4OVDA

Crystal structure of a putative peptidoglycan glycosyltransferase from atopobium parvulum dsm 20469
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
511
structure length
422
Chain Sequence
NDIVLHARRGTIYDRNGNVLAMSVDCKNNTKRVYPYGNVGVQILGFVNADNEGASGLEYYYNDILAGTNGHMISNITEAQNGQDIVLSIDIELQKKAEEQLTAAVKDFEAKQGGSIMAMNPRTGEIYAAASYPLPDFVDYESLNLKLVSSIYEPGSVFKVITTSIGVDNNLFGPNSTFNIPTELQVGDNKVTDDDWRTSAMDMSVREMLRRSSNVGMAFLETQLIGDKRFAEGIDKFGIGHTTGIDFPGEATGIVRSLDQYEGPTGGNMAFGQGLAIPFIQVIRAYTAVANKGTMVTPHFMVSKGGQEVSWPTKDVISSSTASAELDMMTTVVKEGTGVRAGIYGYTVAGKTGTGQQVVEETGSYGENSGFVASFCGIVNPSESDLMVYVGLNDTHQLASQSAAVVFSQFAKDAATRLNIQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidoglycan glycosyltransferase
publication title Crystal structure of a putative peptidoglycan glycosyltransferase from Atopobium parvulum DSM 20469
rcsb
source organism Atopobium parvulum
molecule tags Transferase
total genus 119
structure length 422
sequence length 511
ec nomenclature ec 2.4.1.129: Peptidoglycan glycosyltransferase.
pdb deposition date 2014-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
A PF03717 PBP_dimer Penicillin-binding Protein dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4ovdA03
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4ovdA02
3.90.1310.10 Alpha Beta Alpha-Beta Complex Penicillin-binding protein 2a (Domain 2) Penicillin-binding protein 2a (Domain 2) 4ovdA01
3G32A 3NY4A 4JF5A 1K54A 5CTNA 1L0GA 2H0YA 1RCJA 4CPKA 3M2KA 4B88A 4K0XA 1I2SA 3G31A 4OONA 3B3XA 1JWPA 3PBQA 3LEZA 5F82A 3GRJA 1LI0A 1BLCA 1O7EA 4GZBA 3VP3A 3VP1A 2ZM8A 1EROA 4RX2A 1K55A 5DTSA 4DKIA 2VGKA 1MBLA 2Y2HA 4JBFA 4LCLA 3HLEA 1YLJA 4UHUA 5FQMA 1XKZA 1SDEA 3V3RA 1M6KA 3ZDJA 5E2EA 1KVMA 1ONGA 3QNBA 1IKIA 4E6WA 3P09A 3PAGA 4GNUA 5F83A 3ZFZA 1AXBA 1XX2A 2XQZA 1DJAA 2WK0A 4LV1A 5GHXA 4D2OA 1W79A 3OCNA 3A3DA 5M19A 4B4XA 3C7VA 5E2HA 1G68A 5CEDA 3IHBA 3PTEA 4PM5A 1H5XA 4WEJA 1PYYA 3GVBA 3UDFA 4BENA 3SOIA 5FSRA 3EQUA 5EUAA 1IEMA 4EBNA 1HZOA 3UE3A 4X53A 4RA7A 3SH8A 1IYQA 2FFYA 1PZPA 4N1XA 4HBTA 3Q81A 2RL3A 3FV7A 4DE1A 1FSYA 5FQKA 5GL9A 3WRZA 2FFFB 1ONHA 1GA0A 1XGJA 3BFEA 1K57C 3M6BA 3EQVA 4S2OA 4XUZA 5M18A 1EI5A 3ZVTA 3SS3A 1HD8A 2H0TA 5GLBA 1KDWA 2ZC7A 2DNSA 3MXSA 2DRWA 3OPRA 2ZQDA 3FWLA 1VM1A 5CHUA 4PM8A 2PU2A 3IF5A 4BD1A 2DCFA 2PBYA 3E2KA 3W8KA 1GHPA 4OLDA 2QZ6A 4U0TA 5D3OA 4FCFA 4R1GA 2WKHA 3C4OA 2HPBA 2WGWB 1E3UA 5DVAA 3V50A 1GCEA 3W4OA 4E3MA 1BT5A 3M2JA 4DDYA 2J7VA 4OPYA 2Y4AA 5IHVA 1K4EA 1K4FA 2WKIA 4E3NA 1MWSA 3G35A 3TOIA 5EVIC 2HDUA 5EVID 3VP2A 2XFSA 1ESUA 3MKFA 3HLGA 5EE8A 2EXBA 2JCHA 2ZQ8A 2I72A 1ZG6A 2XFTA 1S0WA 2JE5A 2ZQCA 4U0XA 4WZ5C 4B4ZA 3SS5A 3TSGA 3UPPA 3BLSA 3RXXA 5TFQA 1BLPA 5L2FA 3OPLA 3MZDA 2Z2MA 1ERQA 1BTLA 3IQAA 1RGYA 3IWIA 4PM7A 4RVAA 5EOOA 2E8IA 5G18A 1KE0A 4C6YA 1PWGA 2WKEA 2XLNA 4P85A 3WS1A 2WGWA 3ZHHA 5FQIA 4JF4A 3UN7A 3IWQA 5CHJA 4QY5A 1YLYA 3C7UA 5A91A 4FSFA 2XH9A 4KZ5A 4WM9A 4GD8A 1YMXA 4DDSA 1K56A 3OCLA 4U3TA 3ISGA 1HVBA 1YM1A 4JXVA 2QPNA 1NZUA 3VSKA 3A3IA 1N9BA 5EVLA 2C6WB 1IYSA 4PMAA 1L0EA 2G2WA 3MZFA 5FATA 5AQ9A 1HTZA 2Y91A 1RGZA 3LY4A 4NK3A 2WZXA 4ZDXA 1JWZA 3V39A 4X68A 2CC1A 5KZHA 3A3EA 4FH4A 1Y54A 4OVDA 1NYYA 3HLCA 3UE1A 2C5WB 4X56A 3GMWA 2Y2PA 2Y2LA 3SH7A 5DF8A 4PM6A 1ES2A 4OOLA 3ITBA 1WYBA 4N9LA 3VMAA 4NETA 1K6RA 3BEBA 3PBNA 1EWZA 2ZQAA 4DE3A 4QJGA 5AQ7A 3DWKA 5GLCA 4KZ3A 4Q8IA 3QNCA 5FAOA 4Z9QA 2V20A 4EBLA 1BSGA 4BQMA 3UNWA 3ZG5A 4DF6A 1JWVA 3ITAA 2B5RA 5HARA 3I7JA 1MKIA 1W8YA 1C3BA 1W5DA 4KZ8A 3GV9A 4JXWA 3N8SA 3ZG0A 3P98A 3PBRA 4E3JA 3HREA 2ZLYA 4WEKA 4UA9A 3OC2A 2Y2MA 5HAIA 4OP5A 4IVKA 1Q2QA 3FYZA 4UAAA 3ZG8B 3NC8A 3HBRA 1ZG4A 3IHAA 4OQGA 3BYDA 3ZG7B 4N9KA 5FI7A 3BFFA 3MBZA 3LCEA 3IH9A 5HFOA 1GA9A 5FQJA 4C75A 3W4PA 1U60A 2Q9NA 1YT4A 3IWOA 5DTKA 3IXHA 4S2NA 1LL5A 2ZD8A 1XXMA 1LLBA 4OQ0A 1IYOA 1PWDA 3O88A 4QB8A 2WAFA 5BOHA 4GD6A 3BECA 1K25A 1QMFA 3CJMA 1Q2PA 3IF6C 4DXCA 4IVIA 3VSLA 4YINA 2Y59A 4KQRA 4IBXA 3WWXA 2ZMAA 4E3OA 3D4FA 4KZBA 1LI9A 4KG5A 4S2IA 1BLHA 1FCOA 3ZVWA 1H8YA 3N4IA 3N8RA 4MBHA 2XF3A 3FKVA 3AGDA 2ZM0A 5GLAA 4JXSA 2J9OA 2OV5A 3UPOA 2JBFA 4WMCD 3UDXA 2OLVA 3GSGA 4R3JA 5TR7A 1I5QA 4E6XA 3VP0A 3W4QA 3WS5A 1K54C 1GHIA 1NYMA 3A3FA 3CZDA 3PBTA 1KVLA 3NDGA 1RP5A 3S22A 1IKGA 2RCXA 3BRMA 2HDQA 4RYEA 1TVFA 1M40A 2XEPA 1NZOA 3WRTA 4H8RA 3V3SA 2EXAA 1PI4A 2WADA 3PAEA 4L0LA 4BL2A 5KMWA 1FCNA 2XD5A 4DE0A 1YLTA 3NBLA 3WS2A 2ZM2A 3VOYA 4QU3A 5GLDA 3HLBA 4S2MA 1BULA 3LY3A 1FOFA 3IH8A 2Y2NA 2ZQ9A 4S2PA 4Y0UA 5EECA 3HLWA 3HLFA 1TDLA 2EX9A 3NI9A 4LCMA 5DTTA 1FR6A 4LV0A 5FI2A 2HP6A 3UY6A 4JLFA 4GDBA 4MBKA 1W7FA 2EFXA 5CGXA 3Q07A 4EQIA 4P6BA 5HAQA 1YQSA 4LV3A 3VP4A 1MWRA 4QD4A 4ZJ2A 4JF6A 3IXDA 3IXGA 1L0FA 3NDEA 2Y2KA 4K91A 1MWTA 5AQAA 2BLSA 2EFUA 4A5RA 4BJPA 5FQQA 1MPLA 3QHYA 3OZHA 2Y2IA 4HEFA 3FKWA 4MNRA 4BD0A 3CMZA 4X69A 3LO7A 5CXWA 3A3JA 1K57A 3FZCA 5EVIB 5FQ9A 5I94A 4OPZA 3BM6A 2P74A 4UA7A 1CI9A 1KGEA 3O87A 5GHYA 3OPPA 4IEDA 2X71A 4ZJ3A 1K6SA 3ZNYA 4GDNA 1KE4A 4S2KA 2Y2OA 3Q1FA 4EWFA 4O7DA 2X02A 4BL3A 2OLUA 5U47A 2ZJ9A 5CGSA 4EBPA 3TG9A 2P9VB 2R9WA 3IXBA 4KQOA 5A90A 1ES3A 4QY6A 2Z2LB 1IYPA 1DJCA 1ZC2A 1XGIA 4WBGA 3S4XA 4MEZA 4YFMA 5FA7A 5CHMA 1JTGA 1E3UD 3N6IA 1KGFA 4WMCA 3Q7VB 2WAEA 5FAPA 5EVIA 4R4RA 4EV4A 3RJUA 1DY6A 4R3BA 3C5AA 2HP9A 3S1YA 3ZGAB 1QMEA 4JKTA 4WZ5A 2XDMA 2WGVA 1S6RA 1L0DA 1ES4A 4OQIA 1BZAA 3HUMA 4OOYA 4DRTA 4ZTKA 5HL1A 2IWBA 1ES5A 1NY0A 3ZNTA 2ZC3B 2Y55A 1WE4A 4KG2A 2EX2A 1JTDA 2V2FF 4E3LA 5FASA 4PPRA 2Y2QA 1TDGA 4LENA 2P9VA 4HBUA 1YLPA 4ID4A 4ZAMA 5JYPA 5KSCA 1PWCA 3ZCZA 1XPBA 1J9MA 2Z2LA 2JC7A 2ZQ7A 1PI5A 4GN2A 3UE0A 2XK1A 1FCMA 3MZEA 3Q7VA 5DF9A 1CI8A 5FI6A 5A92A 5HW3A 2J9PA 1E25A 4S2LA 2Y2JA 2BG1A 3N7WA 3G2YA 4WELA 4C3QA 1CEGA 3MXRA 5E2FA 3O86A 1K56D 1KGGA 3DW0A 1W8QA 3UO9A 3O3VA 4EUZA 2J8YA 1SHVA 4OPRA 4OOMA 1GHMA 2Y2GA 1K38A 2A3UA 3ZG9B 2ZC3A 1ERMA 1KDSA 3AGEA 1I2WA 3PBOA 5EPHA 4X6TA 1PW1A 4KZ6A 1WYCA 4N1HA 1PIOA 1LL9A 4PM9A 3PBSA 3G2ZA 3WS0A 1NRFA 2HDRA 4KZ7A 3HUNA 1FR1A 2XD1A 2WUQA 3VFHA 5JYOA 2OSUA 5CTMA 2XR0A 3VOZA 5TGFA 5DF7A 3RXWA 5E43A 1O07A 1CEFA 5GHZA 2GDNA 4UA6A 3BLMA 4KZ4A 4S2JA 4XXRA 4KG6A 2H5SA 1E4DA 2Z2MB 4OP8A 2G2UA 4MLLA 4K0WA 3GTCA 3WS4A 4KQQA 3N8LA 4GB7A 3SS4A 5J8XA 1KE3A 4RX3A 1FQGA 3G30A 4R0QA 4QHCA 4E3KA 5KSHA 4GOGA 1K55C 4KZAA 4N92A 2X01A 2ZC4B 5HAPA 1PW8A 3BFGA 5CERA 5FAQA 3SH9A 3JYIA 5F1FA 5CGWA 3GQZA 5FDHA 3M6HA 4XUXA 3CG5A 4JXGA 4WYYA 5EOEA 1G6AA 5F1GA 4BLMA 2ZC6B 1SCWA 5CRFA 1MWUA 1IELA 3IF6B 3MFDA 4OKPA 2VGJA 4M3KA 3BFDA 3NCKA 2PU4A 2UWXA 4ZJ1A 1L2SA 5HX9A 3GR2A 3MKEA 1NXYA 3HVFA 4GKUA 1BUEA 1SKFA 2WYXA 3OPHA 5E2GA 3BFCA 1LHYA 2WGIA 3HL9A 4F94A 4Y0TA 1XA7A 4HESA 3G4PA 2HDSA 2QMIA 1YMSA 2IWCA 1XP4A 4P0MA 2V1ZA 1OMEA 2ZC4A 4Y0OA 5A93A 1MXOA 4MBFA 4ZBEA 5CEBA 4E3IA 4X55A 4DXBA 4DE2A 4S2NC 1TEMA 1H8ZA 4P87A 4OQHA 1YLZA 5M1AA 5CECA 3Q82A 3HUOA 4FD8A 3IT9A 3DTMA 4WZ4A 4IBRA 3IF6A 1PZOA 4Y7PA 2A49A 1SDNA 1Z6FA 3DWZA 3UPNA 1CK3A 1ALQA 1NJ4A 1FSWA 3C4PA 1VQQA 4OH0A 1BLSA 1YLWA 1ESIA 3AGFA 2Q9MA 2H10A 4KENB 3VFFA 1DJBA 1JVJA 2ZC5B 1MY8A 3HLDA 4JPMA 4KZ9A 2XGNA 3E2LA 2EX8A 1XA1A 4R23A 5AQBA 3UDIA 2R9XA 3V5MA 4CJNA 1ZKJA 2EX6A 3G34A 1N4OA 4R4SA 3Q7ZA 2WZZA 4OLGA 4FH2A 4OPQA 2HP5A 2IWDA 3NIAA 4LV2A
chains in the Genus database with same CATH superfamily
3G32A 4JF5A 2INWA 1L0GA 4CPKA 4K0XA 4OONA 1JWPA 1ZHHB 3MQQA 4GZBA 3VP1A 2ZM8A 1EROA 4RX2A 1K55A 2Y2HA 1X0OA 4UHUA 5FQMA 1M6KA 1KVMA 1IKIA 3PAGA 4EUVA 3T1SA 1AXBA 1XX2A 5GHXA 4WEJA 3SOIA 3C38A 5FSRA 1IEMA 3E98A 1HZOA 1Y28A 2FFYA 1PZPA 4HNBA 3Q81A 3FV7A 4DE1A 2FFFB 3KX0X 1GA0A 4G3VA 4I39A 1XGJA 3BFEA 4S2OA 3ZVTA 4DJ2A 1PRQA 5GLBA 5L8MA 1BYWA 3IF5A 4EEPA 3E2KA 4OLDA 5DVAA 2HPBA 2WGWB 1E3UA 3L9KA 2J7VA 2Y4AA 4JGOA 2XFSA 5HSQA 1G5UA 2ZQ8A 2OWJA 1ZG6A 2XFTA 2JE5A 2ZQCA 4B4ZA 3UPPA 2WKRA 3D9YA 3MZDA 2Z2MA 5G18A 1KE0A 4C6YA 2WKEA 1FIKA 2JKRI 3IX4A 4MCWA 2M7UA 2Z6CA 2WKPA 4DDSA 4U3TA 3ISGA 4JXVA 2QPNA 3JPUA 5MC7A 2O99A 3VSKA 5A8BA 2C6WB 2EA9A 5FATA 5AQ9A 4UQIS 1HTZA 3ZYTA 2Y91A 1RGZA 2WZXA 4ZDXA 1TS7A 2R78A 3A0RA 4UQIM 3LIFA 2JN7A 3A3EA 1Y54A 3GMWA 1ES2A 4OOLA 5EVEA 3ITBA 1WYBA 3F1PA 2QKPA 4NETA 3PBNA 1EWZA 5AQ7A 3O5YA 3V67A 4KZ3A 3QNCA 1NWZA 3ITAA 1MKIA 1C3BA 1W5DA 4WN5A 3ZG0A 2W3DA 3UMDA 5HWTA 4E3JA 3HREA 1NLYA 2Y2MA 3FYZA 1S1ZA 3IHAA 4KUKA 4PKYA 3PXPA 4LFUA 5L09A 3ZG7B 2PD8A 4N9KA 5HD5A 1DRMA 3BFFA 2VJWA 3LCEA 5HPIA 5HFOA 4C75A 2Q9NA 4EU0A 3IXHA 2OAQ1 4OQ0A 1LLBA 3KO6A 3O88A 2WKQA 3T4LA 5BOHA 3K3DA 2GX5A 4Y2FA 3VSLA 4YINA 4HJ3A 4E3OA 3CHWP 1D06A 1H8YA 3N4IA 3N8RA 3BQAA 1L3LA 2J9OA 2OV5A 3UPOA 4WMCD 1I5QA 4E6XA 1NYMA 4H6JA 4HQAA 3T4SA 3BRMA 4RYEA 1ZTUA 1M40A 1PI4A 4L0LA 2PYRA 1XFNA 2O9BA 5KIZA 5KMWA 1YLTA 5DJTA 3UB7A 5AVEA 2ZM2A 2YKFA 3HLBA 4S2MA 1W63M 2Y2NA 4S2PA 4LCMA 3JVVA 3UY6A 1W7FA 3Q07A 4EQIA 2ZMVA 1YAXA 3FG8A 5FEFA 1MWRA 3IXDA 3NDEA 5G4ZA 1MPLA 4NXBA 1MC0A 4MNRA 4BD0A 3KSIA 1K57A 2P04A 3O87A 2H28A 5GHYA 2JKTI 4HY8A 3RTYA 4LRYC 4GDNA 1KE4A 3T4JA 2X02A 5FDSA 4EBPA 4FTXA 3NJAA 4LPZA 4KQOA 5A90A 2Z2LB 1PNEA 4WMCA 1KOUA 5IT5A 1T18A 4EV4A 2BASA 1VB6A 2VKSA 1DY6A 3C5AA 2HP9A 3S1YA 3CUEA 2XA7S 2WGVA 1GSXA 1JNUA 4LLOB 4GW9A 2ZC3B 4KG2A 1WE4A 2XA7M 2V0WA 3A0VA 4X1MA 1TDGA 2MJ6A 3SW1A 4NXFA 1G28A 4ZAMA 1PI5A 4GN2A 3Q7VA 4F3LA 2VK3A 5A92A 5HW3A 1OJGA 1VEUB 3N7WA 4CLCA 4C3QA 1CEGA 1KGGA 1W8QA 2W27A 1K38A 5J7EA 1ERMA 3BW6A 1P9RA 4KZ6A 3G2ZA 2W3HA 3HUNA 2XD1A 3DBAA 4Y3IA 5JYOA 5E43A 1O07A 2GDNA 4I5SA 4KZ4A 4S2JA 4XXRA 3NECA 2PD7A 1LL8A 2KX6A 4IUKA 4K0WA 3GTCA 3QP6A 1KE3A 1UGUA 4R0QA 4QHCA 4N92A 2X01A 5FAQA 2VGLS 5CGWA 3LIEA 4JGPA 2B95A 5L07A 1G6AA 5F1GA 1SCWA 2VGLM 1MWUA 1V9YA 1IELA 4M3KA 3BFDA 3NCKA 4ZJ1A 3KSGA 5HX9A 4GKUA 5HWWA 1BUEA 2WYXA 3OPHA 3BY9A 3QP1A 4GHIA 3BFCA 4ETZA 3T1RA 3BQ8A 5A93A 3VOLA 1MXOA 5DFXA 4E3IA 4DE2A 1H8ZA 4P87A 5M1AA 4WZ4A 4IBRA 1K0KA 2A49A 1TD5A 1BLSA 1YLWA 1ESIA 2H10A 1XJ4A 2Z6DA 3VFFA 1DJBA 2ZC5B 1MY8A 3PHYA 3V5MA 5F5YA 4I3JA 1N4OA 3NIAA 1Z09A 1K54A 1H8MA 3LUQA 2PAVP 1OTDA 2H0YA 2PT7A 3S7QA 1LI0A 1SDEA 1XJ3A 2VX8A 5E2EA 3ZDJA 4E6WA 3P09A 4L9GA 5F83A 4NXGA 2WK0A 3OCNA 4HHDA 4B4XA 5CEDA 4PM5A 1H5XA 2E8JA 3DAVA 5EUAA 3K2NA 4X53A 4RA7A 2W0NA 1IYQA 4HBTA 2RL3A 3M6BA 4XUZA 1EI5A 1HD8A 4HOIA 4YOFA 2ZC7A 3MJQA 3MXSA 4NEED 1CF0A 4Q0JA 4PM8A 3S7NA 3F1NB 2DCFA 3H7WB 5D3OA 2HJ9C 4R1GA 3V50A 1F9IA 3W4OA 4ETXA 3BWLA 1N9LA 2WKIA 1MWSA 3NHQA 5EV0A 3G35A 2JCHA 3E4QA 4WZ5C 3SS5A 3UMEA 5TFQA 2J3TC 2J3TD 3MS6A 2WGWA 4B93A 3ZHHA 5FQIA 3UB5P 4Y17A 4JF4A 5CHJA 3C7UA 2XH9A 3S7PA 1VETB 4GD8A 2BTFP 2YKHA 3KYEA 1NZUA 3GECA 3QP4A 1N9BA 4I38A 1EW0A 5EVLA 5HDSA 1L0EA 1P0ZA 1PFLA 4R6LA 5LBRA 1H0MA 4OVDA 1NYYA 3HLCA 3UE1A 1GSWA 2C5WB 2Y2LA 3KYQA 1LSXA 3PYPA 2ACGA 1T19A 5FAOA 4Z9QA 4EBLA 4DN0A 4NXEA 2B5RA 3DTIA 5HARA 4Y5FA 3UB8A 1W8YA 2K2NA 2PR6A 3N8SA 4Q0HA 3SZTA 2V0UA 1F5MA 3LR3A 4UAAA 3ZG8B 3HBRA 4OQGA 3BYDA 2QWSA 5FI7A 3IH9A 2J80A 1UWPX 2CMNA 1U60A 3IWOA 1IFQA 5DTKA 4S2NA 2ZD8A 1XXMA 4FUWA 4YNRA 3LIDA 4QB8A 2WAFA 1S4SA 3BECA 3UB9A 1QMFA 1NLZA 3IF6C 4DXCA 4QWOA 4IBXA 2A24A 2ZMAA 3D4FA 1FCOA 2XF3A 3AGDA 3LR0A 3KYZA 3UDXA 2Y8HA 2OLVA 4EXOA 2M1CA 1GHIA 2EWVA 1CJFA 1YSPA 3PBTA 1KVLA 3NDGA 2K31A 2XEPA 4H8RA 2WADA 3CI6A 1XFQA 3NBLA 2IA2A 3VOYA 3LY3A 3IH8A 5EECA 2ZQ9A 3HLFA 3NI9A 1FR6A 5FI2A 3IX8A 2GJ3A 4Z1WA 1P9WA 2EFXA 1UWNX 4GJ4A 4BBVA 4K91A 2V8FA 4BJPA 4YWZA 4A5RA 5HDCA 2EFUA 5FQQA 3QHYA 4X69A 1D1JA 4Y15A 2UV0E 1D7EA 2P74A 4QPRA 2X71A 4IJGA 1OJ5A 4ARZB 2Y2OA 4O7DA 4EW7A 3EGXC 1S4RA 3RFBA 5CGSA 2P9VB 2JHEA 2PYPA 4NG2A 3DTEA 1S67L 1DJCA 3OLOA 4MEZA 4YFMA 5FA7A 5CHMA 1KGFA 2WAEA 5FAPA 3IS2B 2Y79A 4R3BA 1QMEA 3P01A 4DMZA 4DRTA 1BZAA 1GSVA 2P7JA 5HL1A 3EGDC 3ZNTA 4E3LA 4LENA 2ZL1B 5HPFA 4HBUA 5JYPA 3HCYA 3ZCZA 5J4EA 1J9MA 4KQDA 2Z2LA 3CWFA 3UE0A 1N9OA 1OTAA 4RQ9A 5DF9A 1CI8A 2J9PA 4BBTA 2Y2JA 3EEHA 3TE8A 2LB9A 1K56D 3DW0A 2OOLA 3UO9A 1SHVA 2Y2GA 3ZG9B 2A3UA 2ZC3A 4PHTA 3CAXA 3AGEA 4X6TA 3VE3A 3MMHA 1PW1A 4UEYA 1H3QA 4PM9A 3PBSA 3WS0A 1FR1A 4GS9B 5CTMA 1VEUA 4UA6A 2H5SA 1E4DA 2Z2MB 5TJJA 5EM1A 2G2UA 4KQQA 4HP4A 4GB7A 5J8XA 3G30A 2VV8A 4GOGA 4KZAA 3GQZA 1MKMA 5EOEA 2HZ5A 3JVUA 3IF6B 1OTBA 3VE4A 3TW8A 3F1OB 2PU4A 2UWXA 3GR2A 1NXYA 3IBJA 2WGIA 2V9AA 1XA7A 4HESA 2HDSA 5F68A 2IWCA 1XP4A 2W3GA 3LGOA 4MBFA 4X55A 1AWIA 1YLZA 4R3AA 1LSWA 3HUOA 4NKPA 1CK3A 1NJ4A 1FSWA 1VQQA 4OH0A 3AGFA 1JVJA 4JPMA 3HLDA 4R23A 1XA1A 1ZKJA 4OPQA 2AVXA 1DP6A 2O0YA 2FZ0A 3M2KA 1I2SA 3G31A 3B3XA 3PBQA 3LEZA 2PDRA 3VP3A 5DTSA 4DKIA 2VGKA 4PAUA 1YLJA 1XKZA 3V3RA 3S7OA 3UB6A 3ZFZA 2XQZA 4L9FA 4XT2B 4LV1A 1W79A 5M19A 3C7VA 1G68A 3PTEA 1PYYA 2W1TB 2G7UA 1J3WA 3UE3A 3A0SA 4HI4A 5FQKA 3WRZA 3EQVA 5M18A 4HIAA 4HH2A 4ZRRA 3B33A 3EOIA 3U4LP 5AVFA 2PR5A 3MR0A 4H6JB 2DRWA 1VM1A 5CHUA 2PU2A 4BD1A 1LSVA 3W8KA 1GHPA 3B47A 2QZ6A 2WKHA 4E3MA 1OTEA 2KOIA 5TBMB 1K4FA 2VLGA 4EETB 4E3NA 3T1QB 1SKOB 3TOIA 5EVIC 5EVID 2EXBA 1S0WA 1XJ6A 3OPLA 3ICYA 3F1NA 4PM7A 1RGYA 3LR4A 2QHKA 3H7WA 2B18A 2XLNA 4HJ4A 3UN7A 3IWQA 4QY5A 3TRCA 5A91A 4KZ5A 4WM9A 1YMXA 3OCLA 2QYBA 1TS8A 1TS0A 4PMAA 1CQAA 2G2WA 1G6OA 4NK3A 3T50A 3V39A 5KZHA 3SH7A 1VETA 4PM6A 4X25A 2OAP1 2PHYA 1K6RA 1TS6A 3BEBA 2ZQAA 4QJGA 4Q8IA 2V20A 4BQMA 3UNWA 4O01A 4DF6A 1ODVA 3I7JA 4IHQA 3GV9A 5HZHA 3E0YA 3P98A 2W3FA 3PBRA 2ZOHA 2L1MA 2ZLYA 3VV4A 4WEKA 2JKGA 1IOUA 4UA9A 3OC2A 5HAIA 4OP5A 4IVKA 1OPXA 1Q2QA 4P6ZS 3NC8A 3MBZA 5FQJA 3W4PA 2B02A 1YT4A 1LL5A 3EWKA 3H82B 1IYOA 2Q0OA 4GD6A 1K25A 3CJMA 4IVIA 3WWXA 4S2IA 3ZVWA 1BLHA 2HF6A 4HP9A 3R4KA 3FKVA 5GLAA 1V9ZA 2OWHA 3W4QA 3WS5A 4IUHA 3W2ZA 3CZDA 1F2KA 3CLOA 1TVFA 3LI9A 3V3SA 4BL2A 2JKFA 1FCNA 2XD5A 3WS2A 4QU3A 1OT9A 4DJ3A 4D60A 4Y0UA 4Y13A 3HLWA 2EX9A 4LV0A 2HP6A 3L7HA 4JLFA 4GDBA 4PKYG 5CGXA 3CPTB 3H9WA 4P6BA 4LRZE 4KUOA 4QD4A 1N9NA 1P97A 4JF6A 3IXGA 3G6OA 2BLSA 3OZHA 2Y2IA 4HEFA 4CLCE 3CMZA 3LO7A 4ESPA 3A3JA 3FZCA 5EVIB 5I94A 4OPZA 1MZUA 3MQOA 2VA0A 4EESA 2O9AA 1CI9A 2ZBBA 4EERA 3OPPA 1K6SA 3ZNYA 1ACFA 4S2KA 4B9OA 2XROA 3IXBA 2LB5A 3S4XA 1IYPA 4HJ6A 1XGIA 2VV7A 1JTGA 1E3UD 3T4QA 2KDKA 4GLQA 2PRFA 1A0KA 4FOFA 2PBDP 3LFVA 4JKTA 4WZ5A 2XDMA 1L0DA 1ES4A 4OQIA 3T12B 4ARZA 4ZTKA 1ES5A 3QP2A 3E4OA 5FASA 1JTDA 2V1AA 1VHMA 4PPRA 2Y2QA 2P9VA 1YLPA 4ID4A 5KSCA 1XPBA 2JC7A 2ZQ7A 1T1BA 4I3AA 5HL6A 3KSFA 3MZEA 1FILA 2KLIA 2L4RA 3R7WB 3IS2A 3EEAA 3G2YA 5IU1A 3MXRA 5E2FA 3O86A 2QJ5A 4EUZA 3O3VA 4OOMA 3PBOA 5EPHA 2ZL1A 4N1HA 1PIOA 1LL9A 5DFYA 1NRFA 2HDRA 2XR0A 5DF7A 2NUTC 2ZMFA 3BLMA 4OP8A 4MLLA 3N8LA 3SS4A 4RX3A 1FQGA 3UE6A 5KSHA 2ZC4B 5HAPA 1PW8A 3BFGA 3SH9A 3JYIA 5FDHA 4JXGA 4GS9A 4BLMA 2ZC6B 5CRFA 3T4OA 3MFDA 4OKPA 3T4KA 4E04A 1L2SA 3HVFA 1T1AA 1LHYA 3HL9A 1NRJA 3G4PA 3T4TA 3GDIA 4P0MA 5L10A 1OMEA 4MMNA 4ZBEA 2XSSA 4DXBA 2P08A 5CECA 3DTMA 3IF6A 1PZOA 3TJZC 4Y7PA 3MSHA 5IS1A 1SDNA 3DWZA 3F1OA 2Q9MA 5CX7A 4KENB 3BY8A 2XGNA 3E2LA 2EX8A 4CJNA 3UDIA 2R9XA 2EX6A 5G4YA 4R4SA 3Q7ZA 2EWWA 4OLGA 2HP5A 3VMAA 4BENA 4LV2A 3NY4A 5CTNA 2HGVA 1RCJA 4B88A 5F82A 3GRJA 3FPWA 1BLCA 1O7EA 1MBLA 4JBFA 3NULA 3HLEA 4LCLA 4O0PA 5FL3A 4WL9A 2J3WA 1ONGA 3QNBA 1XJ2A 4BWIA 4GNUA 1DJAA 4D2OA 3A3DA 2FH5A 5E2HA 2D02A 3LR5A 3IHBA 4JGRA 3UDFA 2A24B 3GVBA 1S1YA 1S66L 3EQUA 4EBNA 2VV6A 3SH8A 4BMWA 4N1XA 2A2LA 1FSYA 5GL9A 1DP9A 1ONHA 4MN5A 1YSQA 4MN7A 1K57C 3SS3A 2H0TA 2GZAA 1KDWA 2DNSA 4XT2A 4JGQA 3B42A 3OPRA 2ZQDA 3FWLA 1WA9A 2PBYA 3FPVA 2W1TA 4U0TA 3K3CA 4FCFA 3C4OA 3LIBA 1GCEA 3OOVA 3NOUC 1BT5A 3M2JA 4DDYA 4HH3A 4OPYA 5IHVA 1K4EA 2D01A 5EFWA 2HDUA 3VP2A 1ESUA 3MKFA 3HLGA 4L9EA 5EE8A 3CUEC 2I72A 3D3OA 4U0XA 3TSGA 3BLSA 3RXXA 1BLPA 5L2FA 2HV1A 1ERQA 1BTLA 3IQAA 3IWIA 4RVAA 5EOOA 1DP8A 2E8IA 1PWGA 4P85A 3WS1A 2JKRM 3LICA 5TBMA 1YLYA 1SKOA 4FSFA 3PR6A 4MN6A 3QP5A 1K56A 3MQ0A 1HVBA 4CLCC 1YM1A 4CLCD 3F1PB 4AFIA 3A3IA 5F69A 1IYSA 3MZFA 3BJNA 3LY4A 4BBUA 1JWZA 5DKKA 4Q0IA 2CC1A 4X68A 4FH4A 3IX3A 3NOTC 3P7NA 4X56A 2Y2PA 5DF8A 4WUJA 3C2WA 4N9LA 4LRXC 4DE3A 2ZOIA 3DWKA 5GLCA 2QJ7A 2O9CA 1BSGA 3ZG5A 1JWVA 4EQ1A 4K08A 4KZ8A 4JXWA 5FEGA 5DKLA 2L0WA 5HWVA 1ZG4A 2V1BA 4G3KA 3E4PA 3CITA 2V8CA 1GA9A 1Y4OA 1YPRA 2DMWA 1PWDA 1W63Q 1TF1A 1Q2PA 2NUPC 5F6AA 2Y59A 4KQRA 5HD3A 5AJGA 4KZBA 1LI9A 4KG5A 5HDDA 4MBHA 3RH8B 2ZM0A 3ZQ5A 4JXSA 4II7A 2JBFA 1T1CA 5TR7A 3GSGA 4R3JA 5K5BA 3LEQA 3VP0A 2W1RA 3H82A 1K54C 3A3FA 1RP5A 2VEAA 3S22A 1IKGA 2RCXA 2HDQA 1NZOA 3WRTA 2EXAA 3PAEA 2M7VA 4DE0A 5GLDA 3ULFA 1BULA 1FOFA 5DTTA 1TDLA 1OT6A 4MBKA 5HAQA 1YQSA 4LV3A 2XRNA 3VP4A 3NOPC 4ZJ2A 3D72A 5AQAA 1L0FA 2Y2KA 4GCZA 1MWTA 3OBFA 5J3WA 3FKWA 5CXWA 5FQ9A 3BM6A 4UA7A 1KGEA 2JKTM 4IEDA 4ZJ3A 3U2AA 3KSHA 1OTIA 4EEUA 3Q1FA 4EWFA 3CPTA 4BL3A 2OLUA 5U47A 2ZJ9A 2GNXA 3MF0A 2R9WA 3DTKA 1HLUP 4QY6A 1ES3A 4WBGA 1ZC2A 2K7SA 4I3IA 3N6IA 3Q7VB 4F3LB 3LYXA 4O8GA 4WF0A 1SZVA 5EVIA 2VZWA 3MXQA 4R4RA 3RJUA 4CLCB 3ZGAB 1S6RA 4OOYA 3HUMA 2IWBA 1NY0A 2Y55A 2EX2A 2V2FF 1PWCA 2XK1A 4P6ZM 1FCMA 3MFXA 1YKDA 2HJEA 2I9VA 5FI6A 1E25A 4S2LA 2BG1A 4WELA 5DJUA 4WLAA 2J8YA 4M4XA 4OPRA 1GHMA 1KDSA 1I2WA 1WYCA 3T1XA 3C30A 4KZ7A 3R7WA 2WUQA 3VFHA 2OSUA 3VOZA 5TGFA 3RXWA 3HJIA 1CEFA 5GHZA 4KG6A 4R38A 4R70A 4GHIB 3WS4A 4CQHA 3LIAA 4E3KA 1K55C 5CERA 5F1FA 3M6HA 4X1LA 3CG5A 4WYYA 4XUXA 2VGJA 4G3WA 3MKEA 1SKFA 4MDZA 5E2GA 3FC7A 4Y0TA 4F94A 1F98A 2QMIA 1YMSA 3IBRA 3C8CA 2V1ZA 4ME4A 2ZC4A 4Y0OA 5CEBA 3QP8A 4S2NC 1TEMA 4OQHA 3Q82A 4FD8A 3IT9A 5I5LA 5EM0A 1Z6FA 3UPNA 1ALQA 3HJKA 3C4PA 5C5KA 2W3EA 1STZA 4LGWA 4KZ9A 3TG9A 5AQBA 3G34A 2WZZA 3LI8A 1LT0A 4FH2A 2IWDA
chains in the Genus database with same CATH topology
3G32A 3NY4A 4JF5A 1K54A 5CTNA 1L0GA 2H0YA 1RCJA 4CPKA 3M2KA 4B88A 4K0XA 1I2SA 3G31A 4OONA 3B3XA 1JWPA 3PBQA 3LEZA 5F82A 3GRJA 1LI0A 1BLCA 1O7EA 4GZBA 3VP3A 3VP1A 2ZM8A 1EROA 4RX2A 1K55A 5DTSA 4DKIA 2VGKA 1MBLA 2Y2HA 4JBFA 4LCLA 3HLEA 1YLJA 4UHUA 5FQMA 1XKZA 1SDEA 3V3RA 1M6KA 3ZDJA 5E2EA 1KVMA 1ONGA 3QNBA 1IKIA 4E6WA 3P09A 3PAGA 4GNUA 5F83A 3ZFZA 1AXBA 1XX2A 2XQZA 1DJAA 2WK0A 4LV1A 5GHXA 4D2OA 1W79A 3OCNA 3A3DA 5M19A 4B4XA 3C7VA 5E2HA 1G68A 5CEDA 3IHBA 3PTEA 4PM5A 1H5XA 4WEJA 1PYYA 3GVBA 3UDFA 4BENA 3SOIA 5FSRA 3EQUA 5EUAA 1IEMA 4EBNA 1HZOA 3UE3A 4X53A 4RA7A 3SH8A 1IYQA 2FFYA 1PZPA 4N1XA 4HBTA 3Q81A 2RL3A 3FV7A 4DE1A 1FSYA 5FQKA 5GL9A 3WRZA 2FFFB 1ONHA 1GA0A 1XGJA 3BFEA 1K57C 3M6BA 3EQVA 4S2OA 4XUZA 5M18A 1EI5A 3ZVTA 3SS3A 1HD8A 2H0TA 5GLBA 1KDWA 2ZC7A 2DNSA 3MXSA 2DRWA 3OPRA 2ZQDA 3FWLA 1VM1A 5CHUA 4PM8A 2PU2A 3IF5A 4BD1A 2DCFA 2PBYA 3E2KA 3W8KA 1GHPA 4OLDA 2QZ6A 4U0TA 5D3OA 4FCFA 4R1GA 2WKHA 3C4OA 2HPBA 2WGWB 1E3UA 5DVAA 3V50A 1GCEA 3W4OA 4E3MA 1BT5A 3M2JA 4DDYA 2J7VA 4OPYA 2Y4AA 5IHVA 1K4EA 1K4FA 2WKIA 4E3NA 1MWSA 3G35A 3TOIA 5EVIC 2HDUA 5EVID 3VP2A 2XFSA 1ESUA 3MKFA 3HLGA 5EE8A 2EXBA 2JCHA 2ZQ8A 2I72A 1ZG6A 2XFTA 1S0WA 2JE5A 2ZQCA 4U0XA 4WZ5C 4B4ZA 3SS5A 3TSGA 3UPPA 3BLSA 3RXXA 5TFQA 1BLPA 5L2FA 3OPLA 3MZDA 2Z2MA 1ERQA 1BTLA 3IQAA 1RGYA 3IWIA 4PM7A 4RVAA 5EOOA 2E8IA 5G18A 1KE0A 4C6YA 1PWGA 2WKEA 2XLNA 4P85A 3WS1A 2WGWA 3ZHHA 5FQIA 4JF4A 3UN7A 3IWQA 5CHJA 4QY5A 1YLYA 3C7UA 5A91A 4FSFA 2XH9A 4KZ5A 4WM9A 4GD8A 1YMXA 4DDSA 1K56A 3OCLA 4U3TA 3ISGA 1HVBA 1YM1A 4JXVA 2QPNA 1NZUA 3VSKA 3A3IA 1N9BA 5EVLA 2C6WB 1IYSA 4PMAA 1L0EA 2G2WA 3MZFA 5FATA 5AQ9A 1HTZA 2Y91A 1RGZA 3LY4A 4NK3A 2WZXA 4ZDXA 1JWZA 3V39A 4X68A 2CC1A 5KZHA 3A3EA 4FH4A 1Y54A 4OVDA 1NYYA 3HLCA 3UE1A 2C5WB 4X56A 3GMWA 2Y2PA 2Y2LA 3SH7A 5DF8A 4PM6A 1ES2A 4OOLA 3ITBA 1WYBA 4N9LA 3VMAA 4NETA 1K6RA 3BEBA 3PBNA 1EWZA 2ZQAA 4DE3A 4QJGA 5AQ7A 3DWKA 5GLCA 4KZ3A 4Q8IA 3QNCA 5FAOA 4Z9QA 2V20A 4EBLA 1BSGA 4BQMA 3UNWA 3ZG5A 4DF6A 1JWVA 3ITAA 2B5RA 5HARA 3I7JA 1MKIA 1W8YA 1C3BA 1W5DA 4KZ8A 3GV9A 4JXWA 3N8SA 3ZG0A 3P98A 3PBRA 4E3JA 3HREA 2ZLYA 4WEKA 4UA9A 3OC2A 2Y2MA 5HAIA 4OP5A 4IVKA 1Q2QA 3FYZA 4UAAA 3ZG8B 3NC8A 3HBRA 1ZG4A 3IHAA 4OQGA 3BYDA 3ZG7B 4N9KA 5FI7A 3BFFA 3MBZA 3LCEA 3IH9A 5HFOA 1GA9A 5FQJA 4C75A 3W4PA 1U60A 2Q9NA 1YT4A 3IWOA 5DTKA 3IXHA 4S2NA 1LL5A 2ZD8A 1XXMA 1LLBA 4OQ0A 1IYOA 1PWDA 3O88A 4QB8A 2WAFA 5BOHA 4GD6A 3BECA 1K25A 1QMFA 3CJMA 1Q2PA 3IF6C 4DXCA 4IVIA 3VSLA 4YINA 2Y59A 4KQRA 4IBXA 3WWXA 2ZMAA 4E3OA 3D4FA 4KZBA 1LI9A 4KG5A 4S2IA 1BLHA 1FCOA 3ZVWA 1H8YA 3N4IA 3N8RA 4MBHA 2XF3A 3FKVA 3AGDA 2ZM0A 5GLAA 4JXSA 2J9OA 2OV5A 3UPOA 2JBFA 4WMCD 3UDXA 2OLVA 3GSGA 4R3JA 5TR7A 1I5QA 4E6XA 3VP0A 3W4QA 3WS5A 1K54C 1GHIA 1NYMA 3A3FA 3CZDA 3PBTA 1KVLA 3NDGA 1RP5A 3S22A 1IKGA 2RCXA 3BRMA 2HDQA 4RYEA 1TVFA 1M40A 2XEPA 1NZOA 3WRTA 4H8RA 3V3SA 2EXAA 1PI4A 2WADA 3PAEA 4L0LA 4BL2A 5KMWA 1FCNA 2XD5A 4DE0A 1YLTA 3NBLA 3WS2A 2ZM2A 3VOYA 4QU3A 5GLDA 3HLBA 4S2MA 1BULA 3LY3A 1FOFA 3IH8A 2Y2NA 2ZQ9A 4S2PA 4Y0UA 5EECA 3HLWA 3HLFA 1TDLA 2EX9A 3NI9A 4LCMA 5DTTA 1FR6A 4LV0A 5FI2A 2HP6A 3UY6A 4JLFA 4GDBA 4MBKA 1W7FA 2EFXA 5CGXA 3Q07A 4EQIA 4P6BA 5HAQA 1YQSA 4LV3A 3VP4A 1MWRA 4QD4A 4ZJ2A 4JF6A 3IXDA 3IXGA 1L0FA 3NDEA 2Y2KA 4K91A 1MWTA 5AQAA 2BLSA 2EFUA 4A5RA 4BJPA 5FQQA 1MPLA 3QHYA 3OZHA 2Y2IA 4HEFA 3FKWA 4MNRA 4BD0A 3CMZA 4X69A 3LO7A 5CXWA 3A3JA 1K57A 3FZCA 5EVIB 5FQ9A 5I94A 4OPZA 3BM6A 2P74A 4UA7A 1CI9A 1KGEA 3O87A 5GHYA 3OPPA 4IEDA 2X71A 4ZJ3A 1K6SA 3ZNYA 4GDNA 1KE4A 4S2KA 2Y2OA 3Q1FA 4EWFA 4O7DA 2X02A 4BL3A 2OLUA 5U47A 2ZJ9A 5CGSA 4EBPA 3TG9A 2P9VB 2R9WA 3IXBA 4KQOA 5A90A 1ES3A 4QY6A 2Z2LB 1IYPA 1DJCA 1ZC2A 1XGIA 4WBGA 3S4XA 4MEZA 4YFMA 5FA7A 5CHMA 1JTGA 1E3UD 3N6IA 1KGFA 4WMCA 3Q7VB 2WAEA 5FAPA 5EVIA 4R4RA 4EV4A 3RJUA 1DY6A 4R3BA 3C5AA 2HP9A 3S1YA 3ZGAB 1QMEA 4JKTA 4WZ5A 2XDMA 2WGVA 1S6RA 1L0DA 1ES4A 4OQIA 1BZAA 3HUMA 4OOYA 4DRTA 4ZTKA 5HL1A 2IWBA 1ES5A 1NY0A 3ZNTA 2ZC3B 2Y55A 1WE4A 4KG2A 2EX2A 1JTDA 2V2FF 4E3LA 5FASA 4PPRA 2Y2QA 1TDGA 4LENA 2P9VA 4HBUA 1YLPA 4ID4A 4ZAMA 5JYPA 5KSCA 1PWCA 3ZCZA 1XPBA 1J9MA 2Z2LA 2JC7A 2ZQ7A 1PI5A 4GN2A 3UE0A 2XK1A 1FCMA 3MZEA 3Q7VA 5DF9A 1CI8A 5FI6A 5A92A 5HW3A 2J9PA 1E25A 4S2LA 2Y2JA 2BG1A 3N7WA 3G2YA 4WELA 4C3QA 1CEGA 3MXRA 5E2FA 3O86A 1K56D 1KGGA 3DW0A 1W8QA 3UO9A 3O3VA 4EUZA 2J8YA 1SHVA 4OPRA 4OOMA 1GHMA 2Y2GA 1K38A 2A3UA 3ZG9B 2ZC3A 1ERMA 1KDSA 3AGEA 1I2WA 3PBOA 5EPHA 4X6TA 1PW1A 4KZ6A 1WYCA 4N1HA 1PIOA 1LL9A 4PM9A 3PBSA 3G2ZA 3WS0A 1NRFA 2HDRA 4KZ7A 3HUNA 1FR1A 2XD1A 2WUQA 3VFHA 5JYOA 2OSUA 5CTMA 2XR0A 3VOZA 5TGFA 5DF7A 3RXWA 5E43A 1O07A 1CEFA 5GHZA 2GDNA 4UA6A 3BLMA 4KZ4A 4S2JA 4XXRA 4KG6A 2H5SA 1E4DA 2Z2MB 4OP8A 2G2UA 4MLLA 4K0WA 3GTCA 3WS4A 4KQQA 3N8LA 4GB7A 3SS4A 5J8XA 1KE3A 4RX3A 1FQGA 3G30A 4R0QA 4QHCA 4E3KA 5KSHA 4GOGA 1K55C 4KZAA 4N92A 2X01A 2ZC4B 5HAPA 1PW8A 3BFGA 5CERA 5FAQA 3SH9A 3JYIA 5F1FA 5CGWA 3GQZA 5FDHA 3M6HA 4XUXA 3CG5A 4JXGA 4WYYA 5EOEA 1G6AA 5F1GA 4BLMA 2ZC6B 1SCWA 5CRFA 1MWUA 1IELA 3IF6B 3MFDA 4OKPA 2VGJA 4M3KA 3BFDA 3NCKA 2PU4A 2UWXA 4ZJ1A 1L2SA 5HX9A 3GR2A 3MKEA 1NXYA 3HVFA 4GKUA 1BUEA 1SKFA 2WYXA 3OPHA 5E2GA 3BFCA 1LHYA 2WGIA 3HL9A 4F94A 4Y0TA 1XA7A 4HESA 3G4PA 2HDSA 2QMIA 1YMSA 2IWCA 1XP4A 4P0MA 2V1ZA 1OMEA 2ZC4A 4Y0OA 5A93A 1MXOA 4MBFA 4ZBEA 5CEBA 4E3IA 4X55A 4DXBA 4DE2A 4S2NC 1TEMA 1H8ZA 4P87A 4OQHA 1YLZA 5M1AA 5CECA 3Q82A 3HUOA 4FD8A 3IT9A 3DTMA 4WZ4A 4IBRA 3IF6A 1PZOA 4Y7PA 2A49A 1SDNA 1Z6FA 3DWZA 3UPNA 1CK3A 1ALQA 1NJ4A 1FSWA 3C4PA 1VQQA 4OH0A 1BLSA 1YLWA 1ESIA 3AGFA 2Q9MA 2H10A 4KENB 3VFFA 1DJBA 1JVJA 2ZC5B 1MY8A 3HLDA 4JPMA 4KZ9A 2XGNA 3E2LA 2EX8A 1XA1A 4R23A 5AQBA 3UDIA 2R9XA 3V5MA 4CJNA 1ZKJA 2EX6A 3G34A 1N4OA 4R4SA 3Q7ZA 2WZZA 4OLGA 4FH2A 4OPQA 2HP5A 2IWDA 3NIAA 4LV2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G32 A;  3NY4 A;  4JF5 A;  1K54 A;  5CTN A;  1L0G A;  2H0Y A;  1RCJ A;  4CPK A;  3M2K A;  4B88 A;  4K0X A;  1I2S A;  3G31 A;  4OON A;  3B3X A;  1JWP A;  3PBQ A;  3LEZ A;  5F82 A;  3GRJ A;  1LI0 A;  1BLC A;  1O7E A;  4GZB A;  3VP3 A;  3VP1 A;  2ZM8 A;  1ERO A;  4RX2 A;  1K55 A;  5DTS A;  4DKI A;  2VGK A;  1MBL A;  2Y2H A;  4JBF A;  4LCL A;  3HLE A;  1YLJ A;  4UHU A;  5FQM A;  1XKZ A;  1SDE A;  3V3R A;  1M6K A;  3ZDJ A;  5E2E A;  1KVM A;  1ONG A;  3QNB A;  1IKI A;  4E6W A;  3P09 A;  3PAG A;  4GNU A;  5F83 A;  3ZFZ A;  1AXB A;  1XX2 A;  2XQZ A;  1DJA A;  2WK0 A;  4LV1 A;  5GHX A;  4D2O A;  1W79 A;  3OCN A;  3A3D A;  5M19 A;  4B4X A;  3C7V A;  5E2H A;  1G68 A;  5CED A;  3IHB A;  3PTE A;  4PM5 A;  1H5X A;  4WEJ A;  1PYY A;  3GVB A;  3UDF A;  4BEN A;  3SOI A;  5FSR A;  3EQU A;  5EUA A;  1IEM A;  4EBN A;  1HZO A;  3UE3 A;  4X53 A;  4RA7 A;  3SH8 A;  1IYQ A;  2FFY A;  1PZP A;  4N1X A;  4HBT A;  3Q81 A;  2RL3 A;  3FV7 A;  4DE1 A;  1FSY A;  5FQK A;  5GL9 A;  3WRZ A;  2FFF B;  1ONH A;  1GA0 A;  1XGJ A;  3BFE A;  1K57 C;  3M6B A;  3EQV A;  4S2O A;  4XUZ A;  5M18 A;  1EI5 A;  3ZVT A;  3SS3 A;  1HD8 A;  2H0T A;  5GLB A;  1KDW A;  2ZC7 A;  2DNS A;  3MXS A;  2DRW A;  3OPR A;  2ZQD A;  3FWL A;  1VM1 A;  5CHU A;  4PM8 A;  2PU2 A;  3IF5 A;  4BD1 A;  2DCF A;  2PBY A;  3E2K A;  3W8K A;  1GHP A;  4OLD A;  2QZ6 A;  4U0T A;  5D3O A;  4FCF A;  4R1G A;  2WKH A;  3C4O A;  2HPB A;  2WGW B;  1E3U A;  5DVA A;  3V50 A;  1GCE A;  3W4O A;  4E3M A;  1BT5 A;  3M2J A;  4DDY A;  2J7V A;  4OPY A;  2Y4A A;  5IHV A;  1K4E A;  1K4F A;  2WKI A;  4E3N A;  1MWS A;  3G35 A;  3TOI A;  5EVI C;  2HDU A;  5EVI D;  3VP2 A;  2XFS A;  1ESU A;  3MKF A;  3HLG A;  5EE8 A;  2EXB A;  2JCH A;  2ZQ8 A;  2I72 A;  1ZG6 A;  2XFT A;  1S0W A;  2JE5 A;  2ZQC A;  4U0X A;  4WZ5 C;  4B4Z A;  3SS5 A;  3TSG A;  3UPP A;  3BLS A;  3RXX A;  5TFQ A;  1BLP A;  5L2F A;  3OPL A;  3MZD A;  2Z2M A;  1ERQ A;  1BTL A;  3IQA A;  1RGY A;  3IWI A;  4PM7 A;  4RVA A;  5EOO A;  2E8I A;  5G18 A;  1KE0 A;  4C6Y A;  1PWG A;  2WKE A;  2XLN A;  4P85 A;  3WS1 A;  2WGW A;  3ZHH A;  5FQI A;  4JF4 A;  3UN7 A;  3IWQ A;  5CHJ A;  4QY5 A;  1YLY A;  3C7U A;  5A91 A;  4FSF A;  2XH9 A;  4KZ5 A;  4WM9 A;  4GD8 A;  1YMX A;  4DDS A;  1K56 A;  3OCL A;  4U3T A;  3ISG A;  1HVB A;  1YM1 A;  4JXV A;  2QPN A;  1NZU A;  3VSK A;  3A3I A;  1N9B A;  5EVL A;  2C6W B;  1IYS A;  4PMA A;  1L0E A;  2G2W A;  3MZF A;  5FAT A;  5AQ9 A;  1HTZ A;  2Y91 A;  1RGZ A;  3LY4 A;  4NK3 A;  2WZX A;  4ZDX A;  1JWZ A;  3V39 A;  4X68 A;  2CC1 A;  5KZH A;  3A3E A;  4FH4 A;  1Y54 A;  4OVD A;  1NYY A;  3HLC A;  3UE1 A;  2C5W B;  4X56 A;  3GMW A;  2Y2P A;  2Y2L A;  3SH7 A;  5DF8 A;  4PM6 A;  1ES2 A;  4OOL A;  3ITB A;  1WYB A;  4N9L A;  3VMA A;  4NET A;  1K6R A;  3BEB A;  3PBN A;  1EWZ A;  2ZQA A;  4DE3 A;  4QJG A;  5AQ7 A;  3DWK A;  5GLC A;  4KZ3 A;  4Q8I A;  3QNC A;  5FAO A;  4Z9Q A;  2V20 A;  4EBL A;  1BSG A;  4BQM A;  3UNW A;  3ZG5 A;  4DF6 A;  1JWV A;  3ITA A;  2B5R A;  5HAR A;  3I7J A;  1MKI A;  1W8Y A;  1C3B A;  1W5D A;  4KZ8 A;  3GV9 A;  4JXW A;  3N8S A;  3ZG0 A;  3P98 A;  3PBR A;  4E3J A;  3HRE A;  2ZLY A;  4WEK A;  4UA9 A;  3OC2 A;  2Y2M A;  5HAI A;  4OP5 A;  4IVK A;  1Q2Q A;  3FYZ A;  4UAA A;  3ZG8 B;  3NC8 A;  3HBR A;  1ZG4 A;  3IHA A;  4OQG A;  3BYD A;  3ZG7 B;  4N9K A;  5FI7 A;  3BFF A;  3MBZ A;  3LCE A;  3IH9 A;  5HFO A;  1GA9 A;  5FQJ A;  4C75 A;  3W4P A;  1U60 A;  2Q9N A;  1YT4 A;  3IWO A;  5DTK A;  3IXH A;  4S2N A;  1LL5 A;  2ZD8 A;  1XXM A;  1LLB A;  4OQ0 A;  1IYO A;  1PWD A;  3O88 A;  4QB8 A;  2WAF A;  5BOH A;  4GD6 A;  3BEC A;  1K25 A;  1QMF A;  3CJM A;  1Q2P A;  3IF6 C;  4DXC A;  4IVI A;  3VSL A;  4YIN A;  2Y59 A;  4KQR A;  4IBX A;  3WWX A;  2ZMA A;  4E3O A;  3D4F A;  4KZB A;  1LI9 A;  4KG5 A;  4S2I A;  1BLH A;  1FCO A;  3ZVW A;  1H8Y A;  3N4I A;  3N8R A;  4MBH A;  2XF3 A;  3FKV A;  3AGD A;  2ZM0 A;  5GLA A;  4JXS A;  2J9O A;  2OV5 A;  3UPO A;  2JBF A;  4WMC D;  3UDX A;  2OLV A;  3GSG A;  4R3J A;  5TR7 A;  1I5Q A;  4E6X A;  3VP0 A;  3W4Q A;  3WS5 A;  1K54 C;  1GHI A;  1NYM A;  3A3F A;  3CZD A;  3PBT A;  1KVL A;  3NDG A;  1RP5 A;  3S22 A;  1IKG A;  2RCX A;  3BRM A;  2HDQ A;  4RYE A;  1TVF A;  1M40 A;  2XEP A;  1NZO A;  3WRT A;  4H8R A;  3V3S A;  2EXA A;  1PI4 A;  2WAD A;  3PAE A;  4L0L A;  4BL2 A;  5KMW A;  1FCN A;  2XD5 A;  4DE0 A;  1YLT A;  3NBL A;  3WS2 A;  2ZM2 A;  3VOY A;  4QU3 A;  5GLD A;  3HLB A;  4S2M A;  1BUL A;  3LY3 A;  1FOF A;  3IH8 A;  2Y2N A;  2ZQ9 A;  4S2P A;  4Y0U A;  5EEC A;  3HLW A;  3HLF A;  1TDL A;  2EX9 A;  3NI9 A;  4LCM A;  5DTT A;  1FR6 A;  4LV0 A;  5FI2 A;  2HP6 A;  3UY6 A;  4JLF A;  4GDB A;  4MBK A;  1W7F A;  2EFX A;  5CGX A;  3Q07 A;  4EQI A;  4P6B A;  5HAQ A;  1YQS A;  4LV3 A;  3VP4 A;  1MWR A;  4QD4 A;  4ZJ2 A;  4JF6 A;  3IXD A;  3IXG A;  1L0F A;  3NDE A;  2Y2K A;  4K91 A;  1MWT A;  5AQA A;  2BLS A;  2EFU A;  4A5R A;  4BJP A;  5FQQ A;  1MPL A;  3QHY A;  3OZH A;  2Y2I A;  4HEF A;  3FKW A;  4MNR A;  4BD0 A;  3CMZ A;  4X69 A;  3LO7 A;  5CXW A;  3A3J A;  1K57 A;  3FZC A;  5EVI B;  5FQ9 A;  5I94 A;  4OPZ A;  3BM6 A;  2P74 A;  4UA7 A;  1CI9 A;  1KGE A;  3O87 A;  5GHY A;  3OPP A;  4IED A;  2X71 A;  4ZJ3 A;  1K6S A;  3ZNY A;  4GDN A;  1KE4 A;  4S2K A;  2Y2O A;  3Q1F A;  4EWF A;  4O7D A;  2X02 A;  4BL3 A;  2OLU A;  5U47 A;  2ZJ9 A;  5CGS A;  4EBP A;  3TG9 A;  2P9V B;  2R9W A;  3IXB A;  4KQO A;  5A90 A;  1ES3 A;  4QY6 A;  2Z2L B;  1IYP A;  1DJC A;  1ZC2 A;  1XGI A;  4WBG A;  3S4X A;  4MEZ A;  4YFM A;  5FA7 A;  5CHM A;  1JTG A;  1E3U D;  3N6I A;  1KGF A;  4WMC A;  3Q7V B;  2WAE A;  5FAP A;  5EVI A;  4R4R A;  4EV4 A;  3RJU A;  1DY6 A;  4R3B A;  3C5A A;  2HP9 A;  3S1Y A;  3ZGA B;  1QME A;  4JKT A;  4WZ5 A;  2XDM A;  2WGV A;  1S6R A;  1L0D A;  1ES4 A;  4OQI A;  1BZA A;  3HUM A;  4OOY A;  4DRT A;  4ZTK A;  5HL1 A;  2IWB A;  1ES5 A;  1NY0 A;  3ZNT A;  2ZC3 B;  2Y55 A;  1WE4 A;  4KG2 A;  2EX2 A;  1JTD A;  2V2F F;  4E3L A;  5FAS A;  4PPR A;  2Y2Q A;  1TDG A;  4LEN A;  2P9V A;  4HBU A;  1YLP A;  4ID4 A;  4ZAM A;  5JYP A;  5KSC A;  1PWC A;  3ZCZ A;  1XPB A;  1J9M A;  2Z2L A;  2JC7 A;  2ZQ7 A;  1PI5 A;  4GN2 A;  3UE0 A;  2XK1 A;  1FCM A;  3MZE A;  3Q7V A;  5DF9 A;  1CI8 A;  5FI6 A;  5A92 A;  5HW3 A;  2J9P A;  1E25 A;  4S2L A;  2Y2J A;  2BG1 A;  3N7W A;  3G2Y A;  4WEL A;  4C3Q A;  1CEG A;  3MXR A;  5E2F A;  3O86 A;  1K56 D;  1KGG A;  3DW0 A;  1W8Q A;  3UO9 A;  3O3V A;  4EUZ A;  2J8Y A;  1SHV A;  4OPR A;  4OOM A;  1GHM A;  2Y2G A;  1K38 A;  2A3U A;  3ZG9 B;  2ZC3 A;  1ERM A;  1KDS A;  3AGE A;  1I2W A;  3PBO A;  5EPH A;  4X6T A;  1PW1 A;  4KZ6 A;  1WYC A;  4N1H A;  1PIO A;  1LL9 A;  4PM9 A;  3PBS A;  3G2Z A;  3WS0 A;  1NRF A;  2HDR A;  4KZ7 A;  3HUN A;  1FR1 A;  2XD1 A;  2WUQ A;  3VFH A;  5JYO A;  2OSU A;  5CTM A;  2XR0 A;  3VOZ A;  5TGF A;  5DF7 A;  3RXW A;  5E43 A;  1O07 A;  1CEF A;  5GHZ A;  2GDN A;  4UA6 A;  3BLM A;  4KZ4 A;  4S2J A;  4XXR A;  4KG6 A;  2H5S A;  1E4D A;  2Z2M B;  4OP8 A;  2G2U A;  4MLL A;  4K0W A;  3GTC A;  3WS4 A;  4KQQ A;  3N8L A;  4GB7 A;  3SS4 A;  5J8X A;  1KE3 A;  4RX3 A;  1FQG A;  3G30 A;  4R0Q A;  4QHC A;  4E3K A;  5KSH A;  4GOG A;  1K55 C;  4KZA A;  4N92 A;  2X01 A;  2ZC4 B;  5HAP A;  1PW8 A;  3BFG A;  5CER A;  5FAQ A;  3SH9 A;  3JYI A;  5F1F A;  5CGW A;  3GQZ A;  5FDH A;  3M6H A;  4XUX A;  3CG5 A;  4JXG A;  4WYY A;  5EOE A;  1G6A A;  5F1G A;  4BLM A;  2ZC6 B;  1SCW A;  5CRF A;  1MWU A;  1IEL A;  3IF6 B;  3MFD A;  4OKP A;  2VGJ A;  4M3K A;  3BFD A;  3NCK A;  2PU4 A;  2UWX A;  4ZJ1 A;  1L2S A;  5HX9 A;  3GR2 A;  3MKE A;  1NXY A;  3HVF A;  4GKU A;  1BUE A;  1SKF A;  2WYX A;  3OPH A;  5E2G A;  3BFC A;  1LHY A;  2WGI A;  3HL9 A;  4F94 A;  4Y0T A;  1XA7 A;  4HES A;  3G4P A;  2HDS A;  2QMI A;  1YMS A;  2IWC A;  1XP4 A;  4P0M A;  2V1Z A;  1OME A;  2ZC4 A;  4Y0O A;  5A93 A;  1MXO A;  4MBF A;  4ZBE A;  5CEB A;  4E3I A;  4X55 A;  4DXB A;  4DE2 A;  4S2N C;  1TEM A;  1H8Z A;  4P87 A;  4OQH A;  1YLZ A;  5M1A A;  5CEC A;  3Q82 A;  3HUO A;  4FD8 A;  3IT9 A;  3DTM A;  4WZ4 A;  4IBR A;  3IF6 A;  1PZO A;  4Y7P A;  2A49 A;  1SDN A;  1Z6F A;  3DWZ A;  3UPN A;  1CK3 A;  1ALQ A;  1NJ4 A;  1FSW A;  3C4P A;  1VQQ A;  4OH0 A;  1BLS A;  1YLW A;  1ESI A;  3AGF A;  2Q9M A;  2H10 A;  4KEN B;  3VFF A;  1DJB A;  1JVJ A;  2ZC5 B;  1MY8 A;  3HLD A;  4JPM A;  4KZ9 A;  2XGN A;  3E2L A;  2EX8 A;  1XA1 A;  4R23 A;  5AQB A;  3UDI A;  2R9X A;  3V5M A;  4CJN A;  1ZKJ A;  2EX6 A;  3G34 A;  1N4O A;  4R4S A;  3Q7Z A;  2WZZ A;  4OLG A;  4FH2 A;  4OPQ A;  2HP5 A;  2IWD A;  3NIA A;  4LV2 A; 
#chains in the Genus database with same CATH topology
 3G32 A;  4JF5 A;  2INW A;  1L0G A;  4CPK A;  4K0X A;  4OON A;  1JWP A;  1ZHH B;  3MQQ A;  4GZB A;  3VP1 A;  2ZM8 A;  1ERO A;  4RX2 A;  1K55 A;  2Y2H A;  1X0O A;  4UHU A;  5FQM A;  1M6K A;  1KVM A;  1IKI A;  3PAG A;  4EUV A;  3T1S A;  1AXB A;  1XX2 A;  5GHX A;  4WEJ A;  3SOI A;  3C38 A;  5FSR A;  1IEM A;  3E98 A;  1HZO A;  1Y28 A;  2FFY A;  1PZP A;  4HNB A;  3Q81 A;  3FV7 A;  4DE1 A;  2FFF B;  3KX0 X;  1GA0 A;  4G3V A;  4I39 A;  1XGJ A;  3BFE A;  4S2O A;  3ZVT A;  4DJ2 A;  1PRQ A;  5GLB A;  5L8M A;  1BYW A;  3IF5 A;  4EEP A;  3E2K A;  4OLD A;  5DVA A;  2HPB A;  2WGW B;  1E3U A;  3L9K A;  2J7V A;  2Y4A A;  4JGO A;  2XFS A;  5HSQ A;  1G5U A;  2ZQ8 A;  2OWJ A;  1ZG6 A;  2XFT A;  2JE5 A;  2ZQC A;  4B4Z A;  3UPP A;  2WKR A;  3D9Y A;  3MZD A;  2Z2M A;  5G18 A;  1KE0 A;  4C6Y A;  2WKE A;  1FIK A;  2JKR I;  3IX4 A;  4MCW A;  2M7U A;  2Z6C A;  2WKP A;  4DDS A;  4U3T A;  3ISG A;  4JXV A;  2QPN A;  3JPU A;  5MC7 A;  2O99 A;  3VSK A;  5A8B A;  2C6W B;  2EA9 A;  5FAT A;  5AQ9 A;  4UQI S;  1HTZ A;  3ZYT A;  2Y91 A;  1RGZ A;  2WZX A;  4ZDX A;  1TS7 A;  2R78 A;  3A0R A;  4UQI M;  3LIF A;  2JN7 A;  3A3E A;  1Y54 A;  3GMW A;  1ES2 A;  4OOL A;  5EVE A;  3ITB A;  1WYB A;  3F1P A;  2QKP A;  4NET A;  3PBN A;  1EWZ A;  5AQ7 A;  3O5Y A;  3V67 A;  4KZ3 A;  3QNC A;  1NWZ A;  3ITA A;  1MKI A;  1C3B A;  1W5D A;  4WN5 A;  3ZG0 A;  2W3D A;  3UMD A;  5HWT A;  4E3J A;  3HRE A;  1NLY A;  2Y2M A;  3FYZ A;  1S1Z A;  3IHA A;  4KUK A;  4PKY A;  3PXP A;  4LFU A;  5L09 A;  3ZG7 B;  2PD8 A;  4N9K A;  5HD5 A;  1DRM A;  3BFF A;  2VJW A;  3LCE A;  5HPI A;  5HFO A;  4C75 A;  2Q9N A;  4EU0 A;  3IXH A;  2OAQ 1;  4OQ0 A;  1LLB A;  3KO6 A;  3O88 A;  2WKQ A;  3T4L A;  5BOH A;  3K3D A;  2GX5 A;  4Y2F A;  3VSL A;  4YIN A;  4HJ3 A;  4E3O A;  3CHW P;  1D06 A;  1H8Y A;  3N4I A;  3N8R A;  3BQA A;  1L3L A;  2J9O A;  2OV5 A;  3UPO A;  4WMC D;  1I5Q A;  4E6X A;  1NYM A;  4H6J A;  4HQA A;  3T4S A;  3BRM A;  4RYE A;  1ZTU A;  1M40 A;  1PI4 A;  4L0L A;  2PYR A;  1XFN A;  2O9B A;  5KIZ A;  5KMW A;  1YLT A;  5DJT A;  3UB7 A;  5AVE A;  2ZM2 A;  2YKF A;  3HLB A;  4S2M A;  1W63 M;  2Y2N A;  4S2P A;  4LCM A;  3JVV A;  3UY6 A;  1W7F A;  3Q07 A;  4EQI A;  2ZMV A;  1YAX A;  3FG8 A;  5FEF A;  1MWR A;  3IXD A;  3NDE A;  5G4Z A;  1MPL A;  4NXB A;  1MC0 A;  4MNR A;  4BD0 A;  3KSI A;  1K57 A;  2P04 A;  3O87 A;  2H28 A;  5GHY A;  2JKT I;  4HY8 A;  3RTY A;  4LRY C;  4GDN A;  1KE4 A;  3T4J A;  2X02 A;  5FDS A;  4EBP A;  4FTX A;  3NJA A;  4LPZ A;  4KQO A;  5A90 A;  2Z2L B;  1PNE A;  4WMC A;  1KOU A;  5IT5 A;  1T18 A;  4EV4 A;  2BAS A;  1VB6 A;  2VKS A;  1DY6 A;  3C5A A;  2HP9 A;  3S1Y A;  3CUE A;  2XA7 S;  2WGV A;  1GSX A;  1JNU A;  4LLO B;  4GW9 A;  2ZC3 B;  4KG2 A;  1WE4 A;  2XA7 M;  2V0W A;  3A0V A;  4X1M A;  1TDG A;  2MJ6 A;  3SW1 A;  4NXF A;  1G28 A;  4ZAM A;  1PI5 A;  4GN2 A;  3Q7V A;  4F3L A;  2VK3 A;  5A92 A;  5HW3 A;  1OJG A;  1VEU B;  3N7W A;  4CLC A;  4C3Q A;  1CEG A;  1KGG A;  1W8Q A;  2W27 A;  1K38 A;  5J7E A;  1ERM A;  3BW6 A;  1P9R A;  4KZ6 A;  3G2Z A;  2W3H A;  3HUN A;  2XD1 A;  3DBA A;  4Y3I A;  5JYO A;  5E43 A;  1O07 A;  2GDN A;  4I5S A;  4KZ4 A;  4S2J A;  4XXR A;  3NEC A;  2PD7 A;  1LL8 A;  2KX6 A;  4IUK A;  4K0W A;  3GTC A;  3QP6 A;  1KE3 A;  1UGU A;  4R0Q A;  4QHC A;  4N92 A;  2X01 A;  5FAQ A;  2VGL S;  5CGW A;  3LIE A;  4JGP A;  2B95 A;  5L07 A;  1G6A A;  5F1G A;  1SCW A;  2VGL M;  1MWU A;  1V9Y A;  1IEL A;  4M3K A;  3BFD A;  3NCK A;  4ZJ1 A;  3KSG A;  5HX9 A;  4GKU A;  5HWW A;  1BUE A;  2WYX A;  3OPH A;  3BY9 A;  3QP1 A;  4GHI A;  3BFC A;  4ETZ A;  3T1R A;  3BQ8 A;  5A93 A;  3VOL A;  1MXO A;  5DFX A;  4E3I A;  4DE2 A;  1H8Z A;  4P87 A;  5M1A A;  4WZ4 A;  4IBR A;  1K0K A;  2A49 A;  1TD5 A;  1BLS A;  1YLW A;  1ESI A;  2H10 A;  1XJ4 A;  2Z6D A;  3VFF A;  1DJB A;  2ZC5 B;  1MY8 A;  3PHY A;  3V5M A;  5F5Y A;  4I3J A;  1N4O A;  3NIA A;  1Z09 A;  1K54 A;  1H8M A;  3LUQ A;  2PAV P;  1OTD A;  2H0Y A;  2PT7 A;  3S7Q A;  1LI0 A;  1SDE A;  1XJ3 A;  2VX8 A;  5E2E A;  3ZDJ A;  4E6W A;  3P09 A;  4L9G A;  5F83 A;  4NXG A;  2WK0 A;  3OCN A;  4HHD A;  4B4X A;  5CED A;  4PM5 A;  1H5X A;  2E8J A;  3DAV A;  5EUA A;  3K2N A;  4X53 A;  4RA7 A;  2W0N A;  1IYQ A;  4HBT A;  2RL3 A;  3M6B A;  4XUZ A;  1EI5 A;  1HD8 A;  4HOI A;  4YOF A;  2ZC7 A;  3MJQ A;  3MXS A;  4NEE D;  1CF0 A;  4Q0J A;  4PM8 A;  3S7N A;  3F1N B;  2DCF A;  3H7W B;  5D3O A;  2HJ9 C;  4R1G A;  3V50 A;  1F9I A;  3W4O A;  4ETX A;  3BWL A;  1N9L A;  2WKI A;  1MWS A;  3NHQ A;  5EV0 A;  3G35 A;  2JCH A;  3E4Q A;  4WZ5 C;  3SS5 A;  3UME A;  5TFQ A;  2J3T C;  2J3T D;  3MS6 A;  2WGW A;  4B93 A;  3ZHH A;  5FQI A;  3UB5 P;  4Y17 A;  4JF4 A;  5CHJ A;  3C7U A;  2XH9 A;  3S7P A;  1VET B;  4GD8 A;  2BTF P;  2YKH A;  3KYE A;  1NZU A;  3GEC A;  3QP4 A;  1N9B A;  4I38 A;  1EW0 A;  5EVL A;  5HDS A;  1L0E A;  1P0Z A;  1PFL A;  4R6L A;  5LBR A;  1H0M A;  4OVD A;  1NYY A;  3HLC A;  3UE1 A;  1GSW A;  2C5W B;  2Y2L A;  3KYQ A;  1LSX A;  3PYP A;  2ACG A;  1T19 A;  5FAO A;  4Z9Q A;  4EBL A;  4DN0 A;  4NXE A;  2B5R A;  3DTI A;  5HAR A;  4Y5F A;  3UB8 A;  1W8Y A;  2K2N A;  2PR6 A;  3N8S A;  4Q0H A;  3SZT A;  2V0U A;  1F5M A;  3LR3 A;  4UAA A;  3ZG8 B;  3HBR A;  4OQG A;  3BYD A;  2QWS A;  5FI7 A;  3IH9 A;  2J80 A;  1UWP X;  2CMN A;  1U60 A;  3IWO A;  1IFQ A;  5DTK A;  4S2N A;  2ZD8 A;  1XXM A;  4FUW A;  4YNR A;  3LID A;  4QB8 A;  2WAF A;  1S4S A;  3BEC A;  3UB9 A;  1QMF A;  1NLZ A;  3IF6 C;  4DXC A;  4QWO A;  4IBX A;  2A24 A;  2ZMA A;  3D4F A;  1FCO A;  2XF3 A;  3AGD A;  3LR0 A;  3KYZ A;  3UDX A;  2Y8H A;  2OLV A;  4EXO A;  2M1C A;  1GHI A;  2EWV A;  1CJF A;  1YSP A;  3PBT A;  1KVL A;  3NDG A;  2K31 A;  2XEP A;  4H8R A;  2WAD A;  3CI6 A;  1XFQ A;  3NBL A;  2IA2 A;  3VOY A;  3LY3 A;  3IH8 A;  5EEC A;  2ZQ9 A;  3HLF A;  3NI9 A;  1FR6 A;  5FI2 A;  3IX8 A;  2GJ3 A;  4Z1W A;  1P9W A;  2EFX A;  1UWN X;  4GJ4 A;  4BBV A;  4K91 A;  2V8F A;  4BJP A;  4YWZ A;  4A5R A;  5HDC A;  2EFU A;  5FQQ A;  3QHY A;  4X69 A;  1D1J A;  4Y15 A;  2UV0 E;  1D7E A;  2P74 A;  4QPR A;  2X71 A;  4IJG A;  1OJ5 A;  4ARZ B;  2Y2O A;  4O7D A;  4EW7 A;  3EGX C;  1S4R A;  3RFB A;  5CGS A;  2P9V B;  2JHE A;  2PYP A;  4NG2 A;  3DTE A;  1S67 L;  1DJC A;  3OLO A;  4MEZ A;  4YFM A;  5FA7 A;  5CHM A;  1KGF A;  2WAE A;  5FAP A;  3IS2 B;  2Y79 A;  4R3B A;  1QME A;  3P01 A;  4DMZ A;  4DRT A;  1BZA A;  1GSV A;  2P7J A;  5HL1 A;  3EGD C;  3ZNT A;  4E3L A;  4LEN A;  2ZL1 B;  5HPF A;  4HBU A;  5JYP A;  3HCY A;  3ZCZ A;  5J4E A;  1J9M A;  4KQD A;  2Z2L A;  3CWF A;  3UE0 A;  1N9O A;  1OTA A;  4RQ9 A;  5DF9 A;  1CI8 A;  2J9P A;  4BBT A;  2Y2J A;  3EEH A;  3TE8 A;  2LB9 A;  1K56 D;  3DW0 A;  2OOL A;  3UO9 A;  1SHV A;  2Y2G A;  3ZG9 B;  2A3U A;  2ZC3 A;  4PHT A;  3CAX A;  3AGE A;  4X6T A;  3VE3 A;  3MMH A;  1PW1 A;  4UEY A;  1H3Q A;  4PM9 A;  3PBS A;  3WS0 A;  1FR1 A;  4GS9 B;  5CTM A;  1VEU A;  4UA6 A;  2H5S A;  1E4D A;  2Z2M B;  5TJJ A;  5EM1 A;  2G2U A;  4KQQ A;  4HP4 A;  4GB7 A;  5J8X A;  3G30 A;  2VV8 A;  4GOG A;  4KZA A;  3GQZ A;  1MKM A;  5EOE A;  2HZ5 A;  3JVU A;  3IF6 B;  1OTB A;  3VE4 A;  3TW8 A;  3F1O B;  2PU4 A;  2UWX A;  3GR2 A;  1NXY A;  3IBJ A;  2WGI A;  2V9A A;  1XA7 A;  4HES A;  2HDS A;  5F68 A;  2IWC A;  1XP4 A;  2W3G A;  3LGO A;  4MBF A;  4X55 A;  1AWI A;  1YLZ A;  4R3A A;  1LSW A;  3HUO A;  4NKP A;  1CK3 A;  1NJ4 A;  1FSW A;  1VQQ A;  4OH0 A;  3AGF A;  1JVJ A;  4JPM A;  3HLD A;  4R23 A;  1XA1 A;  1ZKJ A;  4OPQ A;  2AVX A;  1DP6 A;  2O0Y A;  2FZ0 A;  3M2K A;  1I2S A;  3G31 A;  3B3X A;  3PBQ A;  3LEZ A;  2PDR A;  3VP3 A;  5DTS A;  4DKI A;  2VGK A;  4PAU A;  1YLJ A;  1XKZ A;  3V3R A;  3S7O A;  3UB6 A;  3ZFZ A;  2XQZ A;  4L9F A;  4XT2 B;  4LV1 A;  1W79 A;  5M19 A;  3C7V A;  1G68 A;  3PTE A;  1PYY A;  2W1T B;  2G7U A;  1J3W A;  3UE3 A;  3A0S A;  4HI4 A;  5FQK A;  3WRZ A;  3EQV A;  5M18 A;  4HIA A;  4HH2 A;  4ZRR A;  3B33 A;  3EOI A;  3U4L P;  5AVF A;  2PR5 A;  3MR0 A;  4H6J B;  2DRW A;  1VM1 A;  5CHU A;  2PU2 A;  4BD1 A;  1LSV A;  3W8K A;  1GHP A;  3B47 A;  2QZ6 A;  2WKH A;  4E3M A;  1OTE A;  2KOI A;  5TBM B;  1K4F A;  2VLG A;  4EET B;  4E3N A;  3T1Q B;  1SKO B;  3TOI A;  5EVI C;  5EVI D;  2EXB A;  1S0W A;  1XJ6 A;  3OPL A;  3ICY A;  3F1N A;  4PM7 A;  1RGY A;  3LR4 A;  2QHK A;  3H7W A;  2B18 A;  2XLN A;  4HJ4 A;  3UN7 A;  3IWQ A;  4QY5 A;  3TRC A;  5A91 A;  4KZ5 A;  4WM9 A;  1YMX A;  3OCL A;  2QYB A;  1TS8 A;  1TS0 A;  4PMA A;  1CQA A;  2G2W A;  1G6O A;  4NK3 A;  3T50 A;  3V39 A;  5KZH A;  3SH7 A;  1VET A;  4PM6 A;  4X25 A;  2OAP 1;  2PHY A;  1K6R A;  1TS6 A;  3BEB A;  2ZQA A;  4QJG A;  4Q8I A;  2V20 A;  4BQM A;  3UNW A;  4O01 A;  4DF6 A;  1ODV A;  3I7J A;  4IHQ A;  3GV9 A;  5HZH A;  3E0Y A;  3P98 A;  2W3F A;  3PBR A;  2ZOH A;  2L1M A;  2ZLY A;  3VV4 A;  4WEK A;  2JKG A;  1IOU A;  4UA9 A;  3OC2 A;  5HAI A;  4OP5 A;  4IVK A;  1OPX A;  1Q2Q A;  4P6Z S;  3NC8 A;  3MBZ A;  5FQJ A;  3W4P A;  2B02 A;  1YT4 A;  1LL5 A;  3EWK A;  3H82 B;  1IYO A;  2Q0O A;  4GD6 A;  1K25 A;  3CJM A;  4IVI A;  3WWX A;  4S2I A;  3ZVW A;  1BLH A;  2HF6 A;  4HP9 A;  3R4K A;  3FKV A;  5GLA A;  1V9Z A;  2OWH A;  3W4Q A;  3WS5 A;  4IUH A;  3W2Z A;  3CZD A;  1F2K A;  3CLO A;  1TVF A;  3LI9 A;  3V3S A;  4BL2 A;  2JKF A;  1FCN A;  2XD5 A;  3WS2 A;  4QU3 A;  1OT9 A;  4DJ3 A;  4D60 A;  4Y0U A;  4Y13 A;  3HLW A;  2EX9 A;  4LV0 A;  2HP6 A;  3L7H A;  4JLF A;  4GDB A;  4PKY G;  5CGX A;  3CPT B;  3H9W A;  4P6B A;  4LRZ E;  4KUO A;  4QD4 A;  1N9N A;  1P97 A;  4JF6 A;  3IXG A;  3G6O A;  2BLS A;  3OZH A;  2Y2I A;  4HEF A;  4CLC E;  3CMZ A;  3LO7 A;  4ESP A;  3A3J A;  3FZC A;  5EVI B;  5I94 A;  4OPZ A;  1MZU A;  3MQO A;  2VA0 A;  4EES A;  2O9A A;  1CI9 A;  2ZBB A;  4EER A;  3OPP A;  1K6S A;  3ZNY A;  1ACF A;  4S2K A;  4B9O A;  2XRO A;  3IXB A;  2LB5 A;  3S4X A;  1IYP A;  4HJ6 A;  1XGI A;  2VV7 A;  1JTG A;  1E3U D;  3T4Q A;  2KDK A;  4GLQ A;  2PRF A;  1A0K A;  4FOF A;  2PBD P;  3LFV A;  4JKT A;  4WZ5 A;  2XDM A;  1L0D A;  1ES4 A;  4OQI A;  3T12 B;  4ARZ A;  4ZTK A;  1ES5 A;  3QP2 A;  3E4O A;  5FAS A;  1JTD A;  2V1A A;  1VHM A;  4PPR A;  2Y2Q A;  2P9V A;  1YLP A;  4ID4 A;  5KSC A;  1XPB A;  2JC7 A;  2ZQ7 A;  1T1B A;  4I3A A;  5HL6 A;  3KSF A;  3MZE A;  1FIL A;  2KLI A;  2L4R A;  3R7W B;  3IS2 A;  3EEA A;  3G2Y A;  5IU1 A;  3MXR A;  5E2F A;  3O86 A;  2QJ5 A;  4EUZ A;  3O3V A;  4OOM A;  3PBO A;  5EPH A;  2ZL1 A;  4N1H A;  1PIO A;  1LL9 A;  5DFY A;  1NRF A;  2HDR A;  2XR0 A;  5DF7 A;  2NUT C;  2ZMF A;  3BLM A;  4OP8 A;  4MLL A;  3N8L A;  3SS4 A;  4RX3 A;  1FQG A;  3UE6 A;  5KSH A;  2ZC4 B;  5HAP A;  1PW8 A;  3BFG A;  3SH9 A;  3JYI A;  5FDH A;  4JXG A;  4GS9 A;  4BLM A;  2ZC6 B;  5CRF A;  3T4O A;  3MFD A;  4OKP A;  3T4K A;  4E04 A;  1L2S A;  3HVF A;  1T1A A;  1LHY A;  3HL9 A;  1NRJ A;  3G4P A;  3T4T A;  3GDI A;  4P0M A;  5L10 A;  1OME A;  4MMN A;  4ZBE A;  2XSS A;  4DXB A;  2P08 A;  5CEC A;  3DTM A;  3IF6 A;  1PZO A;  3TJZ C;  4Y7P A;  3MSH A;  5IS1 A;  1SDN A;  3DWZ A;  3F1O A;  2Q9M A;  5CX7 A;  4KEN B;  3BY8 A;  2XGN A;  3E2L A;  2EX8 A;  4CJN A;  3UDI A;  2R9X A;  2EX6 A;  5G4Y A;  4R4S A;  3Q7Z A;  2EWW A;  4OLG A;  2HP5 A;  3VMA A;  4BEN A;  4LV2 A;  3NY4 A;  5CTN A;  2HGV A;  1RCJ A;  4B88 A;  5F82 A;  3GRJ A;  3FPW A;  1BLC A;  1O7E A;  1MBL A;  4JBF A;  3NUL A;  3HLE A;  4LCL A;  4O0P A;  5FL3 A;  4WL9 A;  2J3W A;  1ONG A;  3QNB A;  1XJ2 A;  4BWI A;  4GNU A;  1DJA A;  4D2O A;  3A3D A;  2FH5 A;  5E2H A;  2D02 A;  3LR5 A;  3IHB A;  4JGR A;  3UDF A;  2A24 B;  3GVB A;  1S1Y A;  1S66 L;  3EQU A;  4EBN A;  2VV6 A;  3SH8 A;  4BMW A;  4N1X A;  2A2L A;  1FSY A;  5GL9 A;  1DP9 A;  1ONH A;  4MN5 A;  1YSQ A;  4MN7 A;  1K57 C;  3SS3 A;  2H0T A;  2GZA A;  1KDW A;  2DNS A;  4XT2 A;  4JGQ A;  3B42 A;  3OPR A;  2ZQD A;  3FWL A;  1WA9 A;  2PBY A;  3FPV A;  2W1T A;  4U0T A;  3K3C A;  4FCF A;  3C4O A;  3LIB A;  1GCE A;  3OOV A;  3NOU C;  1BT5 A;  3M2J A;  4DDY A;  4HH3 A;  4OPY A;  5IHV A;  1K4E A;  2D01 A;  5EFW A;  2HDU A;  3VP2 A;  1ESU A;  3MKF A;  3HLG A;  4L9E A;  5EE8 A;  3CUE C;  2I72 A;  3D3O A;  4U0X A;  3TSG A;  3BLS A;  3RXX A;  1BLP A;  5L2F A;  2HV1 A;  1ERQ A;  1BTL A;  3IQA A;  3IWI A;  4RVA A;  5EOO A;  1DP8 A;  2E8I A;  1PWG A;  4P85 A;  3WS1 A;  2JKR M;  3LIC A;  5TBM A;  1YLY A;  1SKO A;  4FSF A;  3PR6 A;  4MN6 A;  3QP5 A;  1K56 A;  3MQ0 A;  1HVB A;  4CLC C;  1YM1 A;  4CLC D;  3F1P B;  4AFI A;  3A3I A;  5F69 A;  1IYS A;  3MZF A;  3BJN A;  3LY4 A;  4BBU A;  1JWZ A;  5DKK A;  4Q0I A;  2CC1 A;  4X68 A;  4FH4 A;  3IX3 A;  3NOT C;  3P7N A;  4X56 A;  2Y2P A;  5DF8 A;  4WUJ A;  3C2W A;  4N9L A;  4LRX C;  4DE3 A;  2ZOI A;  3DWK A;  5GLC A;  2QJ7 A;  2O9C A;  1BSG A;  3ZG5 A;  1JWV A;  4EQ1 A;  4K08 A;  4KZ8 A;  4JXW A;  5FEG A;  5DKL A;  2L0W A;  5HWV A;  1ZG4 A;  2V1B A;  4G3K A;  3E4P A;  3CIT A;  2V8C A;  1GA9 A;  1Y4O A;  1YPR A;  2DMW A;  1PWD A;  1W63 Q;  1TF1 A;  1Q2P A;  2NUP C;  5F6A A;  2Y59 A;  4KQR A;  5HD3 A;  5AJG A;  4KZB A;  1LI9 A;  4KG5 A;  5HDD A;  4MBH A;  3RH8 B;  2ZM0 A;  3ZQ5 A;  4JXS A;  4II7 A;  2JBF A;  1T1C A;  5TR7 A;  3GSG A;  4R3J A;  5K5B A;  3LEQ A;  3VP0 A;  2W1R A;  3H82 A;  1K54 C;  3A3F A;  1RP5 A;  2VEA A;  3S22 A;  1IKG A;  2RCX A;  2HDQ A;  1NZO A;  3WRT A;  2EXA A;  3PAE A;  2M7V A;  4DE0 A;  5GLD A;  3ULF A;  1BUL A;  1FOF A;  5DTT A;  1TDL A;  1OT6 A;  4MBK A;  5HAQ A;  1YQS A;  4LV3 A;  2XRN A;  3VP4 A;  3NOP C;  4ZJ2 A;  3D72 A;  5AQA A;  1L0F A;  2Y2K A;  4GCZ A;  1MWT A;  3OBF A;  5J3W A;  3FKW A;  5CXW A;  5FQ9 A;  3BM6 A;  4UA7 A;  1KGE A;  2JKT M;  4IED A;  4ZJ3 A;  3U2A A;  3KSH A;  1OTI A;  4EEU A;  3Q1F A;  4EWF A;  3CPT A;  4BL3 A;  2OLU A;  5U47 A;  2ZJ9 A;  2GNX A;  3MF0 A;  2R9W A;  3DTK A;  1HLU P;  4QY6 A;  1ES3 A;  4WBG A;  1ZC2 A;  2K7S A;  4I3I A;  3N6I A;  3Q7V B;  4F3L B;  3LYX A;  4O8G A;  4WF0 A;  1SZV A;  5EVI A;  2VZW A;  3MXQ A;  4R4R A;  3RJU A;  4CLC B;  3ZGA B;  1S6R A;  4OOY A;  3HUM A;  2IWB A;  1NY0 A;  2Y55 A;  2EX2 A;  2V2F F;  1PWC A;  2XK1 A;  4P6Z M;  1FCM A;  3MFX A;  1YKD A;  2HJE A;  2I9V A;  5FI6 A;  1E25 A;  4S2L A;  2BG1 A;  4WEL A;  5DJU A;  4WLA A;  2J8Y A;  4M4X A;  4OPR A;  1GHM A;  1KDS A;  1I2W A;  1WYC A;  3T1X A;  3C30 A;  4KZ7 A;  3R7W A;  2WUQ A;  3VFH A;  2OSU A;  3VOZ A;  5TGF A;  3RXW A;  3HJI A;  1CEF A;  5GHZ A;  4KG6 A;  4R38 A;  4R70 A;  4GHI B;  3WS4 A;  4CQH A;  3LIA A;  4E3K A;  1K55 C;  5CER A;  5F1F A;  3M6H A;  4X1L A;  3CG5 A;  4WYY A;  4XUX A;  2VGJ A;  4G3W A;  3MKE A;  1SKF A;  4MDZ A;  5E2G A;  3FC7 A;  4Y0T A;  4F94 A;  1F98 A;  2QMI A;  1YMS A;  3IBR A;  3C8C A;  2V1Z A;  4ME4 A;  2ZC4 A;  4Y0O A;  5CEB A;  3QP8 A;  4S2N C;  1TEM A;  4OQH A;  3Q82 A;  4FD8 A;  3IT9 A;  5I5L A;  5EM0 A;  1Z6F A;  3UPN A;  1ALQ A;  3HJK A;  3C4P A;  5C5K A;  2W3E A;  1STZ A;  4LGW A;  4KZ9 A;  3TG9 A;  5AQB A;  3G34 A;  2WZZ A;  3LI8 A;  1LT0 A;  4FH2 A;  2IWD A; 
#chains in the Genus database with same CATH homology
 3G32 A;  3NY4 A;  4JF5 A;  1K54 A;  5CTN A;  1L0G A;  2H0Y A;  1RCJ A;  4CPK A;  3M2K A;  4B88 A;  4K0X A;  1I2S A;  3G31 A;  4OON A;  3B3X A;  1JWP A;  3PBQ A;  3LEZ A;  5F82 A;  3GRJ A;  1LI0 A;  1BLC A;  1O7E A;  4GZB A;  3VP3 A;  3VP1 A;  2ZM8 A;  1ERO A;  4RX2 A;  1K55 A;  5DTS A;  4DKI A;  2VGK A;  1MBL A;  2Y2H A;  4JBF A;  4LCL A;  3HLE A;  1YLJ A;  4UHU A;  5FQM A;  1XKZ A;  1SDE A;  3V3R A;  1M6K A;  3ZDJ A;  5E2E A;  1KVM A;  1ONG A;  3QNB A;  1IKI A;  4E6W A;  3P09 A;  3PAG A;  4GNU A;  5F83 A;  3ZFZ A;  1AXB A;  1XX2 A;  2XQZ A;  1DJA A;  2WK0 A;  4LV1 A;  5GHX A;  4D2O A;  1W79 A;  3OCN A;  3A3D A;  5M19 A;  4B4X A;  3C7V A;  5E2H A;  1G68 A;  5CED A;  3IHB A;  3PTE A;  4PM5 A;  1H5X A;  4WEJ A;  1PYY A;  3GVB A;  3UDF A;  4BEN A;  3SOI A;  5FSR A;  3EQU A;  5EUA A;  1IEM A;  4EBN A;  1HZO A;  3UE3 A;  4X53 A;  4RA7 A;  3SH8 A;  1IYQ A;  2FFY A;  1PZP A;  4N1X A;  4HBT A;  3Q81 A;  2RL3 A;  3FV7 A;  4DE1 A;  1FSY A;  5FQK A;  5GL9 A;  3WRZ A;  2FFF B;  1ONH A;  1GA0 A;  1XGJ A;  3BFE A;  1K57 C;  3M6B A;  3EQV A;  4S2O A;  4XUZ A;  5M18 A;  1EI5 A;  3ZVT A;  3SS3 A;  1HD8 A;  2H0T A;  5GLB A;  1KDW A;  2ZC7 A;  2DNS A;  3MXS A;  2DRW A;  3OPR A;  2ZQD A;  3FWL A;  1VM1 A;  5CHU A;  4PM8 A;  2PU2 A;  3IF5 A;  4BD1 A;  2DCF A;  2PBY A;  3E2K A;  3W8K A;  1GHP A;  4OLD A;  2QZ6 A;  4U0T A;  5D3O A;  4FCF A;  4R1G A;  2WKH A;  3C4O A;  2HPB A;  2WGW B;  1E3U A;  5DVA A;  3V50 A;  1GCE A;  3W4O A;  4E3M A;  1BT5 A;  3M2J A;  4DDY A;  2J7V A;  4OPY A;  2Y4A A;  5IHV A;  1K4E A;  1K4F A;  2WKI A;  4E3N A;  1MWS A;  3G35 A;  3TOI A;  5EVI C;  2HDU A;  5EVI D;  3VP2 A;  2XFS A;  1ESU A;  3MKF A;  3HLG A;  5EE8 A;  2EXB A;  2JCH A;  2ZQ8 A;  2I72 A;  1ZG6 A;  2XFT A;  1S0W A;  2JE5 A;  2ZQC A;  4U0X A;  4WZ5 C;  4B4Z A;  3SS5 A;  3TSG A;  3UPP A;  3BLS A;  3RXX A;  5TFQ A;  1BLP A;  5L2F A;  3OPL A;  3MZD A;  2Z2M A;  1ERQ A;  1BTL A;  3IQA A;  1RGY A;  3IWI A;  4PM7 A;  4RVA A;  5EOO A;  2E8I A;  5G18 A;  1KE0 A;  4C6Y A;  1PWG A;  2WKE A;  2XLN A;  4P85 A;  3WS1 A;  2WGW A;  3ZHH A;  5FQI A;  4JF4 A;  3UN7 A;  3IWQ A;  5CHJ A;  4QY5 A;  1YLY A;  3C7U A;  5A91 A;  4FSF A;  2XH9 A;  4KZ5 A;  4WM9 A;  4GD8 A;  1YMX A;  4DDS A;  1K56 A;  3OCL A;  4U3T A;  3ISG A;  1HVB A;  1YM1 A;  4JXV A;  2QPN A;  1NZU A;  3VSK A;  3A3I A;  1N9B A;  5EVL A;  2C6W B;  1IYS A;  4PMA A;  1L0E A;  2G2W A;  3MZF A;  5FAT A;  5AQ9 A;  1HTZ A;  2Y91 A;  1RGZ A;  3LY4 A;  4NK3 A;  2WZX A;  4ZDX A;  1JWZ A;  3V39 A;  4X68 A;  2CC1 A;  5KZH A;  3A3E A;  4FH4 A;  1Y54 A;  4OVD A;  1NYY A;  3HLC A;  3UE1 A;  2C5W B;  4X56 A;  3GMW A;  2Y2P A;  2Y2L A;  3SH7 A;  5DF8 A;  4PM6 A;  1ES2 A;  4OOL A;  3ITB A;  1WYB A;  4N9L A;  3VMA A;  4NET A;  1K6R A;  3BEB A;  3PBN A;  1EWZ A;  2ZQA A;  4DE3 A;  4QJG A;  5AQ7 A;  3DWK A;  5GLC A;  4KZ3 A;  4Q8I A;  3QNC A;  5FAO A;  4Z9Q A;  2V20 A;  4EBL A;  1BSG A;  4BQM A;  3UNW A;  3ZG5 A;  4DF6 A;  1JWV A;  3ITA A;  2B5R A;  5HAR A;  3I7J A;  1MKI A;  1W8Y A;  1C3B A;  1W5D A;  4KZ8 A;  3GV9 A;  4JXW A;  3N8S A;  3ZG0 A;  3P98 A;  3PBR A;  4E3J A;  3HRE A;  2ZLY A;  4WEK A;  4UA9 A;  3OC2 A;  2Y2M A;  5HAI A;  4OP5 A;  4IVK A;  1Q2Q A;  3FYZ A;  4UAA A;  3ZG8 B;  3NC8 A;  3HBR A;  1ZG4 A;  3IHA A;  4OQG A;  3BYD A;  3ZG7 B;  4N9K A;  5FI7 A;  3BFF A;  3MBZ A;  3LCE A;  3IH9 A;  5HFO A;  1GA9 A;  5FQJ A;  4C75 A;  3W4P A;  1U60 A;  2Q9N A;  1YT4 A;  3IWO A;  5DTK A;  3IXH A;  4S2N A;  1LL5 A;  2ZD8 A;  1XXM A;  1LLB A;  4OQ0 A;  1IYO A;  1PWD A;  3O88 A;  4QB8 A;  2WAF A;  5BOH A;  4GD6 A;  3BEC A;  1K25 A;  1QMF A;  3CJM A;  1Q2P A;  3IF6 C;  4DXC A;  4IVI A;  3VSL A;  4YIN A;  2Y59 A;  4KQR A;  4IBX A;  3WWX A;  2ZMA A;  4E3O A;  3D4F A;  4KZB A;  1LI9 A;  4KG5 A;  4S2I A;  1BLH A;  1FCO A;  3ZVW A;  1H8Y A;  3N4I A;  3N8R A;  4MBH A;  2XF3 A;  3FKV A;  3AGD A;  2ZM0 A;  5GLA A;  4JXS A;  2J9O A;  2OV5 A;  3UPO A;  2JBF A;  4WMC D;  3UDX A;  2OLV A;  3GSG A;  4R3J A;  5TR7 A;  1I5Q A;  4E6X A;  3VP0 A;  3W4Q A;  3WS5 A;  1K54 C;  1GHI A;  1NYM A;  3A3F A;  3CZD A;  3PBT A;  1KVL A;  3NDG A;  1RP5 A;  3S22 A;  1IKG A;  2RCX A;  3BRM A;  2HDQ A;  4RYE A;  1TVF A;  1M40 A;  2XEP A;  1NZO A;  3WRT A;  4H8R A;  3V3S A;  2EXA A;  1PI4 A;  2WAD A;  3PAE A;  4L0L A;  4BL2 A;  5KMW A;  1FCN A;  2XD5 A;  4DE0 A;  1YLT A;  3NBL A;  3WS2 A;  2ZM2 A;  3VOY A;  4QU3 A;  5GLD A;  3HLB A;  4S2M A;  1BUL A;  3LY3 A;  1FOF A;  3IH8 A;  2Y2N A;  2ZQ9 A;  4S2P A;  4Y0U A;  5EEC A;  3HLW A;  3HLF A;  1TDL A;  2EX9 A;  3NI9 A;  4LCM A;  5DTT A;  1FR6 A;  4LV0 A;  5FI2 A;  2HP6 A;  3UY6 A;  4JLF A;  4GDB A;  4MBK A;  1W7F A;  2EFX A;  5CGX A;  3Q07 A;  4EQI A;  4P6B A;  5HAQ A;  1YQS A;  4LV3 A;  3VP4 A;  1MWR A;  4QD4 A;  4ZJ2 A;  4JF6 A;  3IXD A;  3IXG A;  1L0F A;  3NDE A;  2Y2K A;  4K91 A;  1MWT A;  5AQA A;  2BLS A;  2EFU A;  4A5R A;  4BJP A;  5FQQ A;  1MPL A;  3QHY A;  3OZH A;  2Y2I A;  4HEF A;  3FKW A;  4MNR A;  4BD0 A;  3CMZ A;  4X69 A;  3LO7 A;  5CXW A;  3A3J A;  1K57 A;  3FZC A;  5EVI B;  5FQ9 A;  5I94 A;  4OPZ A;  3BM6 A;  2P74 A;  4UA7 A;  1CI9 A;  1KGE A;  3O87 A;  5GHY A;  3OPP A;  4IED A;  2X71 A;  4ZJ3 A;  1K6S A;  3ZNY A;  4GDN A;  1KE4 A;  4S2K A;  2Y2O A;  3Q1F A;  4EWF A;  4O7D A;  2X02 A;  4BL3 A;  2OLU A;  5U47 A;  2ZJ9 A;  5CGS A;  4EBP A;  3TG9 A;  2P9V B;  2R9W A;  3IXB A;  4KQO A;  5A90 A;  1ES3 A;  4QY6 A;  2Z2L B;  1IYP A;  1DJC A;  1ZC2 A;  1XGI A;  4WBG A;  3S4X A;  4MEZ A;  4YFM A;  5FA7 A;  5CHM A;  1JTG A;  1E3U D;  3N6I A;  1KGF A;  4WMC A;  3Q7V B;  2WAE A;  5FAP A;  5EVI A;  4R4R A;  4EV4 A;  3RJU A;  1DY6 A;  4R3B A;  3C5A A;  2HP9 A;  3S1Y A;  3ZGA B;  1QME A;  4JKT A;  4WZ5 A;  2XDM A;  2WGV A;  1S6R A;  1L0D A;  1ES4 A;  4OQI A;  1BZA A;  3HUM A;  4OOY A;  4DRT A;  4ZTK A;  5HL1 A;  2IWB A;  1ES5 A;  1NY0 A;  3ZNT A;  2ZC3 B;  2Y55 A;  1WE4 A;  4KG2 A;  2EX2 A;  1JTD A;  2V2F F;  4E3L A;  5FAS A;  4PPR A;  2Y2Q A;  1TDG A;  4LEN A;  2P9V A;  4HBU A;  1YLP A;  4ID4 A;  4ZAM A;  5JYP A;  5KSC A;  1PWC A;  3ZCZ A;  1XPB A;  1J9M A;  2Z2L A;  2JC7 A;  2ZQ7 A;  1PI5 A;  4GN2 A;  3UE0 A;  2XK1 A;  1FCM A;  3MZE A;  3Q7V A;  5DF9 A;  1CI8 A;  5FI6 A;  5A92 A;  5HW3 A;  2J9P A;  1E25 A;  4S2L A;  2Y2J A;  2BG1 A;  3N7W A;  3G2Y A;  4WEL A;  4C3Q A;  1CEG A;  3MXR A;  5E2F A;  3O86 A;  1K56 D;  1KGG A;  3DW0 A;  1W8Q A;  3UO9 A;  3O3V A;  4EUZ A;  2J8Y A;  1SHV A;  4OPR A;  4OOM A;  1GHM A;  2Y2G A;  1K38 A;  2A3U A;  3ZG9 B;  2ZC3 A;  1ERM A;  1KDS A;  3AGE A;  1I2W A;  3PBO A;  5EPH A;  4X6T A;  1PW1 A;  4KZ6 A;  1WYC A;  4N1H A;  1PIO A;  1LL9 A;  4PM9 A;  3PBS A;  3G2Z A;  3WS0 A;  1NRF A;  2HDR A;  4KZ7 A;  3HUN A;  1FR1 A;  2XD1 A;  2WUQ A;  3VFH A;  5JYO A;  2OSU A;  5CTM A;  2XR0 A;  3VOZ A;  5TGF A;  5DF7 A;  3RXW A;  5E43 A;  1O07 A;  1CEF A;  5GHZ A;  2GDN A;  4UA6 A;  3BLM A;  4KZ4 A;  4S2J A;  4XXR A;  4KG6 A;  2H5S A;  1E4D A;  2Z2M B;  4OP8 A;  2G2U A;  4MLL A;  4K0W A;  3GTC A;  3WS4 A;  4KQQ A;  3N8L A;  4GB7 A;  3SS4 A;  5J8X A;  1KE3 A;  4RX3 A;  1FQG A;  3G30 A;  4R0Q A;  4QHC A;  4E3K A;  5KSH A;  4GOG A;  1K55 C;  4KZA A;  4N92 A;  2X01 A;  2ZC4 B;  5HAP A;  1PW8 A;  3BFG A;  5CER A;  5FAQ A;  3SH9 A;  3JYI A;  5F1F A;  5CGW A;  3GQZ A;  5FDH A;  3M6H A;  4XUX A;  3CG5 A;  4JXG A;  4WYY A;  5EOE A;  1G6A A;  5F1G A;  4BLM A;  2ZC6 B;  1SCW A;  5CRF A;  1MWU A;  1IEL A;  3IF6 B;  3MFD A;  4OKP A;  2VGJ A;  4M3K A;  3BFD A;  3NCK A;  2PU4 A;  2UWX A;  4ZJ1 A;  1L2S A;  5HX9 A;  3GR2 A;  3MKE A;  1NXY A;  3HVF A;  4GKU A;  1BUE A;  1SKF A;  2WYX A;  3OPH A;  5E2G A;  3BFC A;  1LHY A;  2WGI A;  3HL9 A;  4F94 A;  4Y0T A;  1XA7 A;  4HES A;  3G4P A;  2HDS A;  2QMI A;  1YMS A;  2IWC A;  1XP4 A;  4P0M A;  2V1Z A;  1OME A;  2ZC4 A;  4Y0O A;  5A93 A;  1MXO A;  4MBF A;  4ZBE A;  5CEB A;  4E3I A;  4X55 A;  4DXB A;  4DE2 A;  4S2N C;  1TEM A;  1H8Z A;  4P87 A;  4OQH A;  1YLZ A;  5M1A A;  5CEC A;  3Q82 A;  3HUO A;  4FD8 A;  3IT9 A;  3DTM A;  4WZ4 A;  4IBR A;  3IF6 A;  1PZO A;  4Y7P A;  2A49 A;  1SDN A;  1Z6F A;  3DWZ A;  3UPN A;  1CK3 A;  1ALQ A;  1NJ4 A;  1FSW A;  3C4P A;  1VQQ A;  4OH0 A;  1BLS A;  1YLW A;  1ESI A;  3AGF A;  2Q9M A;  2H10 A;  4KEN B;  3VFF A;  1DJB A;  1JVJ A;  2ZC5 B;  1MY8 A;  3HLD A;  4JPM A;  4KZ9 A;  2XGN A;  3E2L A;  2EX8 A;  1XA1 A;  4R23 A;  5AQB A;  3UDI A;  2R9X A;  3V5M A;  4CJN A;  1ZKJ A;  2EX6 A;  3G34 A;  1N4O A;  4R4S A;  3Q7Z A;  2WZZ A;  4OLG A;  4FH2 A;  4OPQ A;  2HP5 A;  2IWD A;  3NIA A;  4LV2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...