EA 5G4YA 1CQAA 1ZG4A 3G2YA 3HLEA 1MXOA 3W8KA 3ZG9B 2XEPA 3BQ8A 4HP4A 2IWDA 1SDNA 3UB6A 3IHBA 3NECA 4I3IA 1L0GA 2UWXA 4HP9A 5FQ9A 1BT5A 2VV6A 1K57A 4KQDA 1N9LA 4GCZA 1KDSA 2V1AA 4KENB 1CI8A 1XA1A 5CRFA 5E2GA 3P01A 1F98A 1IELA 1HVBA 3DW0A 3MSHA 3SH7A 2Y2JA 4EERA 3KO6A 3HBRA 2WZZA 3NIAA 5CHUA 1KE4A 3RH8B 3TSGA 2XA7S 3LO7A 1LHYA 3JYIA 2JKTM 1H0MA 1G28A 4P6ZM 4R1GA 1ZG6A 3F1OB 3B3XA 5AQ7A 3V5MA 4F3LB 4PMAA 3D3OA 2BTFP 1BLHA 2XROA 4LRZE 3UE6A 1MPLA 5M1AA 3MFXA 4KQQA 1XKZA 2XFTA 1YLPA 2R9XA 4WLAA 3CUEA 5DTKA 2V0UA 1T1AA 4K0WA 3LI9A 1UWNX 4R23A 2ACGA 4HBTA 3VSLA 3HJKA 4AFIA 4QB8A 3VSKA 1ES2A 3IWQA 3LR3A 4OONA 1YLJA 3DTKA 1LSVA 3IHAA 1WYCA 2HP5A 4E6XA 1D1JA 1VB6A 2P7JA 3A3FA 2PRFA 1LL5A 3R4KA 3CPTA 2QJ5A 3OZHA 5TBMB 2PD7A 4IEDA 2W3EA 2WGVA 4QU3A 2GZAA 2PYPA 3F1NB 2ZC4A 4FH2A 4E3LA 5HAIA 3CWFA 4O01A 4YINA 3C2WA 3T50A 3Q7VB 4Y0OA 2WUQA 4N1HA 2W1TA 4PAUA 4WELA 1KVMA 1PWDA 3T12B 1I2WA 1T1BA 3T4SA 2E8JA 3GSGA 2DNSA 4O0PA 3UO9A 1CJFA 2JHEA 4YWZA 4EWFA 3BLSA 4C6YA 5EVIA 4QWOA 4LRYC 2KOIA 2WKHA 2LB9A 4DE1A 4Y13A 4KZ6A 4OQGA 4OPZA 3LEZA 2ZBBA 3QP2A 3B42A 3O88A 4H6JB 4ZRRA 1DY6A 1K4EA 2Y2PA 3K3DA 5F1GA 4HEFA 2Z2LA 3VE3A 5A92A 4LGWA 4BQMA 1OTDA 2PAVP 4OOMA 2EFUA 1MWRA 3B47A 4F94A 4RA7A 2H5SA 2YKHA 3ZG7B 2PR5A 1P0ZA 2EWWA 3LR0A 1H8YA 3ZGAB 3O3VA 4X1MA 2KDKA 4BMWA 4P6ZS 2XDMA 1ES4A 4HI4A 3IBJA 2BLSA 1K55A 1JNUA 4PM6A 4WN5A 5DKKA 1W5DA 2HV1A 4HHDA 3NDEA 1XJ2A 3GMWA 3G2ZA 3H82A 4H8RA 4MBKA 1KGGA 2LB5A 2ZC3B 4XUXA 1JTDA 5HWWA 2QPNA 3CLOA 4FUWA 4UHUA 4DRTA 3IQAA 3DBAA 1BZAA 4KG5A 3UE1A 2JKRI 3E98A 2QZ6A 3PBRA 1XXMA 4Q8IA 4Q0JA 2K2NA 3ULFA 1QMFA 2J80A 5IU1A 4D60A 2GJ3A 5EE8A 4HOIA 4EV4A 4GHIA 2O9BA 2JKRM 5J3WA 1SKOB 2ZQ7A 4XUZA 3HCYA 3LI8A 2HZ5A 4ARZA 1NZOA 4OOLA 5HDSA 1XPBA 3S7QA 2ZMAA 3MS6A 3N6IA 4OQ0A 2XSSA 1LI0A 1BYWA 4OOYA 4PKYA 3UB7A 2OAP1 4KZAA 2V0WA 4IBXA 1L2SA 1L0EA 4S2MA 2Y2LA 2XLNA 2WKIA 1OT6A 3BY8A 3WRZA 3IS2A 4E3KA 2FFFB 3VOZA 5GHXA 4GJ4A 4ZDXA 2K7SA 4ETXA 1LSXA 1SHVA 1K6SA 2QWSA 5HPFA 1GSVA 4RX3A 3G6OA 4L9GA 3B33A 5DKLA 4WZ5C 3MXSA 4WEKA 1AXBA 4DDYA 5HWTA 4KQRA 3HLBA 4FH4A 4ETZA 2AVXA 2XRNA 5G4ZA 3AGEA 3LYXA 3T4LA 5D3OA 2BG1A 5TFQA 3IX4A 1GHMA 5EVLA 2OLVA 3WS2A 4R3JA 3DTEA 1S4SA 3CJMA 1FSYA 1JWPA 1BLSA 3JPUA 4WUJA 3MR0A 4WMCA 1IFQA 4FD8A 1PWGA 2Z6DA 5IHVA 1XGIA 3AGDA 4K0XA 4WYYA 4OPRA 1H5XA 4E6WA 3PHYA 2GDNA 5DFXA 4EQIA 3FKVA 5KZHA 4WM9A 3ZNYA 3BWLA 5CHMA 2XF3A 3MMHA 1TD5A 3CPTB 2KX6A 4WZ4A 5F6AA 1FQGA 5CTNA 3LY4A 4BL2A 3BFFA 4BLMA 2WADA 2JN7A 4JF4A 5DVAA 4P87A 3BECA 1ACFA 3UE0A 2ZC4B 3FV7A 1TS6A 4PM7A 4PKYG 4HH2A 5BOHA 2L1MA 2PU4A 5CERA 2W1TB 4ZJ3A 3D9YA 5CX7A 4LCLA 5C5KA 1IEMA 3T4QA 1WYBA 3FYZA 3HLGA 2G2UA 2RCXA 2JC7A 5EVIB 4Y17A 1W8YA 2ZM8A 2XQZA 2EX8A 5AQAA 2ZC5B 3PAGA 1NRJA 3CHWP 4KUKA 5FQMA 4IVIA 3EGDC 3T1SA 5J4EA 5EVID 1TEMA 3UMDA 3L9KA 4PM9A 4S2JA 2X71A 2Z2LB 1VETA 2J3TC 4Y15A 1HTZA 3ITAA 4EW7A 2XH9A 2M7UA 3HLCA 4WEJA 3PBTA 2B5RA 2PBDP 1PIOA 3EEAA 2Y2KA 3VOLA 4Y5FA 4I39A 1XJ4A 2EX6A 3ICYA 4C3QA 3IF6C 1ES5A 4S2NA 2IWBA 5DF7A 3MKFA 4E3IA 2PBYA 3OPLA 5FL3A 5FAOA 3ZG5A 5TR7A 3LGOA 3H82B 4JF6A 5E2HA 4ME4A 4OLDA 1T18A 3PR6A 4OQIA 5E2EA 4GDBA 2B18A 3NJAA 5HZHA 1TS8A 5J7EA 1P9RA 4EBNA 3AGFA 5M18A 3PBSA 4X53A 5EOOA 4G3VA 2OV5A 4OP8A 1L3LA 1LSWA 3UMEA 2RL3A 4A5RA 4P85A 1P97A 2HJ9C 4GHIB 4KZ5A 2J8YA 1Y54A 3JVUA 1MWUA 4EBPA 3MFDA 3C38A 5A8BA 4S2IA 5FDHA 2Y2HA 4JGPA 1N9OA 1Z09A 2HDQA 2W0NA 3K2NA 3A3JA 5FDSA 3S7OA 4U0XA 2JKTI 2B02A 2PT7A 4BD1A 4NXGA 1IYOA 3LIBA 4GS9A 3BLMA 5AQ9A 3M6BA 3JVVA 3N7WA 3BQAA 5U47A 1K54A 4KUOA 3O87A 3OOVA 3HVFA 3IS2B 3LY3A 1DRMA 4ZJ1A 1NYYA 4Q0HA 1WA9A 1NXYA 3F1PA 2QHKA 1FR1A 2K31A 4OH0A 4R0QA 2VKSA 3C4PA 4JF5A 2ZL1A 4ZAMA 4OKPA 2IWCA 1O07A 3GRJA 4DE2A 5CEBA 2ZMVA 4B4XA 3OPPA 1HZOA 3EQUA 1PNEA 2WGWA 4PM8A 4IBRA 4EQ1A 4R70A 3E2KA 1XP4A 3PYPA 3OBFA 1DP9A 3HUMA 3ZHHA 2D02A 1T1CA 2OLUA 4PPRA 2CC1A 5G18A 2EWVA 2V1ZA 4LENA 3T4TA 1YLZA 5FEFA 4EETB 2ZLYA 2ZQ9A 1E25A 3IX8A 3SH8A 3KSGA 3A0SA 1J3WA 2WAFA 3IWOA 1DP6A 2WKRA 3L7HA 1X0OA 4IUHA 1D06A 1KVLA 4KQOA 1LL8A 3GTCA 1GHIA 2VX8A 3S4XA 3M2KA 1NWZA 2EXBA 1KGFA 3LR4A 5GLBA 1PW8A 3S7PA 4WMCD 3QP6A 2HJEA 2W3DA 3OPRA 1Y4OA 5HPIA 2Y79A 1SDEA 3A3DA 3KX0X 5A91A 4Z9QA 1Q2QA 1YPRA 5DF8A 1G6AA 3IF6A 3NHQA 5JYPA 2JE5A 5TGFA 4I38A 3FG8A 1EWZA 5FAQA 1ZTUA 4ZBEA 4HBUA 4UEYA 3UDXA 3V3SA 2WKQA 4WBGA 5L07A 3E4QA 1BLPA 5KMWA 5FQIA 4YNRA 4OP5A 4OPQA 4X25A 3QNCA 5CTMA 3SOIA 4JGOA 1CEFA 3BRMA 3LIFA 2FH5A 1ZKJA 2G7UA 4OPYA 3LIEA 3HLWA 4NEED 4X6TA 5DJTA 2P08A 3V3RA 4G3KA 3DAVA 3A3IA 1BLCA 4NXEA 4RQ9A 3TE8A 4ZJ2A 3OC2A 2HP6A 3MQOA 1K56A 3VOYA 2WZXA 2IA2A 2Q9MA 5L10A 3UY6A 3KSFA 4RVAA 3QHYA 2EX9A 4CLCC 2VZWA 1RCJA 3E2LA 4HH3A 1VETB 5DF9A 1YAXA 1OTBA 4KZ8A 2Y2QA 3UE3A 5LBRA 3IH9A 2V8CA 2ZQ8A 4CJNA 2P9VA 3VP2A 1TF1A 1I5QA 4YFMA 2JBFA 3C4OA 2HP9A 2W3FA 2WK0A 1K0KA 4EBLA 4OLGA 5GLDA 1K6RA 3QNBA 5DTSA 2V8FA 1NRFA 3WS1A 1GHPA 3NC8A 4KZ4A 3CZDA 3ZG8B 4FTXA 4MEZA 2WKPA 2C6WB 4U0TA 3N8RA 4Z1WA 1NZUA 3MZDA 3GQZA 5IT5A 4JGRA 1EROA 2J9PA 2NUTC 1BUEA 5FI7A 1UWPX 2HPBA 1I2SA 3P7NA 1KE0A 5HD3A 3FPWA 4GN2A 1FR6A 1YSQA 1GA9A 2OSUA 3RXXA 4S2LA 3QP1A 1TDLA 5CGWA 3MQQA 4EUVA 3ZNTA 3NI9A 3VP3A 1M40A 4XXRA 1YLWA 3IF5A 2H0YA 1QMEA 1ERQA 4GDNA 1YT4A 1OMEA 3ISGA 3BFGA 5F68A 4I3JA 2Q0OA 1MKMA 3IX3A 3BEBA 3C5AA 3LUQA 2WAEA 4R3BA 2ZM2A 4LRXC 3E0YA 5FI2A 1BTLA 3IH8A 4GS9B 2Q9NA 4NKPA 4P0MA 3LIAA 3MZFA 2V20A 4DMZA 2ZQCA 5FQQA 3ZCZA 5F69A 1FOFA 4GD6A 1IYPA 1IYQA 3UB9A 3DTIA 2ZOIA 2ZMFA 3SH9A 3QP8A 3F1PB 3MBZA 2PR6A 2VLGA 4JLFA 5GL9A 1N9NA 1L0FA 4P6BA 5EVEA 3K3CA 4N1XA 2P74A 1XFQA 2Z2MA 3RFBA 5FSRA 1U60A 1A0KA 2A2LA 2A3UA 2I72A 2ZL1B 1GA0A 3P98A 5HX9A 4GNUA 1JTGA 1CF0A 1AWIA 3VP0A 5M19A 4GLQA 3SS4A 2XD5A 5AVEA 2WGWB 4QY5A 4EUZA 1OTEA 1PFLA 2GNXA 1RP5A 3KSHA 3IXDA 4XT2A 1G68A 3C7VA 1VHMA 2EA9A 3NDGA 4X55A 3HUNA 3PTEA 5HDCA 3T1RA 4QHCA 3P09A 1JVJA 4CLCA 3GVBA 1K57C 1N9BA 1W7FA 1YQSA 3R7WA 4D2OA 4S2OA 3SS3A 2L4RA 1NLYA 3HJIA 4WF0A 5EECA 5CECA 2YKFA 2JKFA 4HJ4A 1CI9A 5HDDA 3MZEA 5A90A 1VM1A 3KSIA 4EU0A 2ZJ9A 4G3WA 3G31A 1YM1A 5F82A 3NY4A 2VV8A 3HL9A 3FPVA 1ERMA 1GSXA 2J3TD 3WS4A 1FCMA 4BWIA 2J9OA 4L9EA 2A49A 2VGKA 4M4XA 3GECA 3V39A 5L2FA 1NJ4A 1KDWA 3IT9A 3PBOA 5I5LA 1S66L 3I7JA 3IF6B 1MC0A 1PZOA 3VP1A 4M3KA 2HGVA 4E3OA 4MNRA 4Y2FA 4QJGA 4GB7A 2GX5A 4DE3A 1JWZA 2XD1A 1S1YA 3Q82A 3CI6A 3A0VA 2M7VA 2XFSA 4JXSA 3CITA 2L0WA 2WGIA 1BSGA 1TS0A 4BL3A 1LI9A 1OJ5A 4GZBA 5EUAA 4JXVA 3LCEA 1LL9A 4UA6A 4IJGA 3BY9A 2ZQDA 3UB8A 4I5SA 3MKEA 1PW1A 3TG9A 3WS0A 2ZC7A 3IWIA 5KIZA 3BW6A 2VA0A 4WZ5A 5JYOA 1K56D 2HDUA 3DTMA 3IXGA 3WRTA 3G32A 4BBTA 3KYEA 1F5MA 2P9VB 1T19A 2KLIA 5DFYA 1YMSA 5EVIC 1ZHHB 3TW8A 1PWCA 2OOLA 2VEAA 3DWKA 3OCNA 3CMZA 2DRWA 2ZOHA 3BFEA 4JKTA 5CEDA 1RGYA 4KG2A 4IUKA 4OVDA 1STZA 5J8XA 3OCLA 3UPPA 1XA7A 3IXBA 3ZG0A 4EESA 1YSPA 1IOUA 3VE4A 4RX2A 4R38A 3EQVA 2MJ6A 1KOUA 1MKIA 4ARZB 3UDIA 2I9VA 1TDGA 3D72A 4LLOB 4DJ3A 3TRCA 4QD4A 4NXFA 3IBRA 2W1RA 3HLFA 5FEGA 1G5UA 3OPHA 1JWVA 1S1ZA 3S1YA 3SS5A 5HAQA 1K4FA 3C7UA 5MC7A 3VP4A 1K55C 4MMNA 1FCOA 3M6HA 4E3NA 4DKIA 1SCWA 1XX2A 1MBLA 2A24A 3NOPC 4EXOA 3S7NA 4X56A 3DWZA 1IKGA 2Y8HA 4QPRA 3FKWA 2QKPA 3U4LP 4B88A 2V2FF 4YOFA 5L8MA 3A3EA 2FZ0A 4UQIM 3UNWA 1DJAA 3ZQ5A 2WKEA 5EFWA 2XR0A 3UPOA 3FC7A 1ODVA 4JXGA 3CAXA 3W4OA 2XK1A 1YMXA 3EOIA 4UA9A 3LFVA 1OTAA 3UB5P 5HL1A 3T4JA 2Z2MB 4II7A 4IHQA 2ZM0A 3O5YA 4HQAA 5FATA 3HREA 2UV0E 4LV2A 3MF0A 5HW3A 3UPNA 3VMAA 3V50A 3M2JA 1BULA 4NETA 5HAPA 1VEUA 3H7WA 4XT2B 4MLLA 1W63M 5EPHA 1PI5A 5AJGA 2OWHA 3A0RA 1ES3A 4DE0A 4B93A 4MBHA 2DMWA 5FQKA 2V9AA 4CLCB 3ZVTA 2H0TA 1TVFA 1DJBA 2V1BA 3BJNA 4FSFA 3R7WB 3HUOA 4KZ9A 1K38A 3C8CA 4LV0A 1ESUA 1FSWA 2VV7A 1LLBA 4I3AA 4HY8A 1MWSA 1PYYA 5HSQA 4CLCD 4MBFA 1F9IA 4L9FA 1PZPA 3KYZA 2BASA 2E8IA 2JKGA 4EEUA 1P9WA 4ESPA 5DJUA 2VGLM 2HF6A 1XGJA 3VV4A 4BD0A 4GOGA 2X02A 3UDFA 1W8QA 3HLDA 5HARA 5A93A 3RJUA 2Z6CA 2ZC6B 1OTIA 4KZBA 5GHYA 3BM6A 4BENA 2CMNA 1YKDA 3Q7ZA 5IS1A 3BYDA 4LPZA 5GHZA 1OT9A 5L09A 4QY6A 2B95A 5EM1A 3LR5A 5EV0A 3ZDJA 4HJ3A 4NXBA 4HJ6A 2OWJA 2P04A 3WWXA 4OQHA 4UQIS 3NCKA 2J3WA 1W79A 2H28A 5CXWA 4KZ7A 4DF6A 4X1LA 3PAEA 1E3UA 2Y4AA 2Y2NA 2WYXA 3VFHA 3E4OA 4E3MA 2JCHA 1VQQA 2QYBA 5CGXA 3RXWA 1S0WA 4E3JA 4CLCE 4HIAA 1XJ3A 3Q1FA 4LV1A 1G6OA 3EEHA 4R6LA 1IKIA 4S2PA 3O86A 3QP5A 2O9CA 4HESA 4X68A 1Q2PA 3G4PA 3OLOA 2PDRA 3PXPA 4JPMA 1XJ6A 2EFXA 4X69A 3MXRA 4N9LA 4N9KA 3LICA 3S22A 2VK3A 3NBLA 2EXAA 3C30A 4Y7PA 1KE3A 4LV3A 2R9WA 4GD8A 5F1FA 4MN5A 3U2AA 3FZCA 2Y2OA 4KZ3A 2Y2MA 3N8LA 3W4PA 1H8ZA 1Z6FA 3LIDA 4UA7A 3GV9A 2HDRA 1ALQA 3G30A 2VGLS 3F1OA 3WS5A 2Y59A 4F3LA 3UN7A 1XFNA 3GDIA 4S2NC 5DTTA 2EX2A 3N4IA 4C75A 2Y2IA 1SKFA 5GLCA 4RYEA 3PBNA 2QJ7A 2VJWA 3VFFA 2A24B 2Y55A 1HLUP 1S67L 4IVKA 4DJ2A 3PBQA 2DCFA 1MZUA 2D01A 1C3BA 3MJQA 4Y0TA 4KG6A 2OAQ1 5E43A 4JXWA 5HL6A 4O8GA 4E04A 2ZD8A 5F83A 1DP8A 1M6KA 3ZFZA 1HD8A 4MN6A 1EW0A 1F2KA 2J7VA 2PYRA 5TJJA 1MY8A 4R4RA 2W3HA 5E2FA 1EI5A 3H9WA 4Y3IA 1YLTA 5TBMA 1NY0A 1RGZA 1GSWA 3IXHA 5EOEA 4UAAA 5FAPA 1D7EA 3LEQA 4GW9A 3F1NA 1YLYA 5HD5A 3EGXC 1H8MA 3BFCA 4JGQA 3NULA 3Q7VA 5CHJA 3E4PA 4CQHA 5CGSA 1KGEA 1NYMA 3N8SA 4JBFA 3NOUC 3D4FA 4ZTKA 1OPXA 1FIKA 2G2WA 5AVFA 4MCWA 1CEGA 1LT0A 3MXQA 5KSHA 1VEUB 4PM5A 3ITBA 5K5BA 3H7WB 1UGUA 1K54C 4NK3A 2ZQAA 4BJPA 3V67A 1ZC2A 5FA7A 1W63Q 1K25A 3FWLA 1Y28A 3GR2A 1PRQA 2W27A 1MWTA 1OJGA 2PD8A 3MQ0A 2O9AA 4PHTA 4S2KA 2Y91A 4K08A 4H6JA 1N4OA 4FCFA 3CUEC 5F5YA 2XA7M 2X01A 3EWKA 3T1XA 5I94A 2HDSA 3T1QB 3QP4A 1ONHA 4ID4A 4Y0UA 2M1CA 4LCMA 4R3AA 2Y2GA 2R78A 5AQBA 4DDSA 5GLAA 5FI6A 1IYSA 4LFUA 1PI4A 4R4SA 2NUPC 3KYQA 5HWVA 1GCEA 2H10A 5FASA 1H3QA 2C5WB 4N92A 5FQJA 1S6RA 5HFOA 1FCNA 4DXCA 4FOFA 4GKUA 1TS7A 2PU2A 4DXBA 2W3GA
chains in the Genus database with same CATH topology
4JXGA 2BG1A 5TFQA 1GHMA 3W4OA 3ZVWA 5EVLA 2XK1A 2OLVA 1YMXA 3WS2A 2ZC3A 4KZ8A 4R3JA 2QMIA 2Y2QA 3UE3A 5KSCA 3IH9A 3CJMA 1J9MA 3CG5A 4UA9A 4K91A 1FSYA 2ZQ8A 1JWPA 4CJNA 1BLSA 2P9VA 5HL1A 2Z2MB 4WMCA 1L0DA 3G34A 3VP2A 4FD8A 1I5QA 4YFMA 1PWGA 1DJCA 2ZM0A 5IHVA 1CK3A 1XGIA 2JBFA 3C4OA 3AGDA 4O7DA 3Q81A 4K0XA 5FATA 3HREA 2HP9A 4LV2A 2WK0A 4EBLA 4OLGA 5HW3A 4WYYA 5GLDA 1K6RA 2VGJA 3QNBA 4OPRA 1H5XA 5DTSA 1NRFA 3UPNA 3VMAA 4CPKA 4E6WA 4U3TA 3WS1A 1GHPA 3V50A 2GDNA 3M2JA 3NC8A 4KZ4A 4EQIA 1BULA 3FKVA 5KZHA 3CZDA 4WM9A 4NETA 3ZG8B 3ZNYA 4MEZA 5HAPA 5CHMA 4B4ZA 2XF3A 1ONGA 2C6WB 4L0LA 4U0TA 4MLLA 3N8RA 3G35A 1NZUA 3MZDA 3TOIA 3GQZA 3Q07A 1PI5A 5EPHA 4WZ4A 1FQGA 5CTNA 3W4QA 3LY4A 4BL2A 1WE4A 1ES3A 4DE0A 3BFFA 4MBHA 4BLMA 5FQKA 1EROA 2J9PA 2WADA 4JF4A 5DVAA 1BUEA 3ZVTA 1E4DA 2FFYA 2H0TA 5FI7A 1ESIA 4P87A 3BFDA 1TVFA 2XGNA 1DJBA 1E3UD 1O7EA 3BECA 2HPBA 4FSFA 1ZG4A 3UE0A 2ZC4B 3FV7A 3G2YA 3HLEA 1I2SA 1MXOA 3HUOA 4KZ9A 1KE0A 3W8KA 3ZG9B 1K38A 2XEPA 4PM7A 4GN2A 4LV0A 1FR6A 5BOHA 1ESUA 1GA9A 2OSUA 3RXXA 1FSWA 2PU4A 1LLBA 4S2LA 1TDLA 2IWDA 5CGWA 5CERA 1SDNA 4ZJ3A 1MWSA 1PYYA 3ZNTA 3IHBA 3NI9A 4LCLA 4MBFA 1L0GA 1PZPA 1IEMA 3VP3A 2UWXA 1M40A 1WYBA 5FQ9A 4XXRA 1BT5A 2E8IA 1YLWA 3IF5A 3FYZA 2H0YA 1K57A 1QMEA 3HLGA 1ERQA 2G2UA 2RCXA 4GDNA 1KDSA 2JC7A 1YT4A 4KENB 5EVIB 1CI8A 1XA1A 5CRFA 5E2GA 1OMEA 3ISGA 1W8YA 3BFGA 2ZM8A 2XQZA 1IELA 1HVBA 1XGJA 3DW0A 2EX8A 5AQAA 3SH7A 2ZC5B 2Y2JA 4BD0A 3BEBA 3PAGA 2X02A 3C5AA 4GOGA 2WAEA 4R3BA 3UDFA 3HBRA 2ZM2A 1W8QA 5FI2A 2WZZA 3NIAA 5CHUA 3HLDA 1KE4A 5HARA 5A93A 1BTLA 3TSGA 3IH8A 5FQMA 3RJUA 4IVIA 2Q9NA 2ZC6B 3LO7A 4P0MA 1LHYA 3MZFA 2V20A 3JYIA 1TEMA 5EVID 4KZBA 4PM9A 5GHYA 2ZQCA 3BM6A 5FQQA 3ZCZA 4R1GA 2X71A 4S2JA 4BENA 1FOFA 2Z2LB 4GD6A 3Q7ZA 1IYPA 1IYQA 3BYDA 1HTZA 1ZG6A 3B3XA 5AQ7A 5GHZA 3V5MA 4PMAA 3ITAA 1BLHA 3SH9A 4QY6A 1MPLA 5M1AA 2XH9A 4KQQA 3MBZA 1XKZA 2XFTA 1YLPA 3ZDJA 2R9XA 4JLFA 5GL9A 1L0FA 3HLCA 4P6BA 4WEJA 5DTKA 3PBTA 3WWXA 4N1XA 2P74A 4OQHA 4K0WA 2B5RA 2Z2MA 5FSRA 4R23A 1U60A 1PIOA 2Y2KA 4HBTA 2A3UA 3NCKA 2I72A 3VSLA 3P98A 1GA0A 5HX9A 4GNUA 1JTGA 3VP0A 5M19A 3SS4A 1W79A 2XD5A 5CXWA 4QB8A 3VSKA 2EX6A 4KZ7A 2WGWB 4DF6A 4QY5A 4EUZA 4C3QA 3IF6C 1ES2A 3IWQA 1ES5A 4S2NA 3PAEA 2IWBA 1E3UA 4OONA 5DF7A 3MKFA 1RP5A 4E3IA 2Y4AA 1YLJA 2PBYA 3OPLA 2Y2NA 3IXDA 3IHAA 2WYXA 5FAOA 1WYCA 2HP5A 5TR7A 3ZG5A 4E6XA 3A3FA 1G68A 3C7VA 3VFHA 1LL5A 4X55A 3NDGA 4E3MA 3HUNA 2JCHA 4JF6A 1VQQA 3PTEA 3OZHA 5E2HA 4OLDA 4QHCA 5CGXA 3RXWA 3P09A 1JVJA 4IEDA 3GVBA 1S0WA 1K57C 2WGVA 1N9BA 1W7FA 1YQSA 4OQIA 5E2EA 4GDBA 4E3JA 4D2OA 4QU3A 2ZC4A 4FH2A 4E3LA 4S2OA 3SS3A 5HAIA 4EBNA 5CECA 5EECA 3Q1FA 3AGFA 4LV1A 4YINA 5M18A 3PBSA 1CI9A 4X53A 3Q7VB 3MZEA 5EOOA 5A90A 4Y0OA 2OV5A 1VM1A 2WUQA 4OP8A 4N1HA 2ZJ9A 1IKIA 4S2PA 4WELA 2RL3A 3O86A 1KVMA 3G31A 1YM1A 5F82A 4A5RA 1PWDA 3NY4A 4P85A 1I2WA 3GSGA 4HESA 2DNSA 4KZ5A 3UO9A 2J8YA 3HL9A 4X68A 1ERMA 1Y54A 1Q2PA 3G4PA 4EWFA 3BLSA 3WS4A 1FCMA 1MWUA 2J9OA 4JPMA 2A49A 4C6YA 4EBPA 2VGKA 2EFXA 3MFDA 5EVIA 3V39A 5L2FA 4X69A 3MXRA 1NJ4A 1KDWA 2WKHA 3IT9A 4S2IA 3PBOA 4N9LA 5FDHA 4N9KA 2Y2HA 3I7JA 2HDQA 3IF6B 3A3JA 4DE1A 3S22A 4KZ6A 3NBLA 1PZOA 2EXAA 4OQGA 4OPZA 4U0XA 3VP1A 4Y7PA 4BD1A 1IYOA 1KE3A 4M3KA 3LEZA 4LV3A 2R9WA 4GD8A 5F1FA 4E3OA 3BLMA 4MNRA 3FZCA 5AQ9A 3M6BA 3O88A 2Y2OA 3N7WA 1DY6A 1K4EA 2Y2PA 4KZ3A 5U47A 2Y2MA 3N8LA 3W4PA 1K54A 3O87A 1H8ZA 1Z6FA 5F1GA 4HEFA 4UA7A 4QJGA 2Z2LA 4GB7A 3GV9A 2HDRA 1ALQA 3G30A 3HVFA 5A92A 3LY3A 4DE3A 1JWZA 2XD1A 3WS5A 2Y59A 4BQMA 4ZJ1A 1NYYA 3UN7A 3Q82A 4OOMA 2EFUA 1NXYA 1MWRA 4F94A 4S2NC 5DTTA 4RA7A 2EX2A 2H5SA 1FR1A 3N4IA 4OH0A 2Y2IA 3ZG7B 4C75A 1SKFA 5GLCA 4RYEA 3PBNA 2XFSA 4JXSA 4R0QA 3VFFA 1H8YA 2Y55A 2WGIA 3ZGAB 1BSGA 3C4PA 3O3VA 4JF5A 4BL3A 4ZAMA 4IVKA 4OKPA 1LI9A 2IWCA 3PBQA 1O07A 2XDMA 2DCFA 3GRJA 1ES4A 4DE2A 1C3BA 5CEBA 4GZBA 5EUAA 4JXVA 3LCEA 4B4XA 1LL9A 4UA6A 3OPPA 2BLSA 4Y0TA 1HZOA 3EQUA 1K55A 2WGWA 4KG6A 4PM8A 4IBRA 5E43A 4JXWA 2ZQDA 4PM6A 3E2KA 1XP4A 2ZD8A 5F83A 1M6KA 3MKEA 1HD8A 3ZFZA 1PW1A 2J7VA 1W5DA 3HUMA 3TG9A 3ZHHA 1MY8A 3WS0A 3NDEA 3GMWA 2ZC7A 3G2ZA 4R4RA 2OLUA 4H8RA 4MBKA 4PPRA 1KGGA 2CC1A 3IWIA 5G18A 2V1ZA 4LENA 5E2FA 4WZ5A 1EI5A 1YLZA 2ZC3B 5JYOA 1K56D 1YLTA 2HDUA 4XUXA 1JTDA 1NY0A 1RGZA 3DTMA 3IXGA 2QPNA 3IXHA 5EOEA 4UAAA 3WRTA 3G32A 4UHUA 2ZLYA 2ZQ9A 5FAPA 1E25A 3IQAA 4DRTA 3SH8A 2P9VB 1BZAA 4KG5A 3UE1A 2QZ6A 2WAFA 3IWOA 1YMSA 1YLYA 3PBRA 5EVIC 1XXMA 1PWCA 1KVLA 3DWKA 3BFCA 4Q8IA 3OCNA 4KQOA 3GTCA 1GHIA 3CMZA 1QMFA 2DRWA 3Q7VA 3BFEA 4JKTA 3S4XA 5CHJA 5EE8A 3M2KA 5CEDA 1RGYA 5CGSA 1KGEA 1NYMA 4KG2A 2EXBA 1KGFA 3N8SA 4JBFA 3D4FA 4ZTKA 4OVDA 5GLBA 4EV4A 2G2WA 5J8XA 1PW8A 3OCLA 3UPPA 1CEGA 1XA7A 4WMCD 5KSHA 2ZQ7A 4PM5A 3IXBA 4XUZA 3OPRA 3ITBA 3ZG0A 1K54C 4NK3A 1NZOA 2ZQAA 4OOLA 1SDEA 4RX2A 4BJPA 3A3DA 1XPBA 3EQVA 1ZC2A 5A91A 4Z9QA 1Q2QA 5DF8A 1MKIA 1G6AA 3IF6A 2ZMAA 3UDIA 5FA7A 5JYPA 2JE5A 3N6IA 1K25A 3FWLA 5TGFA 4OQ0A 1TDGA 1LI0A 3GR2A 1EWZA 5FAQA 4OOYA 4ZBEA 4HBUA 1MWTA 4KZAA 3UDXA 4QD4A 3V3SA 4S2KA 4WBGA 2Y91A 4IBXA 1L2SA 1L0EA 3HLFA 4S2MA 2Y2LA 2XLNA 1N4OA 4FCFA 2WKIA 1BLPA 5KMWA 5FQIA 3WRZA 3OPHA 4OP5A 1JWVA 4OPQA 3S1YA 3SS5A 2FFFB 4E3KA 3VOZA 5HAQA 3QNCA 1K4FA 3C7UA 5CTMA 5GHXA 3SOIA 1CEFA 2X01A 4ZDXA 3BRMA 3VP4A 1K55C 5I94A 2HDSA 1SHVA 1FCOA 1K6SA 3M6HA 1ONHA 1ZKJA 4ID4A 4Y0UA 4E3NA 4DKIA 1SCWA 1XX2A 4OPYA 4RX3A 1MBLA 3HLWA 4LCMA 4X6TA 3V3RA 4X56A 3DWZA 2Y2GA 4DDSA 5AQBA 4WZ5C 3MXSA 5GLAA 4WEKA 1AXBA 1IKGA 3A3IA 5FI6A 1BLCA 4DDYA 4ZJ2A 3OC2A 1IYSA 2HP6A 3FKWA 4KQRA 1PI4A 4R4SA 4B88A 3HLBA 4FH4A 1K56A 3VOYA 1GCEA 2WZXA 2V2FF 2H10A 2Q9MA 3A3EA 3UY6A 5FASA 4RVAA 3UNWA 3QHYA 2C5WB 2EX9A 1DJAA 4N92A 5FQJA 2WKEA 1S6RA 5HFOA 1FCNA 4DXCA 1RCJA 3AGEA 3E2LA 4GKUA 2PU2A 2XR0A 5DF9A 4DXBA 3UPOA 5D3OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JXG A;  2BG1 A;  5TFQ A;  1GHM A;  3W4O A;  3ZVW A;  5EVL A;  2XK1 A;  2OLV A;  1YMX A;  3WS2 A;  2ZC3 A;  4KZ8 A;  4R3J A;  2QMI A;  2Y2Q A;  3UE3 A;  5KSC A;  3IH9 A;  3CJM A;  1J9M A;  3CG5 A;  4UA9 A;  4K91 A;  1FSY A;  2ZQ8 A;  1JWP A;  4CJN A;  1BLS A;  2P9V A;  5HL1 A;  2Z2M B;  4WMC A;  1L0D A;  3G34 A;  3VP2 A;  4FD8 A;  1I5Q A;  4YFM A;  1PWG A;  1DJC A;  2ZM0 A;  5IHV A;  1CK3 A;  1XGI A;  2JBF A;  3C4O A;  3AGD A;  4O7D A;  3Q81 A;  4K0X A;  5FAT A;  3HRE A;  2HP9 A;  4LV2 A;  2WK0 A;  4EBL A;  4OLG A;  5HW3 A;  4WYY A;  5GLD A;  1K6R A;  2VGJ A;  3QNB A;  4OPR A;  1H5X A;  5DTS A;  1NRF A;  3UPN A;  3VMA A;  4CPK A;  4E6W A;  4U3T A;  3WS1 A;  1GHP A;  3V50 A;  2GDN A;  3M2J A;  3NC8 A;  4KZ4 A;  4EQI A;  1BUL A;  3FKV A;  5KZH A;  3CZD A;  4WM9 A;  4NET A;  3ZG8 B;  3ZNY A;  4MEZ A;  5HAP A;  5CHM A;  4B4Z A;  2XF3 A;  1ONG A;  2C6W B;  4L0L A;  4U0T A;  4MLL A;  3N8R A;  3G35 A;  1NZU A;  3MZD A;  3TOI A;  3GQZ A;  3Q07 A;  1PI5 A;  5EPH A;  4WZ4 A;  1FQG A;  5CTN A;  3W4Q A;  3LY4 A;  4BL2 A;  1WE4 A;  1ES3 A;  4DE0 A;  3BFF A;  4MBH A;  4BLM A;  5FQK A;  1ERO A;  2J9P A;  2WAD A;  4JF4 A;  5DVA A;  1BUE A;  3ZVT A;  1E4D A;  2FFY A;  2H0T A;  5FI7 A;  1ESI A;  4P87 A;  3BFD A;  1TVF A;  2XGN A;  1DJB A;  1E3U D;  1O7E A;  3BEC A;  2HPB A;  4FSF A;  1ZG4 A;  3UE0 A;  2ZC4 B;  3FV7 A;  3G2Y A;  3HLE A;  1I2S A;  1MXO A;  3HUO A;  4KZ9 A;  1KE0 A;  3W8K A;  3ZG9 B;  1K38 A;  2XEP A;  4PM7 A;  4GN2 A;  4LV0 A;  1FR6 A;  5BOH A;  1ESU A;  1GA9 A;  2OSU A;  3RXX A;  1FSW A;  2PU4 A;  1LLB A;  4S2L A;  1TDL A;  2IWD A;  5CGW A;  5CER A;  1SDN A;  4ZJ3 A;  1MWS A;  1PYY A;  3ZNT A;  3IHB A;  3NI9 A;  4LCL A;  4MBF A;  1L0G A;  1PZP A;  1IEM A;  3VP3 A;  2UWX A;  1M40 A;  1WYB A;  5FQ9 A;  4XXR A;  1BT5 A;  2E8I A;  1YLW A;  3IF5 A;  3FYZ A;  2H0Y A;  1K57 A;  1QME A;  3HLG A;  1ERQ A;  2G2U A;  2RCX A;  4GDN A;  1KDS A;  2JC7 A;  1YT4 A;  4KEN B;  5EVI B;  1CI8 A;  1XA1 A;  5CRF A;  5E2G A;  1OME A;  3ISG A;  1W8Y A;  3BFG A;  2ZM8 A;  2XQZ A;  1IEL A;  1HVB A;  1XGJ A;  3DW0 A;  2EX8 A;  5AQA A;  3SH7 A;  2ZC5 B;  2Y2J A;  4BD0 A;  3BEB A;  3PAG A;  2X02 A;  3C5A A;  4GOG A;  2WAE A;  4R3B A;  3UDF A;  3HBR A;  2ZM2 A;  1W8Q A;  5FI2 A;  2WZZ A;  3NIA A;  5CHU A;  3HLD A;  1KE4 A;  5HAR A;  5A93 A;  1BTL A;  3TSG A;  3IH8 A;  5FQM A;  3RJU A;  4IVI A;  2Q9N A;  2ZC6 B;  3LO7 A;  4P0M A;  1LHY A;  3MZF A;  2V20 A;  3JYI A;  1TEM A;  5EVI D;  4KZB A;  4PM9 A;  5GHY A;  2ZQC A;  3BM6 A;  5FQQ A;  3ZCZ A;  4R1G A;  2X71 A;  4S2J A;  4BEN A;  1FOF A;  2Z2L B;  4GD6 A;  3Q7Z A;  1IYP A;  1IYQ A;  3BYD A;  1HTZ A;  1ZG6 A;  3B3X A;  5AQ7 A;  5GHZ A;  3V5M A;  4PMA A;  3ITA A;  1BLH A;  3SH9 A;  4QY6 A;  1MPL A;  5M1A A;  2XH9 A;  4KQQ A;  3MBZ A;  1XKZ A;  2XFT A;  1YLP A;  3ZDJ A;  2R9X A;  4JLF A;  5GL9 A;  1L0F A;  3HLC A;  4P6B A;  4WEJ A;  5DTK A;  3PBT A;  3WWX A;  4N1X A;  2P74 A;  4OQH A;  4K0W A;  2B5R A;  2Z2M A;  5FSR A;  4R23 A;  1U60 A;  1PIO A;  2Y2K A;  4HBT A;  2A3U A;  3NCK A;  2I72 A;  3VSL A;  3P98 A;  1GA0 A;  5HX9 A;  4GNU A;  1JTG A;  3VP0 A;  5M19 A;  3SS4 A;  1W79 A;  2XD5 A;  5CXW A;  4QB8 A;  3VSK A;  2EX6 A;  4KZ7 A;  2WGW B;  4DF6 A;  4QY5 A;  4EUZ A;  4C3Q A;  3IF6 C;  1ES2 A;  3IWQ A;  1ES5 A;  4S2N A;  3PAE A;  2IWB A;  1E3U A;  4OON A;  5DF7 A;  3MKF A;  1RP5 A;  4E3I A;  2Y4A A;  1YLJ A;  2PBY A;  3OPL A;  2Y2N A;  3IXD A;  3IHA A;  2WYX A;  5FAO A;  1WYC A;  2HP5 A;  5TR7 A;  3ZG5 A;  4E6X A;  3A3F A;  1G68 A;  3C7V A;  3VFH A;  1LL5 A;  4X55 A;  3NDG A;  4E3M A;  3HUN A;  2JCH A;  4JF6 A;  1VQQ A;  3PTE A;  3OZH A;  5E2H A;  4OLD A;  4QHC A;  5CGX A;  3RXW A;  3P09 A;  1JVJ A;  4IED A;  3GVB A;  1S0W A;  1K57 C;  2WGV A;  1N9B A;  1W7F A;  1YQS A;  4OQI A;  5E2E A;  4GDB A;  4E3J A;  4D2O A;  4QU3 A;  2ZC4 A;  4FH2 A;  4E3L A;  4S2O A;  3SS3 A;  5HAI A;  4EBN A;  5CEC A;  5EEC A;  3Q1F A;  3AGF A;  4LV1 A;  4YIN A;  5M18 A;  3PBS A;  1CI9 A;  4X53 A;  3Q7V B;  3MZE A;  5EOO A;  5A90 A;  4Y0O A;  2OV5 A;  1VM1 A;  2WUQ A;  4OP8 A;  4N1H A;  2ZJ9 A;  1IKI A;  4S2P A;  4WEL A;  2RL3 A;  3O86 A;  1KVM A;  3G31 A;  1YM1 A;  5F82 A;  4A5R A;  1PWD A;  3NY4 A;  4P85 A;  1I2W A;  3GSG A;  4HES A;  2DNS A;  4KZ5 A;  3UO9 A;  2J8Y A;  3HL9 A;  4X68 A;  1ERM A;  1Y54 A;  1Q2P A;  3G4P A;  4EWF A;  3BLS A;  3WS4 A;  1FCM A;  1MWU A;  2J9O A;  4JPM A;  2A49 A;  4C6Y A;  4EBP A;  2VGK A;  2EFX A;  3MFD A;  5EVI A;  3V39 A;  5L2F A;  4X69 A;  3MXR A;  1NJ4 A;  1KDW A;  2WKH A;  3IT9 A;  4S2I A;  3PBO A;  4N9L A;  5FDH A;  4N9K A;  2Y2H A;  3I7J A;  2HDQ A;  3IF6 B;  3A3J A;  4DE1 A;  3S22 A;  4KZ6 A;  3NBL A;  1PZO A;  2EXA A;  4OQG A;  4OPZ A;  4U0X A;  3VP1 A;  4Y7P A;  4BD1 A;  1IYO A;  1KE3 A;  4M3K A;  3LEZ A;  4LV3 A;  2R9W A;  4GD8 A;  5F1F A;  4E3O A;  3BLM A;  4MNR A;  3FZC A;  5AQ9 A;  3M6B A;  3O88 A;  2Y2O A;  3N7W A;  1DY6 A;  1K4E A;  2Y2P A;  4KZ3 A;  5U47 A;  2Y2M A;  3N8L A;  3W4P A;  1K54 A;  3O87 A;  1H8Z A;  1Z6F A;  5F1G A;  4HEF A;  4UA7 A;  4QJG A;  2Z2L A;  4GB7 A;  3GV9 A;  2HDR A;  1ALQ A;  3G30 A;  3HVF A;  5A92 A;  3LY3 A;  4DE3 A;  1JWZ A;  2XD1 A;  3WS5 A;  2Y59 A;  4BQM A;  4ZJ1 A;  1NYY A;  3UN7 A;  3Q82 A;  4OOM A;  2EFU A;  1NXY A;  1MWR A;  4F94 A;  4S2N C;  5DTT A;  4RA7 A;  2EX2 A;  2H5S A;  1FR1 A;  3N4I A;  4OH0 A;  2Y2I A;  3ZG7 B;  4C75 A;  1SKF A;  5GLC A;  4RYE A;  3PBN A;  2XFS A;  4JXS A;  4R0Q A;  3VFF A;  1H8Y A;  2Y55 A;  2WGI A;  3ZGA B;  1BSG A;  3C4P A;  3O3V A;  4JF5 A;  4BL3 A;  4ZAM A;  4IVK A;  4OKP A;  1LI9 A;  2IWC A;  3PBQ A;  1O07 A;  2XDM A;  2DCF A;  3GRJ A;  1ES4 A;  4DE2 A;  1C3B A;  5CEB A;  4GZB A;  5EUA A;  4JXV A;  3LCE A;  4B4X A;  1LL9 A;  4UA6 A;  3OPP A;  2BLS A;  4Y0T A;  1HZO A;  3EQU A;  1K55 A;  2WGW A;  4KG6 A;  4PM8 A;  4IBR A;  5E43 A;  4JXW A;  2ZQD A;  4PM6 A;  3E2K A;  1XP4 A;  2ZD8 A;  5F83 A;  1M6K A;  3MKE A;  1HD8 A;  3ZFZ A;  1PW1 A;  2J7V A;  1W5D A;  3HUM A;  3TG9 A;  3ZHH A;  1MY8 A;  3WS0 A;  3NDE A;  3GMW A;  2ZC7 A;  3G2Z A;  4R4R A;  2OLU A;  4H8R A;  4MBK A;  4PPR A;  1KGG A;  2CC1 A;  3IWI A;  5G18 A;  2V1Z A;  4LEN A;  5E2F A;  4WZ5 A;  1EI5 A;  1YLZ A;  2ZC3 B;  5JYO A;  1K56 D;  1YLT A;  2HDU A;  4XUX A;  1JTD A;  1NY0 A;  1RGZ A;  3DTM A;  3IXG A;  2QPN A;  3IXH A;  5EOE A;  4UAA A;  3WRT A;  3G32 A;  4UHU A;  2ZLY A;  2ZQ9 A;  5FAP A;  1E25 A;  3IQA A;  4DRT A;  3SH8 A;  2P9V B;  1BZA A;  4KG5 A;  3UE1 A;  2QZ6 A;  2WAF A;  3IWO A;  1YMS A;  1YLY A;  3PBR A;  5EVI C;  1XXM A;  1PWC A;  1KVL A;  3DWK A;  3BFC A;  4Q8I A;  3OCN A;  4KQO A;  3GTC A;  1GHI A;  3CMZ A;  1QMF A;  2DRW A;  3Q7V A;  3BFE A;  4JKT A;  3S4X A;  5CHJ A;  5EE8 A;  3M2K A;  5CED A;  1RGY A;  5CGS A;  1KGE A;  1NYM A;  4KG2 A;  2EXB A;  1KGF A;  3N8S A;  4JBF A;  3D4F A;  4ZTK A;  4OVD A;  5GLB A;  4EV4 A;  2G2W A;  5J8X A;  1PW8 A;  3OCL A;  3UPP A;  1CEG A;  1XA7 A;  4WMC D;  5KSH A;  2ZQ7 A;  4PM5 A;  3IXB A;  4XUZ A;  3OPR A;  3ITB A;  3ZG0 A;  1K54 C;  4NK3 A;  1NZO A;  2ZQA A;  4OOL A;  1SDE A;  4RX2 A;  4BJP A;  3A3D A;  1XPB A;  3EQV A;  1ZC2 A;  5A91 A;  4Z9Q A;  1Q2Q A;  5DF8 A;  1MKI A;  1G6A A;  3IF6 A;  2ZMA A;  3UDI A;  5FA7 A;  5JYP A;  2JE5 A;  3N6I A;  1K25 A;  3FWL A;  5TGF A;  4OQ0 A;  1TDG A;  1LI0 A;  3GR2 A;  1EWZ A;  5FAQ A;  4OOY A;  4ZBE A;  4HBU A;  1MWT A;  4KZA A;  3UDX A;  4QD4 A;  3V3S A;  4S2K A;  4WBG A;  2Y91 A;  4IBX A;  1L2S A;  1L0E A;  3HLF A;  4S2M A;  2Y2L A;  2XLN A;  1N4O A;  4FCF A;  2WKI A;  1BLP A;  5KMW A;  5FQI A;  3WRZ A;  3OPH A;  4OP5 A;  1JWV A;  4OPQ A;  3S1Y A;  3SS5 A;  2FFF B;  4E3K A;  3VOZ A;  5HAQ A;  3QNC A;  1K4F A;  3C7U A;  5CTM A;  5GHX A;  3SOI A;  1CEF A;  2X01 A;  4ZDX A;  3BRM A;  3VP4 A;  1K55 C;  5I94 A;  2HDS A;  1SHV A;  1FCO A;  1K6S A;  3M6H A;  1ONH A;  1ZKJ A;  4ID4 A;  4Y0U A;  4E3N A;  4DKI A;  1SCW A;  1XX2 A;  4OPY A;  4RX3 A;  1MBL A;  3HLW A;  4LCM A;  4X6T A;  3V3R A;  4X56 A;  3DWZ A;  2Y2G A;  4DDS A;  5AQB A;  4WZ5 C;  3MXS A;  5GLA A;  4WEK A;  1AXB A;  1IKG A;  3A3I A;  5FI6 A;  1BLC A;  4DDY A;  4ZJ2 A;  3OC2 A;  1IYS A;  2HP6 A;  3FKW A;  4KQR A;  1PI4 A;  4R4S A;  4B88 A;  3HLB A;  4FH4 A;  1K56 A;  3VOY A;  1GCE A;  2WZX A;  2V2F F;  2H10 A;  2Q9M A;  3A3E A;  3UY6 A;  5FAS A;  4RVA A;  3UNW A;  3QHY A;  2C5W B;  2EX9 A;  1DJA A;  4N92 A;  5FQJ A;  2WKE A;  1S6R A;  5HFO A;  1FCN A;  4DXC A;  1RCJ A;  3AGE A;  3E2L A;  4GKU A;  2PU2 A;  2XR0 A;  5DF9 A;  4DXB A;  3UPO A;  5D3O A; 
#chains in the Genus database with same CATH topology
 5EM0 A;  3ZVW A;  2ZC3 A;  2QMI A;  3NOT C;  5KSC A;  2INW A;  4Q0I A;  1J9M A;  3CG5 A;  4K91 A;  3RTY A;  1L0D A;  3G34 A;  1DJC A;  1SZV A;  1CK3 A;  1V9Z A;  2O0Y A;  1NLZ A;  4O7D A;  3Q81 A;  2O99 A;  3T4O A;  4MN7 A;  3TJZ C;  4MDZ A;  3ZYT A;  2VGJ A;  4BBU A;  4HNB A;  4CPK A;  4U3T A;  1S4R A;  4NG2 A;  1SKO A;  2PHY A;  4BBV A;  4B4Z A;  1ONG A;  3W2Z A;  4L0L A;  3SZT A;  3SW1 A;  3G35 A;  1V9Y A;  3TOI A;  1FIL A;  3Q07 A;  3W4Q A;  1WE4 A;  3T4K A;  4B9O A;  4WL9 A;  4EEP A;  4DN0 A;  1E4D A;  2FFY A;  1ESI A;  3BFD A;  2XGN A;  1E3U D;  1O7E A;  5G4Y A;  1CQA A;  1ZG4 A;  3G2Y A;  3HLE A;  1MXO A;  3W8K A;  3ZG9 B;  2XEP A;  3BQ8 A;  4HP4 A;  2IWD A;  1SDN A;  3UB6 A;  3IHB A;  3NEC A;  4I3I A;  1L0G A;  2UWX A;  4HP9 A;  5FQ9 A;  1BT5 A;  2VV6 A;  1K57 A;  4KQD A;  1N9L A;  4GCZ A;  1KDS A;  2V1A A;  4KEN B;  1CI8 A;  1XA1 A;  5CRF A;  5E2G A;  3P01 A;  1F98 A;  1IEL A;  1HVB A;  3DW0 A;  3MSH A;  3SH7 A;  2Y2J A;  4EER A;  3KO6 A;  3HBR A;  2WZZ A;  3NIA A;  5CHU A;  1KE4 A;  3RH8 B;  3TSG A;  2XA7 S;  3LO7 A;  1LHY A;  3JYI A;  2JKT M;  1H0M A;  1G28 A;  4P6Z M;  4R1G A;  1ZG6 A;  3F1O B;  3B3X A;  5AQ7 A;  3V5M A;  4F3L B;  4PMA A;  3D3O A;  2BTF P;  1BLH A;  2XRO A;  4LRZ E;  3UE6 A;  1MPL A;  5M1A A;  3MFX A;  4KQQ A;  1XKZ A;  2XFT A;  1YLP A;  2R9X A;  4WLA A;  3CUE A;  5DTK A;  2V0U A;  1T1A A;  4K0W A;  3LI9 A;  1UWN X;  4R23 A;  2ACG A;  4HBT A;  3VSL A;  3HJK A;  4AFI A;  4QB8 A;  3VSK A;  1ES2 A;  3IWQ A;  3LR3 A;  4OON A;  1YLJ A;  3DTK A;  1LSV A;  3IHA A;  1WYC A;  2HP5 A;  4E6X A;  1D1J A;  1VB6 A;  2P7J A;  3A3F A;  2PRF A;  1LL5 A;  3R4K A;  3CPT A;  2QJ5 A;  3OZH A;  5TBM B;  2PD7 A;  4IED A;  2W3E A;  2WGV A;  4QU3 A;  2GZA A;  2PYP A;  3F1N B;  2ZC4 A;  4FH2 A;  4E3L A;  5HAI A;  3CWF A;  4O01 A;  4YIN A;  3C2W A;  3T50 A;  3Q7V B;  4Y0O A;  2WUQ A;  4N1H A;  2W1T A;  4PAU A;  4WEL A;  1KVM A;  1PWD A;  3T12 B;  1I2W A;  1T1B A;  3T4S A;  2E8J A;  3GSG A;  2DNS A;  4O0P A;  3UO9 A;  1CJF A;  2JHE A;  4YWZ A;  4EWF A;  3BLS A;  4C6Y A;  5EVI A;  4QWO A;  4LRY C;  2KOI A;  2WKH A;  2LB9 A;  4DE1 A;  4Y13 A;  4KZ6 A;  4OQG A;  4OPZ A;  3LEZ A;  2ZBB A;  3QP2 A;  3B42 A;  3O88 A;  4H6J B;  4ZRR A;  1DY6 A;  1K4E A;  2Y2P A;  3K3D A;  5F1G A;  4HEF A;  2Z2L A;  3VE3 A;  5A92 A;  4LGW A;  4BQM A;  1OTD A;  2PAV P;  4OOM A;  2EFU A;  1MWR A;  3B47 A;  4F94 A;  4RA7 A;  2H5S A;  2YKH A;  3ZG7 B;  2PR5 A;  1P0Z A;  2EWW A;  3LR0 A;  1H8Y A;  3ZGA B;  3O3V A;  4X1M A;  2KDK A;  4BMW A;  4P6Z S;  2XDM A;  1ES4 A;  4HI4 A;  3IBJ A;  2BLS A;  1K55 A;  1JNU A;  4PM6 A;  4WN5 A;  5DKK A;  1W5D A;  2HV1 A;  4HHD A;  3NDE A;  1XJ2 A;  3GMW A;  3G2Z A;  3H82 A;  4H8R A;  4MBK A;  1KGG A;  2LB5 A;  2ZC3 B;  4XUX A;  1JTD A;  5HWW A;  2QPN A;  3CLO A;  4FUW A;  4UHU A;  4DRT A;  3IQA A;  3DBA A;  1BZA A;  4KG5 A;  3UE1 A;  2JKR I;  3E98 A;  2QZ6 A;  3PBR A;  1XXM A;  4Q8I A;  4Q0J A;  2K2N A;  3ULF A;  1QMF A;  2J80 A;  5IU1 A;  4D60 A;  2GJ3 A;  5EE8 A;  4HOI A;  4EV4 A;  4GHI A;  2O9B A;  2JKR M;  5J3W A;  1SKO B;  2ZQ7 A;  4XUZ A;  3HCY A;  3LI8 A;  2HZ5 A;  4ARZ A;  1NZO A;  4OOL A;  5HDS A;  1XPB A;  3S7Q A;  2ZMA A;  3MS6 A;  3N6I A;  4OQ0 A;  2XSS A;  1LI0 A;  1BYW A;  4OOY A;  4PKY A;  3UB7 A;  2OAP 1;  4KZA A;  2V0W A;  4IBX A;  1L2S A;  1L0E A;  4S2M A;  2Y2L A;  2XLN A;  2WKI A;  1OT6 A;  3BY8 A;  3WRZ A;  3IS2 A;  4E3K A;  2FFF B;  3VOZ A;  5GHX A;  4GJ4 A;  4ZDX A;  2K7S A;  4ETX A;  1LSX A;  1SHV A;  1K6S A;  2QWS A;  5HPF A;  1GSV A;  4RX3 A;  3G6O A;  4L9G A;  3B33 A;  5DKL A;  4WZ5 C;  3MXS A;  4WEK A;  1AXB A;  4DDY A;  5HWT A;  4KQR A;  3HLB A;  4FH4 A;  4ETZ A;  2AVX A;  2XRN A;  5G4Z A;  3AGE A;  3LYX A;  3T4L A;  5D3O A;  2BG1 A;  5TFQ A;  3IX4 A;  1GHM A;  5EVL A;  2OLV A;  3WS2 A;  4R3J A;  3DTE A;  1S4S A;  3CJM A;  1FSY A;  1JWP A;  1BLS A;  3JPU A;  4WUJ A;  3MR0 A;  4WMC A;  1IFQ A;  4FD8 A;  1PWG A;  2Z6D A;  5IHV A;  1XGI A;  3AGD A;  4K0X A;  4WYY A;  4OPR A;  1H5X A;  4E6W A;  3PHY A;  2GDN A;  5DFX A;  4EQI A;  3FKV A;  5KZH A;  4WM9 A;  3ZNY A;  3BWL A;  5CHM A;  2XF3 A;  3MMH A;  1TD5 A;  3CPT B;  2KX6 A;  4WZ4 A;  5F6A A;  1FQG A;  5CTN A;  3LY4 A;  4BL2 A;  3BFF A;  4BLM A;  2WAD A;  2JN7 A;  4JF4 A;  5DVA A;  4P87 A;  3BEC A;  1ACF A;  3UE0 A;  2ZC4 B;  3FV7 A;  1TS6 A;  4PM7 A;  4PKY G;  4HH2 A;  5BOH A;  2L1M A;  2PU4 A;  5CER A;  2W1T B;  4ZJ3 A;  3D9Y A;  5CX7 A;  4LCL A;  5C5K A;  1IEM A;  3T4Q A;  1WYB A;  3FYZ A;  3HLG A;  2G2U A;  2RCX A;  2JC7 A;  5EVI B;  4Y17 A;  1W8Y A;  2ZM8 A;  2XQZ A;  2EX8 A;  5AQA A;  2ZC5 B;  3PAG A;  1NRJ A;  3CHW P;  4KUK A;  5FQM A;  4IVI A;  3EGD C;  3T1S A;  5J4E A;  5EVI D;  1TEM A;  3UMD A;  3L9K A;  4PM9 A;  4S2J A;  2X71 A;  2Z2L B;  1VET A;  2J3T C;  4Y15 A;  1HTZ A;  3ITA A;  4EW7 A;  2XH9 A;  2M7U A;  3HLC A;  4WEJ A;  3PBT A;  2B5R A;  2PBD P;  1PIO A;  3EEA A;  2Y2K A;  3VOL A;  4Y5F A;  4I39 A;  1XJ4 A;  2EX6 A;  3ICY A;  4C3Q A;  3IF6 C;  1ES5 A;  4S2N A;  2IWB A;  5DF7 A;  3MKF A;  4E3I A;  2PBY A;  3OPL A;  5FL3 A;  5FAO A;  3ZG5 A;  5TR7 A;  3LGO A;  3H82 B;  4JF6 A;  5E2H A;  4ME4 A;  4OLD A;  1T18 A;  3PR6 A;  4OQI A;  5E2E A;  4GDB A;  2B18 A;  3NJA A;  5HZH A;  1TS8 A;  5J7E A;  1P9R A;  4EBN A;  3AGF A;  5M18 A;  3PBS A;  4X53 A;  5EOO A;  4G3V A;  2OV5 A;  4OP8 A;  1L3L A;  1LSW A;  3UME A;  2RL3 A;  4A5R A;  4P85 A;  1P97 A;  2HJ9 C;  4GHI B;  4KZ5 A;  2J8Y A;  1Y54 A;  3JVU A;  1MWU A;  4EBP A;  3MFD A;  3C38 A;  5A8B A;  4S2I A;  5FDH A;  2Y2H A;  4JGP A;  1N9O A;  1Z09 A;  2HDQ A;  2W0N A;  3K2N A;  3A3J A;  5FDS A;  3S7O A;  4U0X A;  2JKT I;  2B02 A;  2PT7 A;  4BD1 A;  4NXG A;  1IYO A;  3LIB A;  4GS9 A;  3BLM A;  5AQ9 A;  3M6B A;  3JVV A;  3N7W A;  3BQA A;  5U47 A;  1K54 A;  4KUO A;  3O87 A;  3OOV A;  3HVF A;  3IS2 B;  3LY3 A;  1DRM A;  4ZJ1 A;  1NYY A;  4Q0H A;  1WA9 A;  1NXY A;  3F1P A;  2QHK A;  1FR1 A;  2K31 A;  4OH0 A;  4R0Q A;  2VKS A;  3C4P A;  4JF5 A;  2ZL1 A;  4ZAM A;  4OKP A;  2IWC A;  1O07 A;  3GRJ A;  4DE2 A;  5CEB A;  2ZMV A;  4B4X A;  3OPP A;  1HZO A;  3EQU A;  1PNE A;  2WGW A;  4PM8 A;  4IBR A;  4EQ1 A;  4R70 A;  3E2K A;  1XP4 A;  3PYP A;  3OBF A;  1DP9 A;  3HUM A;  3ZHH A;  2D02 A;  1T1C A;  2OLU A;  4PPR A;  2CC1 A;  5G18 A;  2EWV A;  2V1Z A;  4LEN A;  3T4T A;  1YLZ A;  5FEF A;  4EET B;  2ZLY A;  2ZQ9 A;  1E25 A;  3IX8 A;  3SH8 A;  3KSG A;  3A0S A;  1J3W A;  2WAF A;  3IWO A;  1DP6 A;  2WKR A;  3L7H A;  1X0O A;  4IUH A;  1D06 A;  1KVL A;  4KQO A;  1LL8 A;  3GTC A;  1GHI A;  2VX8 A;  3S4X A;  3M2K A;  1NWZ A;  2EXB A;  1KGF A;  3LR4 A;  5GLB A;  1PW8 A;  3S7P A;  4WMC D;  3QP6 A;  2HJE A;  2W3D A;  3OPR A;  1Y4O A;  5HPI A;  2Y79 A;  1SDE A;  3A3D A;  3KX0 X;  5A91 A;  4Z9Q A;  1Q2Q A;  1YPR A;  5DF8 A;  1G6A A;  3IF6 A;  3NHQ A;  5JYP A;  2JE5 A;  5TGF A;  4I38 A;  3FG8 A;  1EWZ A;  5FAQ A;  1ZTU A;  4ZBE A;  4HBU A;  4UEY A;  3UDX A;  3V3S A;  2WKQ A;  4WBG A;  5L07 A;  3E4Q A;  1BLP A;  5KMW A;  5FQI A;  4YNR A;  4OP5 A;  4OPQ A;  4X25 A;  3QNC A;  5CTM A;  3SOI A;  4JGO A;  1CEF A;  3BRM A;  3LIF A;  2FH5 A;  1ZKJ A;  2G7U A;  4OPY A;  3LIE A;  3HLW A;  4NEE D;  4X6T A;  5DJT A;  2P08 A;  3V3R A;  4G3K A;  3DAV A;  3A3I A;  1BLC A;  4NXE A;  4RQ9 A;  3TE8 A;  4ZJ2 A;  3OC2 A;  2HP6 A;  3MQO A;  1K56 A;  3VOY A;  2WZX A;  2IA2 A;  2Q9M A;  5L10 A;  3UY6 A;  3KSF A;  4RVA A;  3QHY A;  2EX9 A;  4CLC C;  2VZW A;  1RCJ A;  3E2L A;  4HH3 A;  1VET B;  5DF9 A;  1YAX A;  1OTB A;  4KZ8 A;  2Y2Q A;  3UE3 A;  5LBR A;  3IH9 A;  2V8C A;  2ZQ8 A;  4CJN A;  2P9V A;  3VP2 A;  1TF1 A;  1I5Q A;  4YFM A;  2JBF A;  3C4O A;  2HP9 A;  2W3F A;  2WK0 A;  1K0K A;  4EBL A;  4OLG A;  5GLD A;  1K6R A;  3QNB A;  5DTS A;  2V8F A;  1NRF A;  3WS1 A;  1GHP A;  3NC8 A;  4KZ4 A;  3CZD A;  3ZG8 B;  4FTX A;  4MEZ A;  2WKP A;  2C6W B;  4U0T A;  3N8R A;  4Z1W A;  1NZU A;  3MZD A;  3GQZ A;  5IT5 A;  4JGR A;  1ERO A;  2J9P A;  2NUT C;  1BUE A;  5FI7 A;  1UWP X;  2HPB A;  1I2S A;  3P7N A;  1KE0 A;  5HD3 A;  3FPW A;  4GN2 A;  1FR6 A;  1YSQ A;  1GA9 A;  2OSU A;  3RXX A;  4S2L A;  3QP1 A;  1TDL A;  5CGW A;  3MQQ A;  4EUV A;  3ZNT A;  3NI9 A;  3VP3 A;  1M40 A;  4XXR A;  1YLW A;  3IF5 A;  2H0Y A;  1QME A;  1ERQ A;  4GDN A;  1YT4 A;  1OME A;  3ISG A;  3BFG A;  5F68 A;  4I3J A;  2Q0O A;  1MKM A;  3IX3 A;  3BEB A;  3C5A A;  3LUQ A;  2WAE A;  4R3B A;  2ZM2 A;  4LRX C;  3E0Y A;  5FI2 A;  1BTL A;  3IH8 A;  4GS9 B;  2Q9N A;  4NKP A;  4P0M A;  3LIA A;  3MZF A;  2V20 A;  4DMZ A;  2ZQC A;  5FQQ A;  3ZCZ A;  5F69 A;  1FOF A;  4GD6 A;  1IYP A;  1IYQ A;  3UB9 A;  3DTI A;  2ZOI A;  2ZMF A;  3SH9 A;  3QP8 A;  3F1P B;  3MBZ A;  2PR6 A;  2VLG A;  4JLF A;  5GL9 A;  1N9N A;  1L0F A;  4P6B A;  5EVE A;  3K3C A;  4N1X A;  2P74 A;  1XFQ A;  2Z2M A;  3RFB A;  5FSR A;  1U60 A;  1A0K A;  2A2L A;  2A3U A;  2I72 A;  2ZL1 B;  1GA0 A;  3P98 A;  5HX9 A;  4GNU A;  1JTG A;  1CF0 A;  1AWI A;  3VP0 A;  5M19 A;  4GLQ A;  3SS4 A;  2XD5 A;  5AVE A;  2WGW B;  4QY5 A;  4EUZ A;  1OTE A;  1PFL A;  2GNX A;  1RP5 A;  3KSH A;  3IXD A;  4XT2 A;  1G68 A;  3C7V A;  1VHM A;  2EA9 A;  3NDG A;  4X55 A;  3HUN A;  3PTE A;  5HDC A;  3T1R A;  4QHC A;  3P09 A;  1JVJ A;  4CLC A;  3GVB A;  1K57 C;  1N9B A;  1W7F A;  1YQS A;  3R7W A;  4D2O A;  4S2O A;  3SS3 A;  2L4R A;  1NLY A;  3HJI A;  4WF0 A;  5EEC A;  5CEC A;  2YKF A;  2JKF A;  4HJ4 A;  1CI9 A;  5HDD A;  3MZE A;  5A90 A;  1VM1 A;  3KSI A;  4EU0 A;  2ZJ9 A;  4G3W A;  3G31 A;  1YM1 A;  5F82 A;  3NY4 A;  2VV8 A;  3HL9 A;  3FPV A;  1ERM A;  1GSX A;  2J3T D;  3WS4 A;  1FCM A;  4BWI A;  2J9O A;  4L9E A;  2A49 A;  2VGK A;  4M4X A;  3GEC A;  3V39 A;  5L2F A;  1NJ4 A;  1KDW A;  3IT9 A;  3PBO A;  5I5L A;  1S66 L;  3I7J A;  3IF6 B;  1MC0 A;  1PZO A;  3VP1 A;  4M3K A;  2HGV A;  4E3O A;  4MNR A;  4Y2F A;  4QJG A;  4GB7 A;  2GX5 A;  4DE3 A;  1JWZ A;  2XD1 A;  1S1Y A;  3Q82 A;  3CI6 A;  3A0V A;  2M7V A;  2XFS A;  4JXS A;  3CIT A;  2L0W A;  2WGI A;  1BSG A;  1TS0 A;  4BL3 A;  1LI9 A;  1OJ5 A;  4GZB A;  5EUA A;  4JXV A;  3LCE A;  1LL9 A;  4UA6 A;  4IJG A;  3BY9 A;  2ZQD A;  3UB8 A;  4I5S A;  3MKE A;  1PW1 A;  3TG9 A;  3WS0 A;  2ZC7 A;  3IWI A;  5KIZ A;  3BW6 A;  2VA0 A;  4WZ5 A;  5JYO A;  1K56 D;  2HDU A;  3DTM A;  3IXG A;  3WRT A;  3G32 A;  4BBT A;  3KYE A;  1F5M A;  2P9V B;  1T19 A;  2KLI A;  5DFY A;  1YMS A;  5EVI C;  1ZHH B;  3TW8 A;  1PWC A;  2OOL A;  2VEA A;  3DWK A;  3OCN A;  3CMZ A;  2DRW A;  2ZOH A;  3BFE A;  4JKT A;  5CED A;  1RGY A;  4KG2 A;  4IUK A;  4OVD A;  1STZ A;  5J8X A;  3OCL A;  3UPP A;  1XA7 A;  3IXB A;  3ZG0 A;  4EES A;  1YSP A;  1IOU A;  3VE4 A;  4RX2 A;  4R38 A;  3EQV A;  2MJ6 A;  1KOU A;  1MKI A;  4ARZ B;  3UDI A;  2I9V A;  1TDG A;  3D72 A;  4LLO B;  4DJ3 A;  3TRC A;  4QD4 A;  4NXF A;  3IBR A;  2W1R A;  3HLF A;  5FEG A;  1G5U A;  3OPH A;  1JWV A;  1S1Z A;  3S1Y A;  3SS5 A;  5HAQ A;  1K4F A;  3C7U A;  5MC7 A;  3VP4 A;  1K55 C;  4MMN A;  1FCO A;  3M6H A;  4E3N A;  4DKI A;  1SCW A;  1XX2 A;  1MBL A;  2A24 A;  3NOP C;  4EXO A;  3S7N A;  4X56 A;  3DWZ A;  1IKG A;  2Y8H A;  4QPR A;  3FKW A;  2QKP A;  3U4L P;  4B88 A;  2V2F F;  4YOF A;  5L8M A;  3A3E A;  2FZ0 A;  4UQI M;  3UNW A;  1DJA A;  3ZQ5 A;  2WKE A;  5EFW A;  2XR0 A;  3UPO A;  3FC7 A;  1ODV A;  4JXG A;  3CAX A;  3W4O A;  2XK1 A;  1YMX A;  3EOI A;  4UA9 A;  3LFV A;  1OTA A;  3UB5 P;  5HL1 A;  3T4J A;  2Z2M B;  4II7 A;  4IHQ A;  2ZM0 A;  3O5Y A;  4HQA A;  5FAT A;  3HRE A;  2UV0 E;  4LV2 A;  3MF0 A;  5HW3 A;  3UPN A;  3VMA A;  3V50 A;  3M2J A;  1BUL A;  4NET A;  5HAP A;  1VEU A;  3H7W A;  4XT2 B;  4MLL A;  1W63 M;  5EPH A;  1PI5 A;  5AJG A;  2OWH A;  3A0R A;  1ES3 A;  4DE0 A;  4B93 A;  4MBH A;  2DMW A;  5FQK A;  2V9A A;  4CLC B;  3ZVT A;  2H0T A;  1TVF A;  1DJB A;  2V1B A;  3BJN A;  4FSF A;  3R7W B;  3HUO A;  4KZ9 A;  1K38 A;  3C8C A;  4LV0 A;  1ESU A;  1FSW A;  2VV7 A;  1LLB A;  4I3A A;  4HY8 A;  1MWS A;  1PYY A;  5HSQ A;  4CLC D;  4MBF A;  1F9I A;  4L9F A;  1PZP A;  3KYZ A;  2BAS A;  2E8I A;  2JKG A;  4EEU A;  1P9W A;  4ESP A;  5DJU A;  2VGL M;  2HF6 A;  1XGJ A;  3VV4 A;  4BD0 A;  4GOG A;  2X02 A;  3UDF A;  1W8Q A;  3HLD A;  5HAR A;  5A93 A;  3RJU A;  2Z6C A;  2ZC6 B;  1OTI A;  4KZB A;  5GHY A;  3BM6 A;  4BEN A;  2CMN A;  1YKD A;  3Q7Z A;  5IS1 A;  3BYD A;  4LPZ A;  5GHZ A;  1OT9 A;  5L09 A;  4QY6 A;  2B95 A;  5EM1 A;  3LR5 A;  5EV0 A;  3ZDJ A;  4HJ3 A;  4NXB A;  4HJ6 A;  2OWJ A;  2P04 A;  3WWX A;  4OQH A;  4UQI S;  3NCK A;  2J3W A;  1W79 A;  2H28 A;  5CXW A;  4KZ7 A;  4DF6 A;  4X1L A;  3PAE A;  1E3U A;  2Y4A A;  2Y2N A;  2WYX A;  3VFH A;  3E4O A;  4E3M A;  2JCH A;  1VQQ A;  2QYB A;  5CGX A;  3RXW A;  1S0W A;  4E3J A;  4CLC E;  4HIA A;  1XJ3 A;  3Q1F A;  4LV1 A;  1G6O A;  3EEH A;  4R6L A;  1IKI A;  4S2P A;  3O86 A;  3QP5 A;  2O9C A;  4HES A;  4X68 A;  1Q2P A;  3G4P A;  3OLO A;  2PDR A;  3PXP A;  4JPM A;  1XJ6 A;  2EFX A;  4X69 A;  3MXR A;  4N9L A;  4N9K A;  3LIC A;  3S22 A;  2VK3 A;  3NBL A;  2EXA A;  3C30 A;  4Y7P A;  1KE3 A;  4LV3 A;  2R9W A;  4GD8 A;  5F1F A;  4MN5 A;  3U2A A;  3FZC A;  2Y2O A;  4KZ3 A;  2Y2M A;  3N8L A;  3W4P A;  1H8Z A;  1Z6F A;  3LID A;  4UA7 A;  3GV9 A;  2HDR A;  1ALQ A;  3G30 A;  2VGL S;  3F1O A;  3WS5 A;  2Y59 A;  4F3L A;  3UN7 A;  1XFN A;  3GDI A;  4S2N C;  5DTT A;  2EX2 A;  3N4I A;  4C75 A;  2Y2I A;  1SKF A;  5GLC A;  4RYE A;  3PBN A;  2QJ7 A;  2VJW A;  3VFF A;  2A24 B;  2Y55 A;  1HLU P;  1S67 L;  4IVK A;  4DJ2 A;  3PBQ A;  2DCF A;  1MZU A;  2D01 A;  1C3B A;  3MJQ A;  4Y0T A;  4KG6 A;  2OAQ 1;  5E43 A;  4JXW A;  5HL6 A;  4O8G A;  4E04 A;  2ZD8 A;  5F83 A;  1DP8 A;  1M6K A;  3ZFZ A;  1HD8 A;  4MN6 A;  1EW0 A;  1F2K A;  2J7V A;  2PYR A;  5TJJ A;  1MY8 A;  4R4R A;  2W3H A;  5E2F A;  1EI5 A;  3H9W A;  4Y3I A;  1YLT A;  5TBM A;  1NY0 A;  1RGZ A;  1GSW A;  3IXH A;  5EOE A;  4UAA A;  5FAP A;  1D7E A;  3LEQ A;  4GW9 A;  3F1N A;  1YLY A;  5HD5 A;  3EGX C;  1H8M A;  3BFC A;  4JGQ A;  3NUL A;  3Q7V A;  5CHJ A;  3E4P A;  4CQH A;  5CGS A;  1KGE A;  1NYM A;  3N8S A;  4JBF A;  3NOU C;  3D4F A;  4ZTK A;  1OPX A;  1FIK A;  2G2W A;  5AVF A;  4MCW A;  1CEG A;  1LT0 A;  3MXQ A;  5KSH A;  1VEU B;  4PM5 A;  3ITB A;  5K5B A;  3H7W B;  1UGU A;  1K54 C;  4NK3 A;  2ZQA A;  4BJP A;  3V67 A;  1ZC2 A;  5FA7 A;  1W63 Q;  1K25 A;  3FWL A;  1Y28 A;  3GR2 A;  1PRQ A;  2W27 A;  1MWT A;  1OJG A;  2PD8 A;  3MQ0 A;  2O9A A;  4PHT A;  4S2K A;  2Y91 A;  4K08 A;  4H6J A;  1N4O A;  4FCF A;  3CUE C;  5F5Y A;  2XA7 M;  2X01 A;  3EWK A;  3T1X A;  5I94 A;  2HDS A;  3T1Q B;  3QP4 A;  1ONH A;  4ID4 A;  4Y0U A;  2M1C A;  4LCM A;  4R3A A;  2Y2G A;  2R78 A;  5AQB A;  4DDS A;  5GLA A;  5FI6 A;  1IYS A;  4LFU A;  1PI4 A;  4R4S A;  2NUP C;  3KYQ A;  5HWV A;  1GCE A;  2H10 A;  5FAS A;  1H3Q A;  2C5W B;  4N92 A;  5FQJ A;  1S6R A;  5HFO A;  1FCN A;  4DXC A;  4FOF A;  4GKU A;  1TS7 A;  2PU2 A;  4DXB A;  2W3G A; 
#chains in the Genus database with same CATH homology
 4JXG A;  2BG1 A;  5TFQ A;  1GHM A;  3W4O A;  3ZVW A;  5EVL A;  2XK1 A;  2OLV A;  1YMX A;  3WS2 A;  2ZC3 A;  4KZ8 A;  4R3J A;  2QMI A;  2Y2Q A;  3UE3 A;  5KSC A;  3IH9 A;  3CJM A;  1J9M A;  3CG5 A;  4UA9 A;  4K91 A;  1FSY A;  2ZQ8 A;  1JWP A;  4CJN A;  1BLS A;  2P9V A;  5HL1 A;  2Z2M B;  4WMC A;  1L0D A;  3G34 A;  3VP2 A;  4FD8 A;  1I5Q A;  4YFM A;  1PWG A;  1DJC A;  2ZM0 A;  5IHV A;  1CK3 A;  1XGI A;  2JBF A;  3C4O A;  3AGD A;  4O7D A;  3Q81 A;  4K0X A;  5FAT A;  3HRE A;  2HP9 A;  4LV2 A;  2WK0 A;  4EBL A;  4OLG A;  5HW3 A;  4WYY A;  5GLD A;  1K6R A;  2VGJ A;  3QNB A;  4OPR A;  1H5X A;  5DTS A;  1NRF A;  3UPN A;  3VMA A;  4CPK A;  4E6W A;  4U3T A;  3WS1 A;  1GHP A;  3V50 A;  2GDN A;  3M2J A;  3NC8 A;  4KZ4 A;  4EQI A;  1BUL A;  3FKV A;  5KZH A;  3CZD A;  4WM9 A;  4NET A;  3ZG8 B;  3ZNY A;  4MEZ A;  5HAP A;  5CHM A;  4B4Z A;  2XF3 A;  1ONG A;  2C6W B;  4L0L A;  4U0T A;  4MLL A;  3N8R A;  3G35 A;  1NZU A;  3MZD A;  3TOI A;  3GQZ A;  3Q07 A;  1PI5 A;  5EPH A;  4WZ4 A;  1FQG A;  5CTN A;  3W4Q A;  3LY4 A;  4BL2 A;  1WE4 A;  1ES3 A;  4DE0 A;  3BFF A;  4MBH A;  4BLM A;  5FQK A;  1ERO A;  2J9P A;  2WAD A;  4JF4 A;  5DVA A;  1BUE A;  3ZVT A;  1E4D A;  2FFY A;  2H0T A;  5FI7 A;  1ESI A;  4P87 A;  3BFD A;  1TVF A;  2XGN A;  1DJB A;  1E3U D;  1O7E A;  3BEC A;  2HPB A;  4FSF A;  1ZG4 A;  3UE0 A;  2ZC4 B;  3FV7 A;  3G2Y A;  3HLE A;  1I2S A;  1MXO A;  3HUO A;  4KZ9 A;  1KE0 A;  3W8K A;  3ZG9 B;  1K38 A;  2XEP A;  4PM7 A;  4GN2 A;  4LV0 A;  1FR6 A;  5BOH A;  1ESU A;  1GA9 A;  2OSU A;  3RXX A;  1FSW A;  2PU4 A;  1LLB A;  4S2L A;  1TDL A;  2IWD A;  5CGW A;  5CER A;  1SDN A;  4ZJ3 A;  1MWS A;  1PYY A;  3ZNT A;  3IHB A;  3NI9 A;  4LCL A;  4MBF A;  1L0G A;  1PZP A;  1IEM A;  3VP3 A;  2UWX A;  1M40 A;  1WYB A;  5FQ9 A;  4XXR A;  1BT5 A;  2E8I A;  1YLW A;  3IF5 A;  3FYZ A;  2H0Y A;  1K57 A;  1QME A;  3HLG A;  1ERQ A;  2G2U A;  2RCX A;  4GDN A;  1KDS A;  2JC7 A;  1YT4 A;  4KEN B;  5EVI B;  1CI8 A;  1XA1 A;  5CRF A;  5E2G A;  1OME A;  3ISG A;  1W8Y A;  3BFG A;  2ZM8 A;  2XQZ A;  1IEL A;  1HVB A;  1XGJ A;  3DW0 A;  2EX8 A;  5AQA A;  3SH7 A;  2ZC5 B;  2Y2J A;  4BD0 A;  3BEB A;  3PAG A;  2X02 A;  3C5A A;  4GOG A;  2WAE A;  4R3B A;  3UDF A;  3HBR A;  2ZM2 A;  1W8Q A;  5FI2 A;  2WZZ A;  3NIA A;  5CHU A;  3HLD A;  1KE4 A;  5HAR A;  5A93 A;  1BTL A;  3TSG A;  3IH8 A;  5FQM A;  3RJU A;  4IVI A;  2Q9N A;  2ZC6 B;  3LO7 A;  4P0M A;  1LHY A;  3MZF A;  2V20 A;  3JYI A;  1TEM A;  5EVI D;  4KZB A;  4PM9 A;  5GHY A;  2ZQC A;  3BM6 A;  5FQQ A;  3ZCZ A;  4R1G A;  2X71 A;  4S2J A;  4BEN A;  1FOF A;  2Z2L B;  4GD6 A;  3Q7Z A;  1IYP A;  1IYQ A;  3BYD A;  1HTZ A;  1ZG6 A;  3B3X A;  5AQ7 A;  5GHZ A;  3V5M A;  4PMA A;  3ITA A;  1BLH A;  3SH9 A;  4QY6 A;  1MPL A;  5M1A A;  2XH9 A;  4KQQ A;  3MBZ A;  1XKZ A;  2XFT A;  1YLP A;  3ZDJ A;  2R9X A;  4JLF A;  5GL9 A;  1L0F A;  3HLC A;  4P6B A;  4WEJ A;  5DTK A;  3PBT A;  3WWX A;  4N1X A;  2P74 A;  4OQH A;  4K0W A;  2B5R A;  2Z2M A;  5FSR A;  4R23 A;  1U60 A;  1PIO A;  2Y2K A;  4HBT A;  2A3U A;  3NCK A;  2I72 A;  3VSL A;  3P98 A;  1GA0 A;  5HX9 A;  4GNU A;  1JTG A;  3VP0 A;  5M19 A;  3SS4 A;  1W79 A;  2XD5 A;  5CXW A;  4QB8 A;  3VSK A;  2EX6 A;  4KZ7 A;  2WGW B;  4DF6 A;  4QY5 A;  4EUZ A;  4C3Q A;  3IF6 C;  1ES2 A;  3IWQ A;  1ES5 A;  4S2N A;  3PAE A;  2IWB A;  1E3U A;  4OON A;  5DF7 A;  3MKF A;  1RP5 A;  4E3I A;  2Y4A A;  1YLJ A;  2PBY A;  3OPL A;  2Y2N A;  3IXD A;  3IHA A;  2WYX A;  5FAO A;  1WYC A;  2HP5 A;  5TR7 A;  3ZG5 A;  4E6X A;  3A3F A;  1G68 A;  3C7V A;  3VFH A;  1LL5 A;  4X55 A;  3NDG A;  4E3M A;  3HUN A;  2JCH A;  4JF6 A;  1VQQ A;  3PTE A;  3OZH A;  5E2H A;  4OLD A;  4QHC A;  5CGX A;  3RXW A;  3P09 A;  1JVJ A;  4IED A;  3GVB A;  1S0W A;  1K57 C;  2WGV A;  1N9B A;  1W7F A;  1YQS A;  4OQI A;  5E2E A;  4GDB A;  4E3J A;  4D2O A;  4QU3 A;  2ZC4 A;  4FH2 A;  4E3L A;  4S2O A;  3SS3 A;  5HAI A;  4EBN A;  5CEC A;  5EEC A;  3Q1F A;  3AGF A;  4LV1 A;  4YIN A;  5M18 A;  3PBS A;  1CI9 A;  4X53 A;  3Q7V B;  3MZE A;  5EOO A;  5A90 A;  4Y0O A;  2OV5 A;  1VM1 A;  2WUQ A;  4OP8 A;  4N1H A;  2ZJ9 A;  1IKI A;  4S2P A;  4WEL A;  2RL3 A;  3O86 A;  1KVM A;  3G31 A;  1YM1 A;  5F82 A;  4A5R A;  1PWD A;  3NY4 A;  4P85 A;  1I2W A;  3GSG A;  4HES A;  2DNS A;  4KZ5 A;  3UO9 A;  2J8Y A;  3HL9 A;  4X68 A;  1ERM A;  1Y54 A;  1Q2P A;  3G4P A;  4EWF A;  3BLS A;  3WS4 A;  1FCM A;  1MWU A;  2J9O A;  4JPM A;  2A49 A;  4C6Y A;  4EBP A;  2VGK A;  2EFX A;  3MFD A;  5EVI A;  3V39 A;  5L2F A;  4X69 A;  3MXR A;  1NJ4 A;  1KDW A;  2WKH A;  3IT9 A;  4S2I A;  3PBO A;  4N9L A;  5FDH A;  4N9K A;  2Y2H A;  3I7J A;  2HDQ A;  3IF6 B;  3A3J A;  4DE1 A;  3S22 A;  4KZ6 A;  3NBL A;  1PZO A;  2EXA A;  4OQG A;  4OPZ A;  4U0X A;  3VP1 A;  4Y7P A;  4BD1 A;  1IYO A;  1KE3 A;  4M3K A;  3LEZ A;  4LV3 A;  2R9W A;  4GD8 A;  5F1F A;  4E3O A;  3BLM A;  4MNR A;  3FZC A;  5AQ9 A;  3M6B A;  3O88 A;  2Y2O A;  3N7W A;  1DY6 A;  1K4E A;  2Y2P A;  4KZ3 A;  5U47 A;  2Y2M A;  3N8L A;  3W4P A;  1K54 A;  3O87 A;  1H8Z A;  1Z6F A;  5F1G A;  4HEF A;  4UA7 A;  4QJG A;  2Z2L A;  4GB7 A;  3GV9 A;  2HDR A;  1ALQ A;  3G30 A;  3HVF A;  5A92 A;  3LY3 A;  4DE3 A;  1JWZ A;  2XD1 A;  3WS5 A;  2Y59 A;  4BQM A;  4ZJ1 A;  1NYY A;  3UN7 A;  3Q82 A;  4OOM A;  2EFU A;  1NXY A;  1MWR A;  4F94 A;  4S2N C;  5DTT A;  4RA7 A;  2EX2 A;  2H5S A;  1FR1 A;  3N4I A;  4OH0 A;  2Y2I A;  3ZG7 B;  4C75 A;  1SKF A;  5GLC A;  4RYE A;  3PBN A;  2XFS A;  4JXS A;  4R0Q A;  3VFF A;  1H8Y A;  2Y55 A;  2WGI A;  3ZGA B;  1BSG A;  3C4P A;  3O3V A;  4JF5 A;  4BL3 A;  4ZAM A;  4IVK A;  4OKP A;  1LI9 A;  2IWC A;  3PBQ A;  1O07 A;  2XDM A;  2DCF A;  3GRJ A;  1ES4 A;  4DE2 A;  1C3B A;  5CEB A;  4GZB A;  5EUA A;  4JXV A;  3LCE A;  4B4X A;  1LL9 A;  4UA6 A;  3OPP A;  2BLS A;  4Y0T A;  1HZO A;  3EQU A;  1K55 A;  2WGW A;  4KG6 A;  4PM8 A;  4IBR A;  5E43 A;  4JXW A;  2ZQD A;  4PM6 A;  3E2K A;  1XP4 A;  2ZD8 A;  5F83 A;  1M6K A;  3MKE A;  1HD8 A;  3ZFZ A;  1PW1 A;  2J7V A;  1W5D A;  3HUM A;  3TG9 A;  3ZHH A;  1MY8 A;  3WS0 A;  3NDE A;  3GMW A;  2ZC7 A;  3G2Z A;  4R4R A;  2OLU A;  4H8R A;  4MBK A;  4PPR A;  1KGG A;  2CC1 A;  3IWI A;  5G18 A;  2V1Z A;  4LEN A;  5E2F A;  4WZ5 A;  1EI5 A;  1YLZ A;  2ZC3 B;  5JYO A;  1K56 D;  1YLT A;  2HDU A;  4XUX A;  1JTD A;  1NY0 A;  1RGZ A;  3DTM A;  3IXG A;  2QPN A;  3IXH A;  5EOE A;  4UAA A;  3WRT A;  3G32 A;  4UHU A;  2ZLY A;  2ZQ9 A;  5FAP A;  1E25 A;  3IQA A;  4DRT A;  3SH8 A;  2P9V B;  1BZA A;  4KG5 A;  3UE1 A;  2QZ6 A;  2WAF A;  3IWO A;  1YMS A;  1YLY A;  3PBR A;  5EVI C;  1XXM A;  1PWC A;  1KVL A;  3DWK A;  3BFC A;  4Q8I A;  3OCN A;  4KQO A;  3GTC A;  1GHI A;  3CMZ A;  1QMF A;  2DRW A;  3Q7V A;  3BFE A;  4JKT A;  3S4X A;  5CHJ A;  5EE8 A;  3M2K A;  5CED A;  1RGY A;  5CGS A;  1KGE A;  1NYM A;  4KG2 A;  2EXB A;  1KGF A;  3N8S A;  4JBF A;  3D4F A;  4ZTK A;  4OVD A;  5GLB A;  4EV4 A;  2G2W A;  5J8X A;  1PW8 A;  3OCL A;  3UPP A;  1CEG A;  1XA7 A;  4WMC D;  5KSH A;  2ZQ7 A;  4PM5 A;  3IXB A;  4XUZ A;  3OPR A;  3ITB A;  3ZG0 A;  1K54 C;  4NK3 A;  1NZO A;  2ZQA A;  4OOL A;  1SDE A;  4RX2 A;  4BJP A;  3A3D A;  1XPB A;  3EQV A;  1ZC2 A;  5A91 A;  4Z9Q A;  1Q2Q A;  5DF8 A;  1MKI A;  1G6A A;  3IF6 A;  2ZMA A;  3UDI A;  5FA7 A;  5JYP A;  2JE5 A;  3N6I A;  1K25 A;  3FWL A;  5TGF A;  4OQ0 A;  1TDG A;  1LI0 A;  3GR2 A;  1EWZ A;  5FAQ A;  4OOY A;  4ZBE A;  4HBU A;  1MWT A;  4KZA A;  3UDX A;  4QD4 A;  3V3S A;  4S2K A;  4WBG A;  2Y91 A;  4IBX A;  1L2S A;  1L0E A;  3HLF A;  4S2M A;  2Y2L A;  2XLN A;  1N4O A;  4FCF A;  2WKI A;  1BLP A;  5KMW A;  5FQI A;  3WRZ A;  3OPH A;  4OP5 A;  1JWV A;  4OPQ A;  3S1Y A;  3SS5 A;  2FFF B;  4E3K A;  3VOZ A;  5HAQ A;  3QNC A;  1K4F A;  3C7U A;  5CTM A;  5GHX A;  3SOI A;  1CEF A;  2X01 A;  4ZDX A;  3BRM A;  3VP4 A;  1K55 C;  5I94 A;  2HDS A;  1SHV A;  1FCO A;  1K6S A;  3M6H A;  1ONH A;  1ZKJ A;  4ID4 A;  4Y0U A;  4E3N A;  4DKI A;  1SCW A;  1XX2 A;  4OPY A;  4RX3 A;  1MBL A;  3HLW A;  4LCM A;  4X6T A;  3V3R A;  4X56 A;  3DWZ A;  2Y2G A;  4DDS A;  5AQB A;  4WZ5 C;  3MXS A;  5GLA A;  4WEK A;  1AXB A;  1IKG A;  3A3I A;  5FI6 A;  1BLC A;  4DDY A;  4ZJ2 A;  3OC2 A;  1IYS A;  2HP6 A;  3FKW A;  4KQR A;  1PI4 A;  4R4S A;  4B88 A;  3HLB A;  4FH4 A;  1K56 A;  3VOY A;  1GCE A;  2WZX A;  2V2F F;  2H10 A;  2Q9M A;  3A3E A;  3UY6 A;  5FAS A;  4RVA A;  3UNW A;  3QHY A;  2C5W B;  2EX9 A;  1DJA A;  4N92 A;  5FQJ A;  2WKE A;  1S6R A;  5HFO A;  1FCN A;  4DXC A;  1RCJ A;  3AGE A;  3E2L A;  4GKU A;  2PU2 A;  2XR0 A;  5DF9 A;  4DXB A;  3UPO A;  5D3O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...