4OVKA

Crystal structure of periplasmic solute binding protein from veillonella parvula dsm 2008
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
329
structure length
329
Chain Sequence
NIKVVTDLTGTDVSMKKEINRIAIVPIPWTSIVYAVDGSDKKIVGIHPSAKKSYEASIFKTLAPDLENVNSSFVDNNFNVNFEEVAKLKPDVVIIWDYQPEVAKKLKELGIPAVSIKYGTLEDIQNGIRLLGKILDKPEQAEALISYHKDSEAYFKQKNASALPNKPKVLYLQNKNLTVAGNNSVNQLMITMTGGENAAKDTKGSWTKVSMEEIMTWDPDIIILSNFDSIRPDDIYQDKLEGQNWSNIKAVKTHRVYKAPMGIYRWDAPNVETPLMMKWMGQLIQPDTFNDYILRDDLKQFYNTFYHYNLTDSEINTILNISINNTPTF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Periplasmic binding protein
publication title Crystal structure of periplasmic solute binding protein from Veillonella parvula DSM 2008
rcsb
source organism Veillonella parvula
molecule tags Solute-binding protein
total genus 119
structure length 329
sequence length 329
ec nomenclature
pdb deposition date 2013-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01497 Peripla_BP_2 Periplasmic binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 4ovkA00
3PDIB 2MINA 1M1NB 1N2ZA 5M29A 3PSHA 4WESB 1EFDN 3BE5A 3R5TA 3AETA 3CX3A 4WNAB 3K1AB 5CX1A 3TNYA 1H1LA 2AFHA 2MINB 1G20A 3ZK8A 1QH1B 4XPIA 3PSAA 5BVHA 1M1YA 3AEUA 2X4LA 2XY4A 5CX1B 4INPA 2OV1A 4TKVB 3R5SA 4MX8A 3MWGA 5JPDA 1N4DA 2AFHB 3PDIA 1G20B 3AESB 5JJ5A 4XPIB 2AFIA 4UTOA 3ZK7A 1M34A 4GICA 1K75A 4DBLE 1QH1A 4WN9A 4UTPA 2AFIB 4TKUA 2M6LA 2WI8A 1M34B 3AERA 4MLZA 4TKVA 1K2VN 1TOAA 1G21A 2PRSA 4ND8A 2OV3A 5KHLB 3MFQA 4K3VA 3ZKAA 3AESA 5KOHA 4WN9B 1XVLA 1PQ4A 3EIWA 1PSZA 4TKUB 2Q8PA 3MWFA 1ESZA 5JG7A 4NNPA 3AERB 1L5HA 2ETVA 1MIOA 1G21B 2OGWA 4ND8B 4HN9A 4H59A 2YNMD 5KOHB 5B58T 4FILA 2YNMC 4PM4A 2XUZA 4WZAA 1L5HB 2OSVA 1MIOB 4HMOA 4BBPA 4LS3A 1KARA 5JOQA 3NU1A 2O1EA 2RG7A 4HMQA 5FLYA 4WZBA 5GGXA 4OXRA 3UJPA 4H0FA 4B8YA 3G9QA 1K7SN 4PAGA 4WZAB 3HH8A 3HXPA 3GI1A 2XV1A 4IRMA 5KOJA 4LJSA 1KAEA 4WZBB 2Q8QA 4G07A 2XH8A 1FP4A 5CR9A 1KAHA 2PHZA 4HMPA 1N4AA 5KOJB 1N2CA 4OVKA 2QI9F 3TEFA 3U7QA 5BVGB 3HJTA 3LHSA 1FP4B 3MD9A 2M6KA 3AEKA 4UDNA 5M34A 4INOA 2XQVA 5I4KA 4OXQA 2WHYA 3LI2A 2R7AA 1N2CB 3AEQA 4FNAA 3ZTTA 3EIXA 3U7QB 1QGUB 4NNOA 4FI3F 2XDQA 1QH8A 3AEKB 2PS9A 5HDQA 5M2QA 3ZK9A 3AEQB 3MINA 4CL2A 3AETB 1K0FA 4N01A 4G09A 5BVGA 4FKMA 5GGYA 3BE6A 5M3BA 1H1LB 1M1NA 1QH8B 2XDQB 4M7OA 4MDYA 5BVHB 4WESA 1M1YB 4MO9A 3AEUB 5HX7A 3MINB 2PS0A 2PS3A 4WNAA 3K1AA 3TLKA 5AFSA 1QGUA 2R79A 4UDOA
chains in the Genus database with same CATH superfamily
4M9UA 3ID6C 4LMAA 3ZGYA 2EJVA 3NHJA 4FFBA 3KZOA 3OFNA 5TQ2B 3WLMA 1BFKA 5HMLA 4YHBA 1ZUHA 3JYHA 1ZWKA 1K89A 4ESHA 4EY8A 1C0EA 2IYNA 4GXNA 1J8VA 3GT0A 4G67A 1USIA 1E1RD 4UNQA 4P6VF 4X94A 3ZKWB 4DV4B 1O57A 4KWEA 4M98A 1U0LA 1RADA 2FH5B 1TUEA 2PKXA 4LPSA 1OC4A 1ILEA 2HSEA 2Q3EA 2GXQA 1IVYA 1CP3A 2YBDA 3GRKA 3OPYB 3DFZA 1GTZA 1XSEA 4MW4A 2GPTA 4A8TA 2C2KA 4UCWA 5EYPB 1PX2A 1ZWLA 2GKSA 2GUGA 5JZ9A 1RT9A 2NO5A 2AOVA 4GMDA 5K45A 4DA6A 2OZPA 2FP3A 1KI8A 2JFUA 4FCWA 4P4LA 1H5UA 2ZXUA 2VQDA 4N8DA 1P0QA 4JR1A 3IQZA 4FP9A 3BHNA 4EGFA 4HADA 5HKAA 3CW2A 1X8KA 1OA1A 4PW0A 4J1SA 1XTPA 1P7ZA 1NN0A 2H4XA 2BFOA 4ARZA 2GZ3A 1X7ZB 4BNFA 5HKLA 4YO8A 3DTTA 5FUBA 4QRDA 1XVIA 4E94A 1DL5A 4TL9A 1BU5A 1Y6RA 2HXSA 1UQRA 2ZJ6A 2ZUBA 1T4MA 3ASZA 1LZLA 1W9MA 4K9NA 4LF7B 1PVOA 3OLZA 4AMUA 5PNTA 4KVAA 2GCPA 1L7OA 4OGLA 2ZAIA 2BMJA 4FMPA 2ORYA 2J5RA 4TSKA 1ZOOA 2GLXA 3EDMA 5EE1A 1ML3A 1QLHA 2QLLA 1N2BA 3O4VA 4PNEA 3UTCA 2X5XA 1D6SA 3HVKA 3L7MA 4RH0A 5EUMA 9ATCA 2VOJA 1UMDA 4WZAA 5EXPA 5K20A 4Q34A 4ACAA 3W6PA 3AM1A 4RU1A 1BMFA 3MJVA 3VVMA 1U3CA 3STHA 3URKA 4IFIA 4OU4A 3EWAA 4R1TA 1KXZA 4L8FA 5CVEA 1TU3A 1YD7A 5U1PA 5J58A 1DI0A 2P78A 1N5OX 2NVOA 3Q2OA 4U0JA 5EMHA 3STVA 2AOXA 2UKDA 1GGEA 4N0PA 3P2MA 5AXCA 1FDUA 1FUEA 2J9FB 1W46A 2GFHA 3KJEA 3QFRA 5T4BA 4M38A 3U13A 4IGAA 3RKRA 1OPXA 1XLVA 2GXSA 2CVHA 4V0QA 2VSOA 2V97A 3ASVA 1HDCA 1DAMA 2PT6A 4G5HA 1Z8DA 2Q0HA 3KUUA 2GHTA 3M4ZA 3NBAA 3QMWA 4NBKA 5A4FS 1NVBA 4YGYA 4OK3A 4DBZA 1D0SA 2VXOA 5JZSA 5KTNA 3EZLA 2RGDA 3D6FA 4ZQBA 5EKUA 1L5QA 5DPMA 3J7AC 1O89A 1Z16A 3ESYA 3ICCA 3D3JA 2RGNC 3I2JA 1I5EA 1N2CB 3OJWA 1HT3A 4PAWA 5EZQA 4Z0PA 4F5ZA 3QM1A 1NN1A 3IEIA 5KTKA 3AF0A 4CF4A 2WZDA 1CZNA 3RANA 1KI6B 2R1VA 1WF3A 1UBEA 2X58A 4WA7A 2CK3D 3R2JA 4I8XA 4X8MA 3SC2A 4AQ7A 3THXA 3U44B 4R54A 4A8JA 1XB2A 3IP5A 3QGMA 4UMEA 4AJPA 2QT1A 4AJIA 1JKJB 1WZUA 1R64A 4B79A 3NAQA 2CEAA 2QLTA 5AKHA 1AU9A 4WWHA 3FGNA 1X7GA 1OKKD 5E8RA 3ND5A 5F4ZA 5HX7A 2RHRA 4HDSA 2B92A 3T1OA 3ETNA 3GLFE 4G0UA 4EF4A 4C4SA 5IXJA 3PI7A 1T5SA 4DMMA 1QGUA 3TZLA 1G8HA 2QP4A 4K9OA 1TA4A 2WWFA 4ZARA 3T5MA 4B3XA 3IDFA 5CXUA 2OZLA 2QN1A 3E2PA 5BUSA 1H6CA 3IMCA 4A9AA 1SVIA 1FFCA 4X6YA 4JENA 4FDLA 2DTEA 3C43A 3RRBA 3DQZA 2FPUA 4P7BA 1I7NA 2QYSA 3D8HA 4RMIA 3ZH2A 5K8LA 4I1SA 2FZCA 3AB7A 3H2IA 2ZUDA 2Q2OA 1LF0A 1NXPA 4PF1A 2Y3IA 5H68A 4C7JA 4DV2B 2BP7A 4MVJD 4HT3B 5A03A 1CS4C 4ZANA 5F3WB 1WCWA 4ZXFA 3LP6A 5L3QB 2UUAB 1ILWA 4WKGA 2B8TA 2HADA 5DNAA 4D3XA 3L9XA 2J3QA 1VLVA 1CUCA 1JQEA 1W94A 2WDPA 2PSSA 3HDHA 4ZTUB 3NX4A 1M2HA 3MUFA 3QUCA 1KI9A 4W1QA 3DT6A 3UGTA 2JATA 3PGVA 4KFSA 2BV3A 4A0QA 3KOWA 1JIXA 4JHXA 4P54A 4BEVA 3RRYA 4ENRA 4HDNA 4MWGA 1DSSG 4U9UA 2D2FA 4XJTA 4AI6A 2QW1A 1P0IA 2IHBA 5FL3A 3PEEA 4WA8A 3EZ2A 3W6OA 3EARA 4B9AA 2OO7A 3BE8A 3LUAA 4OXNA 3VX4A 5JD4A 2LW7A 3QOFA 1ULSA 4F7WA 1CRLA 1H2HA 4ZFNA 4MAMA 1SHJA 1MJGM 3DXYA 4LRXA 4BJ5A 2VC2B 5DWQA 2ZBQA 1H1DA 3G0IA 4GP9A 2LPMA 1HSZA 3EZFA 2PUEA 2OHJA 4S1WA 3THWB 1B0AA 2FHSA 4OQEA 4KBFA 3O4HA 4U39A 1QPBA 4XYEA 4ZYYA 3AXTA 2FFJA 3DPSA 2R65A 2VSQA 2NAPA 4UD6A 3WKBA 3KC2A 2ANBA 2Q3DA 1MDBA 2GILA 2VG8A 2WP8J 4I5FA 4JP5A 4KPGA 2WPDD 3W2GA 1JWLA 3MJFA 4FKBA 1V3VA 4FOSA 3RU9A 4B80A 1W4CA 2JLSA 4IMIB 1U8TA 3B7GA 1TKBA 1CEEA 2F8MA 3C6MA 3V2UA 3OF2A 3R9KA 3PUVA 3HNRA 3QPUA 4IGKA 4WXMA 1O1YA 5D86A 3KVRA 2JH3A 2XR1A 3PQEA 1Y6QA 1KAEA 2NU7B 1K8XB 2JGDB 4FS3A 4EEKA 1A27A 4TUYA 1R0KA 3ZY6A 4AP9A 4S0XA 3B12A 1QFJA 3PJGA 2QN2A 4XQGA 2QQ5A 3RJ9A 3WSWA 3WWEA 1G2IA 4U7PB 4X1IB 4F2GA 1MO5A 4B3BA 1V47A 3ABOB 2CCGA 4QGAA 4IDPA 1CERA 2H2IA 4UBLA 2BT4A 3BIJA 1T8TA 1LX6A 2W37A 3V4FA 4HDKB 3ONFA 3WLAA 4XOUA 2FK8A 3WBFA 3DNPA 3U7QB 3K0CC 3EG5A 3IEXA 3U48A 4DDWA 2CVQA 1XZHA 4MB2A 3UKDA 4ND5A 3ZHVA 3OP1A 1NPYA 5L6MB 2AT1A 3PFKA 4PNPA 1C30B 2H4FA 3V80A 1FTGA 4H7FA 1J22A 3G2NA 3AF6A 4MS3B 4U5XA 1LQ2A 2EC5A 1OHHD 2HIHA 2VUTA 2X4DA 4BC1A 2ZI3A 2II6A 1TEZA 2ZQZA 4X85A 3MWLA 3QTLA 3CT6A 3R24A 4M9ZA 3EZYA 3T06B 4M1SA 4EUSA 5E6RA 2LVBA 3JQ6A 3GFTA 3MMSA 3W5DA 1BDBA 3T7TA 4KN9S 1JG3A 1K6MA 3MSCA 4M76B 4C03A 1DTEA 3BHIA 1Z68A 1WVGA 1P4SA 4H7DA 1X2BA 4TV8B 4D9BA 2C84A 5FPYA 1E4YA 3HYNA 5EZ5A 5FI3A 1RYYA 3KDSE 2I7VA 2O9JA 4Q24A 2EL7A 3GGSA 5BQFA 2WTXA 2B1RA 3PE6A 1JBEA 3BFKA 1WX1A 1Y1PA 3QKRB 3P9IA 4KE8A 2BM0A 2WABA 3M2PA 2PH1A 1GILA 2IOFA 3B13B 4MWBA 2ODAA 4UM7A 5I3ZA 2HK9A 1ZMXA 2Z95A 2FMIA 3ESZA 3R3HA 2I6GA 4IMPA 4ZOBA 4M9QA 1W4LA 4WXHA 4BGVA 4BX8A 2I6TA 4X61A 1HE5A 3NOXA 1ISHA 4KG7A 3DTVA 4QIHA 3ZTYA 3A32A 3EMBA 3IUEA 5JDCC 3RU7A 5DN6D 5HKKD 1J49A 1T34A 1FS6A 1CF4A 2W2LA 5KTOA 5KAPA 1PUIA 4M3NA 2W43A 2J0UA 4Q16A 3WGNA 1D9ZA 4HCJA 3CISA 3QXSA 3WYNA 1NTOA 2B4RO 2AW5A 3RYFA 5KNLA 1X1EA 2JANA 3BQMB 4IH4A 1IEWA 1LK7A 4YJDA 2QQFA 2HYDA 2NN3C 2FY8A 3NASA 5ICEA 5EWLB 1VLHA 2H3EA 1EAYA 3FYHA 5CU7A 3IP8A 2R6DA 1IK6A 1XTKA 1IXKA 2X1LA 2XXAB 2I8LA 4UU8A 1HDGO 2V4ZA 4CMEC 6ADHA 1KMHB 4QM7A 1PSWA 1NG1A 2BGRA 5EUBA 2I2FA 1EA7A 4MR7B 3RGWS 2R8ZA 3PGXA 1PG5A 3WYCA 4BYMA 1J33A 4CI9A 1QV7A 5IM4A 1ZD4A 3ZI0A 8AT1A 1OOEA 3HDJA 3GMIA 4DQUA 2V74B 1P4JA 3WGUA 1QVAA 1KH3A 3FKSA 2YWFA 3QUAA 1X7WB 1JPNA 1XI2A 3SSNA 2QIOA 4AJ9A 1LVHA 1ZL2A 2WU3A 3BE4A 1EX1A 3L9WA 5TMDA 4Z53A 3REQA 1LNSA 2PX8A 3WKDA 4O1HA 2WWGA 1X1DA 4FSXA 1HEIA 4B7UA 1J2RA 2R97A 3CZMA 4JOCA 4DT1A 4D0SA 1JYSA 4KKVA 4DCNA 2OMEA 4BMSA 5CVTA 3PWTA 3O4RA 4FEGA 4HVLA 2ZIWB 1VCHA 3GGCA 1O6ZA 3WGQA 4EGAA 4IDDA 2R66A 2GZSA 4Y2YA 5IFLA 4BZWA 4R8LA 3KU1A 1M0EA 1X9IA 3L6DA 2KB0A 1AC5A 1RKXA 1XDUA 2G0NA 4CMJA 4N5DA 4OHWA 2XE4A 3Q5DA 4BS9A 4WPGA 5JARA 5FPHA 4DXAA 5A3JA 4RENA 3FD8A 4IHQA 3WTCA 1GLNA 4J7CA 3HB9A 4ZK6A 2ZJOA 4C7OA 4B9EA 2XUPA 2PT5A 3CZPA 2AEMA 3H1EA 4AYTA 3RS7A 1M8PA 2XECA 5KHAA 2VDVE 2QSYA 3LQRA 4JBLA 1W35A 1USUA 1ULBA 3L79A 5C7YA 5K0ZA 4G5QA 3WIVA 4MRVA 2J87A 1UBUS 2J7PA 3N2IA 1K4KA 3L0BA 5CVVA 1PZGA 5ABPA 3K8QA 4ETNA 1HURA 1Z2CA 4G56A 2XWPA 3L8MA 4JEUA 4OEHA 4DLPA 1NVGA 1OTHA 2C2YA 1SEPA 1I2CA 4RHEA 5FF9A 5BWNA 4BASA 5C5EA 1U11A 3I62A 1K88A 3RRJA 4GEGA 4RK7A 5AT1A 2J5BA 3P9SA 1QNFA 2P6UA 3ANLA 3FAZA 1Y8QB 4X63A 5B36A 2W42A 1H23A 3VR5D 1XNGA 2BMDA 3JATB 4I6GA 4NYIR 3GJ8A 2PFSA 3NQ41 1V16B 3D4OA 3GH3A 3PYLA 5FP0A 4A2PA 1AM4D 4TKLA 1R5NA 4X8LA 3MGKA 4OHOA 4TTJA 4WOJA 2VTVA 3KQSA 5E2IA 1EKXA 2CCJA 3NDBB 1JR3A 2QTWB 4O33A 2BKXA 3TBKA 1XZNA 2YIJA 1H9AA 5KB3A 2H4ZA 2SCUA 2C5FA 1KAGA 3MT0A 3E3NA 2FR8A 1ZNWA 1HG0A 1YS4A 1BQ4A 1XKTA 1SURA 2VI5A 4ICIA 5D3MB 1OTYA 1DU4A 2WBLC 2DZDA 1N0WA 2YIDA 3Q7SA 5DX1A 2X0EA 4I08A 1VLLA 4JJ4A 2RJNA 1P7CA 2HM7A 3E1SA 3HMQA 3H2YA 3LP5A 2FLKA 5BSVA 4RPIA 1D7AA 3FNFA 1TZCA 2JLAA 5HIIA 5DMHA 4CMGA 1BX1A 1SFRA 3W79A 4NICA 3V32A 5HKBA 1QRRA 1T9GS 4XIJA 1GCOA 3QYAA 2L17A 3BKXA 4UHKA 5LZ8A 5A9SB 1V95A 1JQJC 1ADFA 1G21B 2G28A 2PKYX 4HI0E 3RVLA 4BTEA 3DLBA 1BWRA 3DKVA 3PNOA 4H31A 1NNLA 1MGPA 1WCV1 1YRAA 1Y6JA 2GEVA 4KDFA 2QVXX 3NPAA 4Z2YA 3LPLA 4JEIA 1RZUA 4JWKA 1W4RA 2JIQA 5J59A 3G85A 2IITA 1CY0A 2GD2A 3CCCA 4HMOA 1IVNA 4RESA 3D2BA 2XCTB 3EVDA 1GCAA 2VH2A 3TW6A 1KQNA 3V7UA 1JWBB 1AKNA 1RWPA 4CV0A 5TX7A 1IOVA 2REBA 3HWRA 4PRKA 2BMWA 3PZRA 8ATCA 5FBQB 3W3AA 4JI7B 1MRZA 5FPQA 3NHSA 3DLIA 2JGJA 4L5BA 5GINE 2C9YA 1SIBE 4E31A 4RV5A 5EHQA 4Q3AA 2XTMA 1OV6A 2AD5A 4P7JA 4G8CA 4YP5A 3NYQA 4MUAA 5AI9A 1XNQB 1AHHA 1MV8A 2WIKA 4KOAA 4U00A 2B0JA 4WLFA 1I01A 2BH9A 4FQ5A 2D59A 1N9KA 2P2YA 4KFTA 1NVXQ 2ZU6A 4WY2A 4INOA 4CKZA 4GECA 2CJFA 2QYTA 1CRZA 2V3VA 4E33A 4M0UA 2CYBA 4YP0A 4O4JB 3TS1A 2I2WA 4MVCA 4WKCA 5F4BA 4AJKA 3AL0C 4GI2A 3PNPA 5B3AA 3K9WA 2XGJA 1T1GA 3IMEA 2GN0A 2PRJA 5EJGA 4QAQA 3RRXA 5JAZA 1J24A 3S99A 3BS4A 1W0KA 3BZWA 3BCSA 4IIJA 4DJTA 2POCA 2E4VA 4GLLA 3EPRA 3CUTA 5HK9A 4GX1A 1TYZA 4WLNA 4BVJA 1F8UA 4CLHA 4D1YA 3QIAA 4IILA 4D4GA 1XVTA 2IIBA 1DXYA 3QX7A 3G8DA 4MDYA 3EPPA 4ZQFA 1FYXA 2GCGA 3ULKA 2WUEA 3UHAA 2TMKA 3BL6A 3E61A 4JQSA 1RXUA 1UDXA 1KMCA 1FMJA 5T57A 3WRWA 5E6SB 2ONYA 2XWBF 4MQBA 5AFSA 2D00A 5KSYA 4GBMA 1U3TA 3NM5A 1N0VC 2BR3A 3TKYA 5CD1A 3CUSA 5AQ1A 2NVWA 1TUGA 1K68A 4COOA 3A9SA 3L3BA 3QJGA 5DX8A 4ZI7B 4LJRA 2W6ID 1MNAA 3FA2A 4CT4B 1TTHA 3A06A 3P45A 4LZPA 3TL3A 4XPIA 3FLAA 4GQIA 1M8JA 3HZOA 3TQSA 3L7YA 1N92A 4PLWA 1FE8A 1Q20A 1PJ4A 4CG3A 4D46A 4D74A 4D8XA 3QELA 3U4GA 4M36A 1V5GA 1GR0A 1KTVA 1YZTA 2P1DA 3EAFA 3N05A 3H99A 1RWBA 4U2BA 4YT5A 4HUTA 1I13A 3HY3A 5L95A 2AOTA 2IEIA 3KPUA 3OQ1A 1EA5A 3OWHA 1J9EA 5CT6A 3UXMA 2VUSA 3WRYC 3LC0A 1AT1A 4CMIB 2HRRA 1NNSA 2NU6A 2DBQA 5DTJA 4D2IA 4FHZA 1L1QA 3U9SA 2EW8A 3HUFA 3TBFA 1EMDA 1G6KA 1P75A 2Z58A 4NIMA 4RA9B 4XVRA 1B3BA 3ZCVA 4C4YA 3HBLA 2HRZA 4AJ2A 1GO2A 3GEBA 4XCXA 2PBZA 1Z7GA 4L76A 1S2GA 3TLJA 2AXPA 2ZSAA 5DP1A 4A26A 2Z57A 3NGMA 2RIRA 3MJHA 1HLPA 2VRCD 3RHZA 1T6XA 3GB9A 3V9AA 2QNRA 2J3DA 2F3RA 4I9GA 2IKSA 4GVLA 4OHUA 1N78A 5AICA 5KTRA 3AKCA 1QGYA 1U9ZA 3S28A 2I8CA 2HGZA 4PHGA 1DO2A 5AVVA 4GKKB 3N76A 1RRCA 4PZEA 3T5CA 7MDHA 3GLFA 3IMFA 3RAPR 1K5DA 4OJMX 1UXJA 4Y2JA 4K87A 3TDMA 2FU5C 1TA9A 2D1TA 3LC2O 2C29D 4KE7A 4RJTA 1BOFA 5EEGA 3ZE0B 1RYNA 1OYOA 1ZBQA 1YB4A 4JKYA 5KNCD 3RVBA 1FTYA 3HR4A 5D6NA 3TD6A 3EIEA 1Z28A 4W63A 4EVQA 5HRCA 1I4WA 4FM9A 2M32A 1BKDR 5AESA 5CDYA 2JI8A 1GL9B 5F7ZA 2ZSKA 3A6EA 3NDJA 3KQWA 2XUIA 3IJRA 1FQWA 4REOA 1V8ZA 2QTVB 2YZGA 4BP8A 3MUEA 3FM9A 4G37A 3CRVA 4AT1A 3ADBA 1Y8RA 5L4LA 3PX2A 4FJ1A 2GZHA 3I4CA 3P1JA 3I04A 4TXJA 3NS7A 4Y9UA 3PKIA 2WM2A 2FPIA 1HI9A 2JLXA 1U7XA 4LDQA 3MS2A 2PZEA 3B9BA 4E21A 1P19A 3WAGA 2WAAA 1XDSA 2XQVA 4ZQCB 2YV5A 5FFNA 1RXIA 4YO7A 1M7HA 2FPWA 4U0KA 4HWTA 3W7VA 2OQIA 3ORFA 2Z0MA 4NDNE 3PUYA 2G9VA 5ITSA 2O8BB 5A4IS 1UF9A 1W88B 3GU3A 4CZ2A 1A0OA 1QFYA 2PMFA 1ZU4A 3HTXA 2X13A 4DZRA 1Y8CA 2AKAB 2FMXA 3BH6A 2RAVA 2YQ4A 5BVHB 3JQAA 5JNRA 3AEUB 3MGAA 4W6ZA 3SS9X 5TC4A 3ZKWA 1E5QA 2PH3A 2ZJ1A 2NTYC 4MKFA 2C04A 4X7MA 4UOQA 5COQA 4G5OA 4A6DA 5TS3A 3N2KB 3FJOA 4RVSA 4K2HA 3OPYA 3SPXA 5GPBA 2Q6KA 1M5UA 1LC0A 5EYPA 1XFAA 2DFLA 1OW3B 2Q9AA 2N75A 4ZCLA 5KVCA 4UASA 1WE2A 5FNVB 1JG4A 2A5LA 3N70A 4JUBA 2A67A 4K9MA 3TB4A 3PI6A 3I2IA 2JCXA 2CD7A 4N18A 4XRGA 2WU4A 2UUCB 2DBRA 2HMAA 3QLJA 3UAXA 4MQ5A 3CLUD 3CZRA 4GZ3A 2H63A 1OXVA 1P4AA 3TIFA 1QGAA 4GOKA 1YWGO 3MWDB 2PE5A 3C45A 1L7MA 1VLQA 4GMHA 3GN2A 2FOIA 4KIUA 4J75A 4NCIA 3V33A 5IEBA 1FXSA 1L5OA 1YUNA 1RHQA 2PV0A 2A4MA 1XZEA 3KYIB 2JVKA 3M0EA 3BGDA 5AHWA 2FYTA 1F60A 1P1FA 1L4HA 4GGMX 5CDFE 1TPZA 3QJ5A 1XU7A 1XZCA 2JBAB 4CE6A 1H9CA 1KS2A 1WXDA 1RQXA 2DF8A 3ZWYA 3FTPA 4XSGA 2KX7A 4DV7B 2H5LA 1MTZA 2FSVA 1KSFX 2ZSHA 4MA5A 4P2GA 5CGQB 4AJJA 4GBGA 4N9QA 3HXTA 3UNXA 1T8SA 2B1IA 3GUCA 2GF2A 4QD3A 2QUIA 1UKCA 4IJUA 3SX0A 3OBBA 1X87A 5PGMA 2MR5A 3Q41A 4D42A 2P6RA 1KBOA 5B58C 3K70C 1U0RA 5TJHA 2O3RA 2OGUA 2R8RA 3SFVA 1E4VA 4NBLA 3TTSA 1FIUA 1FMFA 3MZ0A 5DO9A 5JAPA 4FOOA 3R23A 3R4CA 3G9QA 4GPIB 4PBRA 3A4MA 2C8JA 2FE4A 3A4YA 4OJNA 2OLEA 3K9QO 4NXNB 2HY7A 3ZWXA 1PZFA 2FWJA 3MJRA 3U62A 1OFUA 4L78A 3PX7A 2WF9A 5A0TA 3MIZA 4CLEA 1L5KA 2BTQB 2PPVA 4JI0B 3BFPA 1E0SA 3NT5A 3T7CA 3OZUA 1N2CA 1HYEA 3CVVA 3D2AA 1FDIA 3C6XA 2QEQA 3C4VA 4ETIA 4TQUS 1O97D 2XNCA 2CXSA 3V1TC 2XAAA 3DDNA 3O82A 3R3YA 4JJGA 4UDNA 1KI6A 1OUMA 2SHKA 3H1AA 1U2TA 4IFEA 2EQBA 2WT4A 3NDIA 1AQIA 4LGVA 4MUHA 3WMXA 2JLYA 1W2GA 4TS3A 3C1TA 3VZCA 4M99A 1VJTA 1D2AA 2PXCA 5IULC 1SCUB 1YCDA 5J63A 5JZVA 1HH4A 1GQRA 5LCXA 3LTNC 3I6QA 5AIAA 4HDRB 1ZVJA 3CW9A 4H77A 4P35A 3A3OA 1FQJA 3FPSA 3JXEA 4PGMA 1I7SB 1MOZA 3W5AA 3OZDA 4PN7A 4X7RA 2DUMA 4TV9F 5AW2A 3CVWA 1U3UA 4ALNA 2D1FA 3L7JA 1LTQA 1UK9A 4DLBA 4JP1A 3DEJA 3H8WA 1N57A 1E61A 1GZ4A 3CF0A 3NBZC 3BF7A 4B09A 1I2MA 3AY0A 3FUTA 3A6KA 3LWNA 3ROQA 3RUDA 2CXRA 3AIIA 5EPOA 4EI7A 1FC0A 3OIUA 1F0KA 3DMTA 3VVLA 1NDQA 1U6KA 3L41A 5EL0A 1BYUA 1EP3B 5L3QA 1TAQA 3U4DA 1L5SA 3SS7X 2Y0BA 4RHCA 1O5TA 2XMBA 3CONA 3BIOA 4M9SA 4OKSA 4XIIA 3BRCA 4XW2A 3D5QA 4G9BA 2QF7A 5A6SB 3RGGA 1E1CB 5JAQA 3TG2A 3LT1A 2AQKA 3DDUA 5KJCA 4PVCA 1MRSA 4IHJB 1LF5A 4RV4A 4F3CA 2GZRA 1W5FA 3FRIA 4RY8A 4XUGB 1CJVC 4LJ6A 1UEIA 2CNWD 3I83A 1BA3A 1D1TA 4KFUA 5ISMA 2MOKA 4P3XA 4Z0TA 3CBQA 3FSJX 1KXJA 3L4SO 4H0CA 1WKVA 1WXHA 4G85A 5EE9A 5C8XA 1KL7A 1SU4A 3KSBC 1VE9A 4RZUA 3ZU4A 5LZ9A 2AQHA 1NUSA 1VP3A 2ZBGA 1Q7BA 3KZKA 3NVDA 4MKRA 5ICCA 4KQ2A 1J0XO 5JZOA 4ZC1A 1UQTA 3THWA 1Z5GA 1JDSA 4ASUA 3LQYA 4KR6A 3PC3A 4K6KA 4BRUA 4YJ2A 1UBOS 3HYSA 2CUZA 4NMHA 1CYEA 5IT0A 4OQNA 1E2EA 3HEMA 1Z18A 4D9IA 3SQMA 3AERB 2R96A 2JFOA 3LPMA 2JFZA 2RHHA 3P32A 2YZMA 4FOLA 4MWSA 4PHCA 5JD3A 3V34A 3QSYA 1TJ5A 1M2EA 1QZXA 2Q6VA 4FILA 3HXQA 1T24A 4B3HA 1S4MA 4B3JA 3BB1A 4PS1A 3QPAA 1B00A 5B2FA 1SQFA 5KNDA 2Z6VA 4J8PA 5AVKA 3RVOA 4K8OA 2W4QA 1RPZA 2JGDA 1IMOA 2AQ8A 2E4XA 4DNQA 1QZZA 1VGQA 3DZHA 1WS6A 3PPYA 5SZIA 5KYWB 2XB9A 2OCGA 3HCRA 5CVDA 4D3YA 1ORIA 2GRUA 1OLXA 3E7DA 3AHHA 1XAJA 2XV1A 5IC5A 3RJMA 1IZZA 1EK0A 4X1IA 4E6PA 5JFGA 4DHEA 1GZVA 1XWWA 3G0OA 3OZSA 3V00A 4FCTA 4WXRA 3N07A 4TTVA 4AJ4A 4C0QC 1M5RA 4B74A 4BLUA 1GIAA 5ALWA 3PVZA 4HDKA 2QTNA 3HDGA 5JFTA 3U7QA 4DQ0A 3FY4A 2BGGA 1OZGA 2VWPA 3LHSA 3A1DA 1ZA1A 4DV1B 2C8KA 1C30A 4PCUA 1IFXA 1TPYA 3ETHA 3ERCA 4J0IA 1ISSA 1VZ3A 2C78A 1T0IA 1GADO 3NHRA 1Z88A 1GPYA 2SECE 2YOGA 3I01M 4MS3A 1KE2A 1KYZA 1PJTA 2CUKA 5C4GB 1SQ5A 1YRWA 2ZSBA 1ZJ6A 4II7A 5TMBA 2FX3A 1F17A 3L4JA 1IUKA 3AEQB 2GLTA 3B6EA 3KPWA 5HS4A 3FBWA 1UK6A 3KT0A 3G3EA 2I6XA 4BUJA 5IYZB 2PZMA 3M9WA 4E88A 1PW7A 3EDQA 1CXZA 2E6UX 1MDFA 3C98A 1M1YB 3CGGA 4XQCA 5F9HA 1U9IA 1MHPA 4C2TA 1DT3A 1E2QA 5IDVA 2W83A 1MMFB 3E3AA 4UQLA 2QP9X 1SXIA 1XXLA 3CXRA 2VPPA 3PQ6A 4LCBA 4ZVRA 3IEMA 3GR6A 4CQMD 3QKRA 4U7DA 2OHOA 1JVBA 4TRMA 3I5YA 3B38A 2V7GA 2BBWA 4UMVA 5LU8A 3AEXA 1YBFA 1DARA 2QJOA 5EIWA 2ZIVB 1JECA 5GV7A 3IV9A 5CB0A 2JLWA 2YW9A 5HUQA 3N6VA 4FLFA 4E08A 1BEEA 1BMTA 4FGWA 2I1WA 3A14A 1XTQA 3MWEB 3DAGA 4ZZ2A 4KC0A 5F9FA 4E13A 1QOZA 2TMDA 3LLMA 5CUQA 4B7ZA 4DCMA 5CA0F 1L4UA 4MS4B 1G5QA 5GAJA 4DBVO 1WMBA 1P4GA 3TX6A 4BBJA 5JC1A 1PDVA 2SKCA 2PVPA 4JFRA 1C8BA 1XDBA 2XXBA 4WNYA 5C1OA 2HNAA 4F38A 3GZ4A 4TVKA 3GVHA 4OIMA 4OKIA 2ZRBA 1WXXA 2FTKE 2C3YA 3KLPX 2VYQA 4YY3B 1KOFA 1B6GA 1YUBA 3R7AA 2E82A 4IFBA 1VE1A 1M34B 4W99A 3K1ZA 2P9YA 3AZQA 3DPUA 2XMZA 4M49A 1Z4MA 2QMEA 3D1VA 5EWLA 5BSTA 4XSHA 4K3VA 4CM3A 1N5KA 4FI3C 4G2TA 5KJ6A 1Y9JA 2QLFA 4OAQA 1LRLA 4J29A 4EQ6A 2QMUA 4ZO8A 1KMHA 5C52B 3AUAA 3CV3A 4CXMA 4JB0A 3F8WA 1RRFA 3HJFA 4NYJR 1XTBA 4OI2A 5FOQA 2DFKB 3PTZA 4G4SP 4QUBA 4Y6SA 1UC9A 1UWKA 4ZEOA 3WZ2A 3ZE9A 1OQAA 3S55A 2J9GA 1R0RE 5I5GA 3H6GA 4FZVA 4DMLA 4B4VA 4JGBA 2JKVA 3QU7A 3DWFA 3NV9A 3ZXIA 3RRFA 4QBHA 4OXRA 3MRSA 1T9KA 2HKIA 1OD6A 3K4PA 1ZKDA 2VQEB 4CQNA 3MAAC 7REQB 1UP7A 4RTQA 4XX0B 2ZTSA 5IAJA 1ZD5A 1PR4A 3QPBA 5ALEA 2BUAA 3OICA 3VKUA 2QTAA 4MVJF 3WE7A 3V4LA 9ABPA 1M8GA 3DHYA 3OE7D 4D57A 2X5KO 2JI6A 1OA0A 3LL7A 4KXNA 2NAFA 1NNUA 2GWHA 4DUGD 4ENSA 1E1MA 1FXWF 1PFQA 1XCOA 2E4ZA 2O4UX 4MO2A 4UOZA 3WGIA 1KOGA 1DZ3A 2XTAA 4YX9A 4L8VA 2FWAA 2O7RA 3K15A 4EK9A 4CIAA 2O8NA 4V03A 1XAIA 2C03A 2R4QA 4I8DA 3ABQB 2VEOA 4QECA 2JCGA 3U31A 4EO4A 2VP0A 4PSUA 2YHAA 1SXHA 1JFLA 4MVJG 2XADA 2J3LA 2PLNA 2QPTA 1O6CA 3HP7A 3I3SR 1GKUB 1Z8FA 2PKWA 4JKIA 4PQFA 1DEHA 1GG5A 1LSSA 3GFVA 3R7NA 3RTGA 3VGJA 4Z9YA 4QOSA 3B6MA 1Y1TA 4C3UA 5G0TA 1GPKA 3UXEA 2HPZA 1EK1A 3MGCA 4OPMA 1BD4A 1QH8B 4RSHA 4M0MA 4V0SA 2GN8A 4R40A 3VFDA 4Y7CA 1W30A 1HLFA 3LY5A 2F1HA 5GONB 3BB3A 4L8WB 4TTAA 3WDKA 5CBPB 1ZNQO 1SQ6A 2QY9A 2YWGA 3Q9UA 4HAXA 5EXDA 5JALA 2X8JB 2ZXFA 1Y8QA 4Q02A 2EZTA 4FD2A 4EO7A 2WWRA 3PFHA 5B12A 3SYKA 2CFRA 3JATA 4MP6A 2NO7A 3NXKA 5ALTA 3MOIA 4CU5A 1V16A 3VU8A 3G0DA 4OO3A 3IKLA 4GVXA 4ENVA 1UFQA 1M8KA 3EIFA 4CKCB 2O23A 5JBNA 3A3YA 5I7HA 1Y5RA 1ZGCA 2HO5A 3F9RA 5D3MA 1Z29A 2XQIA 3EHDA 2XMCA 5F1KA 1EJ0A 4C3VA 1OV4A 1AK2A 2PO7A 3P9CA 4JVLA 3GWZA 3QTTA 4ZEMA 5HHTA 1SHZA 4CBVA 3WDLA 2GKGA 5EMKA 3H4MA 1KKLA 2RMKA 2WSIA 4PLVA 1BDMA 1A8SA 4C0HA 1WULS 5L7YA 3L1IA 4YPVA 2OA0A 3Q3GE 5JFOA 1IQPA 4OXKA 4ZQHA 3VDNB 1R6XA 2ESRA 2M6LA 3WSTA 2CNOA 4AXBA 1DJPA 1VPVA 3OQPA 5A9SA 4D3FA 1G21A 4DEYA 4HUQB 4PPQA 1M1YE 4BU1A 1FFEA 2AUMA 2B98A 1D0IA 2HRDA 3AESA 3K0FA 4WCFC 3RT7A 3X2EA 2W5UA 1PTKA 1U7TA 3OQOA 4G4GA 3ONVA 4ER0A 3MTJA 4WUVA 2XE8A 1P9WA 3AXSA 3CVXA 4KMOA 3G5AA 2WQ6A 2CVOA 4RF3A 1OBVA 4ZD6A 1VMEA 2SBTA 1AN0A 3LPCA 3FOBA 4ZCPA 1R66A 3NAGA 2PAAA 5FBHA 3OCYA 5JD6A 4O3MA 4PGGA 2L82A 1DIRA 1O97C 2GZMA 5ILGA 3VZDA 1SM4A 1PR2A 1GG8A 1XXHA 4HAIA 4BBPA 2ZU0C 5DYNA 1TJ3A 1PS9A 2G4CA 1ZONA 1NY5A 4YRGA 5LN1A 3ESCA 4K1XA 3HCNA 5J2UF 5AKIA 2GS9A 5IKXA 2OBFA 4CIDA 1A8UA 4Q3EA 1B43A 4XA8A 4R3UC 3F1KA 4UM9D 1MORA 7ADHA 1NR7A 3RDPA 3LF1A 5EGSA 2CLLB 2JAUA 1JG6A 3UWOA 2IL1A 4CODB 4DLZA 2XMPA 1JLKA 4LRSB 4EGCB 5JAOA 1TJYA 3HJNA 5AM2A 3HYCA 5DRTA 4P22A 5BMVF 3TRKA 5HW0A 3DA8A 3NG1A 3WHLA 2YWHA 4O4JA 4BO2A 5C5IA 2XB6A 5F5XA 3HM2A 5JWHA 3BXZA 3ETGA 3BWVA 1M34E 4BMCA 3QKWA 4EABA 2QD5A 3S7ZA 3P0FA 4P0TA 1WR8A 1A7AA 1EVQA 3L0PA 2IV7A 3VU0A 2VDWB 1BWSA 4WKOA 2ZJAA 3DHNA 2HMSA 2QUKA 2O8FB 3A1TA 3CWZA 1CJBA 4G1BA 4UXIA 2WJYA 2HA2A 1P61B 5A5DA 4BQPA 1P5ZB 1WMDA 3QVUA 1BHSA 3CF2A 2DQ4A 4XDYA 3JVUA 2EOAA 3OA2A 4OHPA 3VJKA 2ZM6B 4HEJA 4NDZA 1IWOA 4Y2HA 1YI8A 3F71A 3OJLA 1B6SA 2Z2KA 1DTSA 5E6SA 2CD9A 2KSQA 2RK4A 4TWIA 4HAYA 1KZ4A 3PRJA 2P27A 3VTKA 3TI9A 5FDFA 3E9YA 4DKJA 4HLUA 1EESA 3IBFA 2OORA 4TN1A 1H4TA 2ZT6A 3O8DA 4J94A 4ZKEA 4NFSA 4RJIA 4CFZA 1V4BA 4OHRA 4ZI7A 1WJGA 1U63A 4CLOB 4FLMA 1HDXA 1JNYA 1KR2A 1VJ0A 1X77A 2Y93A 4Z1MD 3KQKA 3B6KA 4R2JA 1XCJA 2GN6A 2AA3A 1Y9ZA 3K6SB 4COKA 2FJ0A 2OM2A 4IM7A 4PYMA 2PSDA 1PZMA 4QO8A 3OT4A 1NSTA 4DLRA 1VHWA 4MYRA 4BUCA 2ZZMA 3FDXA 2EZ4A 2BSXA 2V7BA 1BGVA 1E1QD 4CF5A 3DWGA 1FB5A 3M1YA 2OK7A 3WGYA 1Z5WA 1YBMA 4CMIA 1DWUA 3AP1A 2DPYA 2X0NA 2XUKA 3G6KA 2RB5A 3TOSA 3ZDZB 1W87A 4LJYA 4KTVE 4AJLA 5GZ3A 1I4DD 4RA9A 4UDYX 1U0GA 2DHDA 3ZJYA 1FMTA 2YXLA 3ZWAA 1JIIA 2JFWA 4H27A 4JDPA 4PS0A 5GVRA 1FFXA 4QU8A 1Q84A 3A9VA 1Q21A 2Z08A 3ETDA 3IAHA 3LBNA 3MMPA 5FL7D 4AMVA 4D7AA 4M21A 1G42A 1ZH4A 2V45A 2VS1A 5K6TA 1EJ6A 2C8LA 4CCSA 4DY4A 1IHPA 4R16A 1J56A 1RPAA 4PONA 5HFAA 1IQUA 5EE0A 4FPXA 1YJ8A 3CSDA 3O75A 5K3CA 3WWPA 2YJ5A 5IAOA 2JAXA 3DR5A 4NBSA 4F5EA 4YRMA 5KWJA 1QFXA 3KZMA 3QLUC 4QASA 1XEFA 2Q50A 2IEYA 2YN2A 1QJCA 3TK1A 5C7IO 2P65A 1BE0A 4EY7A 2OKGA 4GLOA 3RC9A 1ECFA 3GELA 3UGQA 5C80A 3JQBA 1TUBB 3OSUA 4RMGA 1U3WA 5GM2A 3G5LA 5IM5A 1CUYA 2O57A 3L93A 3NHFA 1PQYA 3PUZA 4WHMA 3TNDA 4Z1OA 2QTVA 4M7RA 3HA2A 4BVAA 4RDXA 3U37A 4L8LA 3THSA 2JGKA 2W2XA 3UG6A 2E18A 4O02B 4I55F 4LHXA 4BMXA 1QTRA 1SMKA 3UOGA 3GT4A 5AJXA 3LBIA 1T2DA 1MOPA 5IVDA 3ZY5A 1XBTA 4KXQA 5ALNA 2Q5FA 2AX3A 2F59A 1NUAA 3L7AA 3BULA 3JQRA 4U7HA 1ES9A 4O1IA 3VUEA 3ZW9A 2DTDA 4HZGA 5E1BA 2ADMA 3AKDA 4LI0A 4LXGA 3RWBA 4JYCA 5GJBA 3H5AA 4JJKA 2L69A 3WGKA 3OTOB 5EP4A 4EGQA 2H4YA 3WLFA 1DX6A 4KSBA 1K6EA 1QIKA 1MTOA 1A88A 2WFMA 1VKHA 4MIKA 2WHYA 1P77A 2O8BA 2B37A 1W88A 2DFPA 1IDOA 2HPAA 2OVBA 3AJAA 1GEEA 3DOUA 3NM6B 3OTWA 3VNSA 1KEZA 2ZREA 3C6QA 1V2HE 4XI9A 4OK6A 4LNHA 4EFMA 2VAPA 1QV6A 1DIBA 3GRRA 5IAGA 4TYNA 3TUIC 2FK7A 2YXEA 5JJIA 3K0EA 1IJFA 1WLSA 3NDPA 3CNEA 721PA 3H2ZA 3RF7A 4LTDA 3BWCA 4FKZA 2FXVA 3N2KA 3BE6A 4MW6A 4RW0A 5EI5A 2PUDA 1HYHA 3QA3E 3TTTA 5LYJB 2OBNA 1QO0A 1NR5A 2CXUA 2XCQA 3JWHA 3MINB 1I9CA 4LWOA 4UBJA 5JAHA 4OMDA 3QX3A 1CULC 2FPGB 3DBOB 1QOPB 1VJ1A 3IBGA 3HCFA 3EXG1 4M8LA 3U3OA 4YXWA 1Y48E 3VZPA 3ZLTA 4P33A 4CM1A 4HPJB 4TZ6A 3O8RA 3SQWA 1YZNA 2VTDA 4N0EA 2G0AA 3EAQA 4RTSA 1AJEA 2D2IA 3K5PA 2VAXA 3RCBA 3IE1A 1NMEA 4RO0A 3A2NA 2DUJA 3PKZA 2FWBA 3G0GA 4R2IA 4LQLA 3VV3A 3UENA 2QL5A 1ICIA 5A06A 2HSWA 1ORRA 3MWDA 1VG9B 3T7JA 2JW5A 2MYPA 1XD2B 5TPZD 3TRJA 4B5KA 5B57C 1ITZA 4WKPA 1A50B 2J9YB 3U4QB 4C6SA 1C3JA 3WV5A 2BRUA 4A0GA 1BS1A 3L07A 4OSPA 2Q41A 4DWJA 5KX5F 3HBFA 3P9XA 2GBLA 4HWRA 4DYVA 5AVJA 2JBAA 4D4MA 1KVRA 3C74A 1HZZC 2ZBDA 3P71T 4PGFA 1U8CB 1XTSA 3MXTA 1A7JA 2WJ4A 3OE4A 4GLJA 4LDAA 1GTSA 5A2QA 5KYYB 3H5WA 5T8KC 1V3UA 1B0UA 3FB1A 1FLVA 2W22A 2RH4A 4OM7A 3WKAA 4D92A 1COWA 4X1OA 2YWJA 3TQCA 1EIWA 3A7EA 1A96A 1NFQA 3ZDYB 4BNJA 2DG2A 4E32A 1LFAA 3O74A 4U2GA 2FZWA 1IN8A 4WN9B 1M7BA 1RXCA 5IT4A 1EE1A 2JCBA 3UUGA 3GDFA 1G1MA 1XX6A 2Y1FA 3MWFA 3NBMA 2VT2A 1VHTA 4JP8A 3LQ1A 4W82A 1G17A 1KDOA 2I2AA 4CMBA 3P7MA 1L5FA 4J43A 3TPZA 1E6MA 2BGJA 3R5FA 2GVDC 3KD3A 4BJ6A 3UHFA 4DRYA 1PJZA 1YE3A 4ISBA 4HJRA 1EJBA 1ID1A 2VDOB 1QHEA 2AJTA 3E7PA 4IBOA 4URVR 1JLHA 1ZLXA 3RVNA 2CHFA 2X23A 3NYWA 1RHMA 3GRCA 1ESEA 3X1ZA 4C22A 3OCCA 5DXFA 4F8EA 5FD8A 2WSSA 2PKQO 3R09A 3E23A 1WBBA 1K66A 1MX5A 1RKUA 1BD3A 1CQPA 4NOKA 2HMYB 5C4IA 4D02A 5I7WA 2PUAA 3O84A 2J7KA 2OG2A 1BS2A 1H0RA 1Q14A 4AICA 5JNLA 3IGFA 4MUNA 4P08A 1UWCA 4HO1X 4BNZA 2CVPA 4LY3A 5IZ4A 1UBGA 3ROZA 3GJ3A 2FQWA 4RJKA 1EP2B 1XYYA 4YV0A 4YAFA 1GNLA 4H3HB 5FRDA 5BVGB 3BWEA 2PEZA 1SCUA 3TVTA 4D3SA 2XZOA 1GL6A 2BLLA 2V3CC 1DC8A 4HDRA 2Y92A 2F62A 1U1FA 5DHUA 2ST1A 2CUTA 5CG1A 4GBJA 2IYZA 1DLJA 1YAHA 4GUAA 1NP3A 5SY6A 1OH8A 2NV2B 1GUAA 1QANA 2ZVQX 5DLQC 4ZT3A 3TH5A 4RDHA 3V42A 5C3MA 2OAP1 5EJ8A 5JVDF 1I3OA 3OOWA 3W5VA 4CMAA 4CU2A 5LM3A 2BY4A 4CM9A 4PRZA 4DSOA 5CYFA 3RVJA 1YBAA 3N0WA 3D1LA 1W93A 1JKXA 3OFND 2PGXA 2D7CA 1E3EA 1SKQA 2F17A 4IO1A 4JU9A 3ANYB 2VPZA 2E85A 4LZLA 3KTAB 3EXEB 4AJ1A 5LIPA 2B4AA 3KB2A 5K2MA 3W7AA 5KNCH 3GL9A 1E62A 3Q7TA 1P9NA 2X15A 1P1BA 2PL5A 3JR7A 5IK2A 2ZGVA 3PSHA 2BDTA 1WD5A 5ELLA 4KR7A 3CX3A 3MQ2A 1CUEA 2NTVA 4S1OA 1E1CA 2ROQA 4EKDA 2B2XA 3B89A 4JYAB 1P1KA 4IUCS 3DB2A 1EK6A 4IHJA 4KZPA 4LVOA 4LY9A 2ZRIA 2WIJA 4RZQA 5H16A 4EJ6A 1WP4A 4W7IA 1AMUA 3UPUA 2I4NA 2VP6A 1CEXA 3SFTA 4ZVLA 2V7EA 2Y9PB 3EGXB 3IHKA 1W34A 3GLGB 2C0PA 3KT3A 3SYRA 5COAA 5A7HA 3DOOA 3PXXA 4WCVA 5KDDA 4C08A 5D2CA 4OXXA 4JX9A 1EFTA 1ESMA 2HQOA 4Z9AA 1BJKA 3EA5A 4BWVA 1QMGA 4PN3A 2GD6A 3GLSA 4MHOA 4NABA 1T1SA 1Z07A 3DFIA 3JYQA 1JR4A 4DIKA 1G5TA 3PC8C 4DN6A 1RPTA 3LXRA 4NFHA 5BNTA 1XCMA 1HDZA 1YB2A 2PZJA 3P2YA 4G1VA 3AERA 4L0DA 2UVPB 2M6RA 5BWCA 3AIOA 5KYVA 1L5ZA 4OI4A 5B53A 4FFRA 3LYAA 3EVNA 1T9AA 2B3DA 2PG3A 2XPCA 3RVSA 1Z3IX 4DAEA 3N2GB 1CHDA 1T25A 2NZUG 3FF4A 2VP2A 2TMGA 3CNOA 3MF4A 3NEAA 4KTTE 5BR4A 1B74A 3K92A 4C4XA 2IPNA 1D8AA 1BMFD 3KL4A 2IUTA 4JITA 4N0MA 5FEMA 3GRVA 5ER9A 3VHXB 3ZU3A 3FTFA 2XUQA 1X92A 2JFHA 1ZUIA 3GNSA 2Q3CA 4M53A 5CIQA 1SCBA 2ARKA 4L5CA 5AK5A 3U60B 3LK6A 4R81A 1GLVA 2Y1CA 2NNWB 2RG7A 3E9RA 2AMYA 4WERA 3S44A 3Q7IA 3SCZA 1QWOA 3ZJ5A 1PV4A 1W96A 2D8AA 1YK0A 4AS3A 4EG0A 2VDPB 5JLAA 2FPOA 3HLKA 3ZBQA 3OFSA 1XNJA 1GARA 2GH1A 3CVJA 3MMXA 3X1DA 1HR0B 1PJCA 4JEMA 4MPJA 1J8QA 2A1IA 1PE0A 5AVOA 5IVKA 2OWDA 3NO4A 5F1OA 3GVIA 3TLEA 1II8A 3ZR4B 2W2KB 3DDOA 3T41A 5ALGA 2B7CA 4FB5A 2BFCB 1NI3A 4AZSA 3MTDA 1T5BA 5CT8A 3PUHA 1O95A 1SJ9A 2D5LA 2JHPA 2M6KA 3ZDAA 2OD2A 3AEQA 2CKDA 5JT1A 1R27A 2LDBA 4JJFA 1W6RA 2WQZA 2FZLA 5K8JB 4H35A 2N46A 1NW9B 2E4WA 2HN9A 3AEKB 3ONDA 1GRVA 1IY2A 1U2GA 2GCOB 2I62A 3HKBB 4KRYA 4CKBB 4LXIA 2VQ6A 4DIMA 3TLMA 4F46A 3HLTA 3K2QA 3LX4A 2IYLD 4W1SA 4HN2A 3HY4A 2AJLI 3BOSA 1CUGA 3EBLA 1I80A 2FFAA 4P1ZA 3DE4X 5ALPA 4CF6A 3GAFA 1UP6A 4Z7QB 3IB3A 2RKBA 4RSGA 1KBZA 2I7TA 3TRFA 1E7WA 2IP2A 3FHLA 1JQ5A 3T0FA 2H8GA 3KLOA 3RUCA 5BV1A 2E5FA 2HO4A 1CUAA 3G9TA 3I9FA 3MWEA 5CW2A 1YKSA 4FR5A 4H0NA 4J7UA 4ZOLF 1Y7PA 1TCUA 2ERCA 2RB4A 2O0KA 2MINB 3AOEA 2XD4A 3M81A 4MS4A 4AUNA 1A5AB 3LWDA 3K32A 4RMJA 1GM5A 1QC5B 5CX4A 2VWHA 3VMMA 5BP7A 1NJ1A 2FEOA 2X6QA 4LJAA 5IYZF 2YTZA 2LZ0A 1C3OB 3WNZA 1KO5A 4O0MA 5AHXA 1JWAB 3MWGA 4IV8A 4RBNA 2JRLA 3A1SA 4E09A 4V0ME 5KOIA 1B23P 5BQXA 2OXTA 2AXNA 2QVLA 1EUZA 1AV7A 2GBPA 3TOVA 2AYZA 2F1KA 3EZNA 2HRCA 4RCVA 1SU8A 1M34A 2LXNA 3GEPA 2ECKA 2C3UA 2QGFA 4H7IA 2PD6A 2AMLA 3KAJA 3A8TA 1E2KA 1AK1A 2UDPA 2QM0A 2QKYA 4WD3A 5ALJA 5IJ9B 2G08A 3T4UA 4CLDA 2YWXA 4BZZA 1GPBA 2QE7A 1C1XB 5AHOA 521PA 2CBZA 3V48A 3MJSA 2AFHE 4Y98A 2R00C 3OKFA 1UC4B 2O3UA 4HGNA 5BYAA 4OI0A 1GXSB 3IP7A 1UR5A 3K9CA 4AQYB 1MW8X 4YRIA 5A9RA 1RLJA 3RR2A 2JGRA 3ENVA 1W5TA 1KQOA 3UV7A 2V6JA 2R1ZA 3H75A 4GX5A 4UD2A 2JAPA 3R5JA 1DAOA 3UMBA 1F12A 1Z0DA 2PM8A 4G6ZA 4KAJA 3LG2A 4YPOA 3D7SA 4NYIQ 4RPJA 2C5GA 1AKEA 3W1EA 2HNBA 4G4JA 5EMNA 1NC3A 1RXWA 3QP9A 5DNVA 4F9FA 1S0UA 2F1OA 3C7KA 1TEHA 2R6CA 4FUQA 2APJA 3N7UA 4RY9A 1A72A 4DNXA 3KWMA 4K0KB 3UBTA 1QG4A 3B8HA 3FR8A 3LX6A 3BWMA 3QWFA 2V1XA 4XX0A 4ZU3A 1H2AS 1VSQA 1ECBA 2CLFB 4F93B 2QRMA 3GLGE 3BBPA 1X0VA 2XMDA 1H69A 3OH8A 4PBSA 3UK0A 1IHXA 4N5NA 3L02A 3EXHC 4K40A 3ELYA 4C5CA 2G83A 1UBMS 1THMA 4UREA 3ZGXA 1QMPA 3AU8A 3Q3HA 2QV0A 3WC4A 3PD1A 3FYCA 1SVKA 3ZS9A 5FI0B 3P9PA 3OTHA 5I6DA 1MG5A 3SMQA 1Y9DA 3H2JA 4FC7A 2VJNA 5K1ZA 4QEDA 3N5CA 3M3DA 3QKTA 4CGYA 2HDNB 1H94A 2XT9A 2HB6A 5KSPA 4CM4B 1LBTA 4XDHA 5K09A 5LUAA 3STTA 1SBCA 2BSAA 3RFFA 1P7YA 2QDXA 4CF7A 4QODA 2VN8A 4UBOA 5FXMA 1SOMA 1OF1A 4PZDA 1LW6E 1V25A 2IXBA 4L15A 5IJ0B 1OU4A 2FLVA 3BGWA 3LLCA 3NATA 1QH8A 4DUPA 3QKUA 1HQYE 1K8QA 1ZHFA 2WWHA 3CCBA 4MVXA 1DPGA 3TB6A 3G8CA 2NO4A 2REQB 1TQDA 3MTIA 1GKKA 1K0FA 5GONA 2OR3A 4U2KA 3OOJA 6NULA 1XZQA 5CBPA 1S3GA 1T8YA 2BFNA 3F3KA 1NIJA 3PQ7A 4NV0A 5E7QA 4TZTA 2DETA 3BXOA 2XDQB 4CPDA 6PFKA 5CM8B 4ZA2A 4JC0A 4UFNA 4DIDA 1Y0BA 2FG6C 5DGHA 3K9BA 1J2YA 3S40A 3DE1X 5BMOA 1ACMA 1OXMA 4B4DA 4Q4DA 4DPLA 1W5BA 3D59A 3EHEA 2R68A 4O2BF 2GERA 4H1WA 2PQ6A 3F5MA 3OESA 1A95A 1A9QA 1WU8A 3LFHA 4GPZA 2H59A 5DCLA 1FX0A 3G79A 5B7PA 1Z4IA 4XVCA 5CA1F 3AILA 4JLSA 1QBKC 2FZGA 2IYOA 2XTJA 5CK5A 3TSWA 5BR8B 2O1XA 3JARB 4CV3A 4ARIA 2RAPA 2ZQ5A 3RVMA 2OMKA 4BO5A 1PFWA 1QFZA 3DTVD 3L8YA 1CUUA 2XBUA 5I9MA 2Z3WA 5ILOA 3SHTA 1IWPB 1P60A 5JJ5A 4DDTA 1J9ZA 2W2LD 1GGNA 1U3FA 1KWGA 2JGEA 1XRNA 4IRXA 1VHLA 3UHPA 1KZGB 2P9CA 2Z04A 4EB6B 1FW8A 5SYMA 3CUUA 3PS9A 1TJ4A 3QYFA 4PZPA 3QKSB 3VYVA 4LF9B 1II0A 2RHWA 3LY9A 4HUQA 4INZA 4L16A 2GVZC 2J9RA 1Q16A 1FFHA 4XWAA 4UTPA 1ZCAA 3HDTA 4JA0A 1Z0AA 1U5AA 1QP7A 3B20A 2EIXA 2FUCA 3D4LA 4RGVA 1G8JA 1BMQA 1OXTA 2FPPB 2G82A 3LCMA 1NE7A 3PQ5A 4II2A 4MYTA 4WOPA 2QUZA 5DMXA 3FI9A 5FBLB 5B30A 3KWFA 2CV2A 1VHJA 3M6AA 3UMVA 2C5LA 1PT5A 1UMBA 4KQ1A 4BJ1A 2UUOA 3U7HB 3NHPA 3OVMA 3ESQA 4L75A 2IXDA 2BKEA 3FGOA 4JOQA 1ZRNA 1HRDA 4LZWA 2WOJA 4QLOA 4QLAA 2JAHA 4QBIA 4JC4A 3EYAA 4JBYA 4F2PA 1BS9A 4YACA 1IH8A 1X7XB 3GLQA 4N6OA 2CLMB 2E48A 1LS1A 4L74A 5AHKA 5LOVB 5TVKA 3OQVA 4PFSA 3T95A 2I34A 3I9KA 5LWHA 3FKSD 5K4AA 4A6XA 4J0GA 2I80A 3DW3X 2V3WA 3K2BA 2OO5C 2OQVA 3S5JA 1GFIA 2VRBA 2BEUB 3PXBA 4R1LA 3HK2A 4E2XA 3UW3A 1NW3A 2C2WA 3MG9A 3WS7A 3L6OO 3IVAA 4DARA 1TMYA 2FAXA 2XEDA 3QLTA 5LL6P 3GQVA 1T3TA 2VPIA 4EB0A 3FCCA 4PO9A 1MA0A 2VDWA 3N0RA 4GXQA 3ZVLA 1KEEA 3E6AA 4K6HA 4Q7KA 3K70B 2O8FA 1ENPA 5FWXB 5JCOC 2ON6A 1XVVA 2XE6A 4NV1A 5JCXA 4M0CA 1U7ZA 4KQKA 4DA7A 4KITB 4KB5A 4GPD1 2C2HA 1MXFA 3JPYA 3MFYA 4LKOA 4BNNA 3IO5A 5EUCA 3V1LA 3AFMA 4BJHB 3DBLB 2PX3A 1NLMA 5DM60 2FG7C 4M1MA 4XGNA 2B4TO 4YMGA 1WDKA 1ZUWA 3WADA 1YB6A 3K30A 2RHJA 3A26A 5C1PA 1W8IA 3K8OE 4LJ4A 1W4BA 3MT9A 3QG1A 3WAJA 2XCSB 2C5EA 2LNDA 1WTAA 3X1KA 4C0XA 3C6KA 4CLOA 5JMWA 4NU0A 1YBVA 2NM0A 4LY6A 2C58A 3D0RA 4OQXA 5EXTA 5L3RA 4BE9A 4CEIB 5F2KA 1Y3BE 5CFZA 2VJKA 1R4MB 3CO0S 3WGJA 1ZHOA 2AEEA 2ZRFA 3K6SA 4NCBA 3OQ6A 4LZOA 1WSWA 1I6LA 4P9NA 5EIBC 5IC4A 1SC9A 4KRFA 2I33A 3T99A 3M5WA 4LPKA 4MUJA 1G7RA 3L1UA 1Y6GA 1WA5A 2OQRA 3TECE 2H1VA 3ADPA 4ZC8A 3B5IA 3QE3A 5C7OO 1N33B 5DT9A 2HHJA 3RWMB 3W3ZB 1L9KA 1E9BA 4YR9A 1RYHA 1UBHS 5L9AA 2FB9A 1JR3D 4FT2A 4YQEA 1DZIA 3TZCA 4FQ7A 4A23A 2J48A 1O0CA 3QPWA 4R8SA 1VPTA 4BNMA 1XJ5A 4KXYA 5L51A 3UB2A 2J3KA 5FUQA 1I4OA 4LCEA 3U17A 1MJNA 3WL4A 5GIOE 4MUYA 3L1HA 5G3ZA 2NU9A 4KNWA 1EWTA 3VI3B 3VR2D 5F2NA 5G1PA 3S8EA 1KF0A 4KO4S 4NCJA 1QGED 4PYRA 4PBTA 3B82A 3KDAA 4J0QA 1HORA 1V43A 2FW7A 3ZBTA 2B78A 5LQKA 2P69A 3JTMA 5FI1B 5ED0A 2DKFA 4J03A 2F2TA 4OQYA 4ENPA 3GLHE 1J06A 4EHFA 1AUPA 1T9BA 3F46A 5A1TA 3VRHA 3AL3A 2HEGA 4D9CA 5LLDA 4BJ3A 4BV3A 1RAAA 4NP6A 1BRMA 2BFEB 1VE5A 4DANA 2JJ2A 5IBQA 1U81A 1JDZA 3E81A 3DDZX 3QLEA 4FFSA 4FFWA 3PYMA 4F60A 4F97A 1BXGB 2P3OA 1R6DA 5AYVA 5DYYA 3CR7A 1I2BA 3GVPA 2K6GA 2ZT7A 3RSGA 3SJZA 3BD9A 3EDOA 1T36B 2ZIXB 1EWVA 3OE1A 1V7CA 3W3AD 3W2FA 5HUHA 3IAS6 1PNOA 1IG0A 2IHZA 5AKJA 3PGLA 3WFJA 3WLRA 2NADA 3BMOB 4A8JC 3JAWB 4MKGA 1UH5A 2ECOA 1KIAA 4YQYA 3B9RA 4C4PA 4C20A 4HXGA 1S1MA 1KVUA 2H7YA 4KX5A 1EVYA 2QRJA 3NIBA 4DZTA 4FYHA 5ECWA 3A9UA 3H42B 4I4NA 5DHRA 2BHNA 3RTEA 1ZM2A 3UG7A 4ZOAA 4I1PA 4LVCA 3HHEA 1D8TA 2VRNA 3AUXA 5LNK1 4OVKA 1OGYA 1K27A 3GFGA 3SXUB 1YL5A 2V9PA 2ATXA 3RSCA 1WPRA 2QXYA 1JDPA 1NN3A 4NQZA 4AO8A 1GPJA 2XHEA 2D3TA 1G2PA 2BC9A 4B6QA 5EHXA 1C2TA 3IKTA 5FR2A 3WLJA 5CPFA 1H8HA 2YWRA 2FGJA 3C24A 1NASA 2HFKA 1M6NA 4HWSA 1OROA 2Q2WA 4TROA 4WXYB 3AHDA 5LYJA 2PVCA 4DIUA 2CZGA 4PYLA 5KYTA 1I24A 1SHLA 2CEKA 4EJ0A 1NMQA 3MINA 1R6TA 1YOVA 2PLWA 4LHWA 5KWEA 2FPGA 3K0CA 2RGUA 3BWYA 3L7CA 1K4MA 3O4GA 2QGZA 3PHHA 5BRAA 5HJEA 3T9FA 4JCCA 5ALVA 1D03A 2W98A 1KJYA 4LJ8A 1AGXA 3D43A 3QMMA 1EI9A 4G84A 1U5BB 2WG0A 4GMGA 1Z38A 2Y27A 4C5BA 1AB6A 3OX2A 2REOA 3QVTA 4ZCQA 4Z4HA 2G80A 3ZDEA 1LK0A 1ZIYA 4QPDA 3AHFA 3IUMA 1UT5A 3CSUA 2J6IA 3C7CB 1TKAA 3KLNA 1XD2A 3O90A 2IHTA 3HJBA 3OIDA 3GJYA 4WNAB 5LZ7A 3U4QA 5B55A 1LBQA 1O5OA 1WTCA 1WHTB 3DC2A 3E3MA 4MV6A 3QFSA 4J1TA 3VO9A 2ZEJA 3BQNB 4DDKA 2AK3A 3PGA1 2FEPA 4EVRA 3UB3A 4YIHA 1WCXA 2MCFA 1GWNA 1MF7A 4W8GA 2BIFA 3QU4A 3GYBA 3T4XA 3WWYA 2WSLA 5BV0A 5KYYA 2G7ZA 2HLDA 5I7SA 2C7BA 2JK0A 2QTGA 3OZ7A 4KLAA 4UTOA 3W0LB 4CMHA 2NW6A 1LB1B 3IRUA 4BMYA 1JG7A 1Q0ZA 4EUEA 3U3XA 3ISJA 1J97A 2A88A 4WN9A 2VP3A 3HABA 4WBNA 3VC2A 5KQRA 4XWWA 1EFPB 5SY9A 1IM2A 1KS9A 4W9NA 1WUIS 2JLZA 2ZCVA 3E15A 2MSEB 2OV3A 2OWEA 1I7PA 2CKMA 2W58A 4REQA 6Q21A 1G8KA 2I03A 3G0BA 1OPRA 2A2ZA 2L42A 3LYHA 2KHZA 5JG7A 1G5IA 1SBNE 3N2ZB 1KDVA 1G7TA 3IAAA 4DREA 5FTJA 2C4HA 3R9XB 3Q7QA 3AP3A 3CPSA 1HNZB 2DPXA 4Y9DA 4UEKA 4R2HA 4IUYA 4IIBA 3O93A 4NBRA 5CGZA 4EFLA 5J4KA 4S1PA 1F06A 1A97A 4YLGA 3RU3A 1MIOB 2YHBA 4WACA 3OLYA 1S01A 1KA9H 1Z5UA 2AJBA 2P9EA 1P81A 3AHIA 4C21A 4GLBA 2W2VA 2CHVA 4MGHA 4W1PA 3T8YA 2HTFA 5EJIA 1N2GA 4RGQA 1AF4A 3A0UA 4ETWA 5B1IA 4RAQA 5DGIA 4EMTA 1R0YA 4LJSA 3TSAA 1ENOA 1GD1O 1KVSA 1PJ3A 1N8NA 2IBMA 3BHMA 2CDAA 3OMLA 4IY1A 1AHPA 3LVRE 1GGVA 3B85A 1JTEA 2JFYA 2COEA 4HXEB 2IHKA 3RYTC 3QPVA 5CB4F 1OFIA 2GK7A 2XB4A 3KQNA 5LQMA 5GOZA 3CRRA 1EK5A 1S5PA 3RYHB 3VDXA 2VPTA 5I45A 2O59A 3AYXB 1X2EA 3GT3A 1JZQA 1NX6A 2LKCA 3GDGA 3TVDA 3ZHOA 1H05A 2OHFA 2YFHA 3PFFA 5GIPE 1N6RA 2H5IA 2JG3A 3SNKA 4QFDA 2VJBA 3EIXA 5COBA 4ZALA 1OYVA 4G1EB 2Q3FA 1QQ6A 1KZ7B 1RJGA 3BSWA 3V4ZA 1F1JA 3AR7A 3K9LA 4L5AA 4RQUA 3REGA 4S3MA 3U5TA 3EXEA 4QYWA 2IYQA 4JQZA 2OAEA 4XZ3A 4EA9A 4EW3A 3IPYA 3IS3A 4Q4HB 3TQQA 2C0CA 1IY0A 3B9PA 4YAJA 3VBCA 2AF4C 5ADWA 5A3QA 4K03A 4UMFA 3QI7A 1NFFA 1LA2A 2QAGB 4NH4A 3FMPB 3T54A 2CFSA 3LMKA 4QELA 1E9CA 1UIRA 5JJLA 4N0DA 3N2LA 2GJ9A 3SKVA 4X66B 3DMNA 4ZVKA 1NAIA 2DR0A 2O2ZA 3OO1A 4PX2A 3KTFA 4U7FA 5J40A 1PSDA 1DC5A 2IOHA 2JCVA 1D9XA 4QDTA 4B35A 1OH6A 2OBLA 1Z7WA 4FDMA 1HDYA 2LV8A 3EGXA 3Q0EA 5FBRB 1H1LA 2P11A 3KAPA 3ASYA 4P7KA 1UJ2A 1THTA 1ZAKA 2OYSA 5DCYA 4DCCA 1UUFA 1R10A 2VNJA 3IOEA 2P91A 1Z5ZA 4QG7A 3UPDA 1I5OA 4LC1A 5EHGA 5G0WA 5H02A 4JXXA 4UFOA 3OZRA 3RS4A 4ALIA 1H85A 3TM4A 2H2AA 1QRSA 1NRIA 1VL0A 1J5PA 4M1WA 4FBGA 1TQ4A 3AFGA 1RP7A 2UVPA 5C8YB 1Q83A 1P33A 2IZ0A 4KPEC 5LMZA 2HV9A 4MA0A 4OGWA 4DB4A 1B8UA 3WIBA 3C6YA 1C0KA 3OC0A 3BIWA 3EUFA 3OM1A 3N2GA 2FJUA 3OC6A 1RQ7A 4JLVA 4KPFC 3SVZA 4HFMA 1CR2A 3IOCA 4H08A 5ILQA 3KBOA 2MMCA 2VNIA 4UHFA 3IELA 5FLXA 2BFWA 2PUWA 5DOVA 4OUDB 2MR6A 5E4JA 5JQGA 2PDAA 1SC3A 4R2MA 3GRZA 4QTTB 2OOKA 2I4LA 4WZZA 1G18A 2M1ZA 3MQ4A 1Z12A 4RA6B 1E9SA 1PWZA 1T6YA 2EQ5A 2PSFA 3F7TA 3PIDA 4EYOA 1EDDA 3Q0IA 3FCXA 5F76A 4AW9A 5BUZA 2ZUSA 3L0IB 3ISVA 1JU3A 3I1JA 3JD0A 5HQ3B 2UYHA 3T3DA 3E4DA 3JS5A 3B51X 3UQYS 5A71A 3X1XA 1VE7A 4WCFB 4ZI5A 4D4HA 2IH4A 3L7KA 4GPBA 4V0NA 1XNHA 4LW8A 4C6HA 5BNFA 2KS6A 2ZIFA 5T4FA 4RZ2A 5ADVA 1Y3DE 1EUDA 5FHQA 4L95C 5BWMA 4I3HA 1QDEA 4EFNA 1N7IA 2BFCA 4ERXA 2YZNA 1NSFA 2CY0A 2QU7A 3LUBA 4LWQA 3G6WA 1NKTA 1MX1A 121PA 1RXSA 1F8YA 4Q18A 5DM4A 2O2XA 3RB8A 4O2LA 5GMOA 1QZ3A 4RGBA 4OKNA 3V8MA 2NZXA 2I4OA 1IN5A 1T8RA 1UPCA 4M8SA 1VG8A 3IV6A 2A8YA 4NYJQ 2ONKA 1AKWA 3AEKA 4PFQA 3VU3A 3DBHB 3P4XA 2GCOA 1SEVA 3HKBA 3CB2A 5HYVA 3P9NA 3VDRA 1HTBA 5E2BA 1XHFA 3JZMA 1Q2XA 4CEHB 4HNVA 2K2QB 3DMGA 2P7IA 4GR5A 3Q1KA 4OAOA 1NE2A 4OLHA 1GNRA 1MJFA 4INJA 4UCFA 5A6VA 1CS0A 3B1WA 2VDQB 1GCGA 1O4WA 2VO1A 4HH3C 4LJ9A 1OWOA 3KNZA 1E1LA 2NUPB 3ND7A 4KE6A 4HLDA 3V8RA 1ODCA 1KKUA 4OFZA 5JQWA 1B4DA 3MJTA 2FR8C 4LDJA 1YHZA 5KYKA 1FVXA 3U40A 3ZS8A 3UJHA 5BSHA 1E7RA 1FJ2A 2VYNA 1KI7A 1YMVA 2FDRA 2OY0A 4I5GA 4A2WA 5B4TA 4HLQB 3H1PA 4RK4A 4RKRA 3VH1A 1B6TA 3O1IC 3ZGLA 3B8EA 1YC5A 4WNCA 2MINA 1X9HA 4TMVA 2HSDA 3CVOA 2QMOA 4YECA 3OQMA 4HP8A 1TECE 4IVNA 5EJ7A 1QC5A 2FDXA 3MT8A 5A3SA 1FEZA 2WTUA 4N8EA 2G0TA 5I51A 5ALFA 5HE9A 4MQMA 1C3OA 3V4RA 1SBQA 5DHQA 1NI4B 2HA4A 2H1SA 2IUFA 4BL5A 2GA9A 2QG9A 4II3A 4AZVA 3C2QA 1QAMA 1QH1B 3AIKA 1YF3A 1T10A 2BM9A 3W9BA 2C61A 1DBQA 3YASA 1NXOA 3LU1A 1T3GA 4EF6A 4P0QB 2HMVA 2XW6A 5HE8A 1H2XA 1SRQA 3EC2A 4G97A 1N4DA 4OF4A 4RKQA 3RO7A 2GCNA 5T64A 4E07A 2XE7A 3D64A 2BFPA 4O5OA 1NVKA 3W6NA 1C1XA 3CF4A 1OYWA 1SVOA 3L4BA 3NIDB 3EEIA 4P58A 1HBJA 5TY0A 5A4KA 1Z6GA 3PHJA 1GXSA 2DPHA 1TI7A 1Y5NA 2P9ZA 3UXHA 3E70C 4KQMA 2JGLA 1DOZA 2PCJA 4ZODA 4MV7A 4NS4A 4TMZA 3WRYA 4I36A 4CL8A 4LYEA 5J43A 3RJTA 2DWCA 4ZYWA 5KC9A 1E1NA 4E2FA 1VJDA 2HPHA 5CPBA 3LSTA 3OQJA 1FFBA 2RC6A 3MB8A 1ZXBA 1RS0A 3CZCA 4LXYA 4WX2B 2PTGA 2JVIA 4NVRA 4RNCA 2P2SA 4B45A 2VTBB 3WQRA 2Y2UA 2J0VA 3QTBA 1Q77A 3W77A 5JV5A 5KNDD 3PYXA 1RZ3A 3AJ8A 1QFSA 4FYXA 3VAAA 4B4KA 4DA0A 3ILSA 3LQ2A 3M3HA 1FCJA 1ULZA 3ZLVA 1GOTA 4P7FA 4G8DA 3U1TA 2O2JA 4TYYA 1OZ0A 2OD9A 4FYWA 1ODFA 1NLUA 1NY6A 2O06A 2VYFA 3T9CA 4EYEA 1C5KA 2J09A 3R1IA 2WWYA 1LNQA 1ZMTA 3A6ZA 4ZYUA 2O5VA 2ZIGA 3SDZA 4C0SA 5DASA 1EVKA 4NCAA 3CPEA 4BKPA 1GPLA 5D5PA 3ITNA 3H16A 5J2TB 1DQNA 3FIUA 1GP2A 1ORWA 2EF1A 3I92A 3LUDA 4KO1S 4MPPA 5FTWA 4E4TA 2Z6AA 4Z8YA 3HCWA 4WGGA 3VPDA 2Q4RA 3O31A 1CY8A 4MZXA 1PKEA 1ZOLA 3I76A 3EPLA 4HFRA 4UNRA 4TLAA 1V96A 2AD1A 3R8XA 3CINA 2YFQA 1LI5A 3SIPA 4YCMA 5IJ0A 3ZE8A 5MFPA 3C1OA 2HWYA 4RVDA 2PUJA 2QYHA 4ZRDA 4B1FA 5AM3A 4TVOA 2ZCJA 4TYMA 1B2RA 4B3RB 4JN6B 3HP4A 4OSOA 3H9GA 1O0SA 2REQA 1NIPA 1XA0A 2G5PA 4Q4JB 4Y7DA 3TOCA 2Z5VA 3WB2A 3JQ8A 3FFBA 4IKEA 2VBFA 2VF8A 4JYZA 1M10A 2CXTA 2HBRA 2OXCA 2XDQA 3TW4A 3FOZA 4IXMA 4XJSA 1E3MA 3KDPA 2QAIA 1HY3A 2E21A 3IR5A 1VG0B 4GP6A 1ND5A 4HEA1 3WKCA 4X3PA 1H42A 1AS2A 3R7BA 1BVYF 4Z49A 3OETA 4GZ6A 3HWWA 4EI9A 2D5CA 4JT9A 1TCBA 2I3GA 2I3BA 4Q01A 5DF1A 1N34B 2X7HA 3VSAA 4U7TB 3FG9A 4MI6A 4L4SA 3WLIA 2JEZA 1L8AA 3IESA 3N6RA 2JLQA 1PD0A 3KJXA 4H1UA 4D56A 1S2IA 4JJ7A 3GQBA 5FOTA 5D3QA 4UHHA 3L6UA 4GPTA 4MTCA 4Q3NA 4L9SA 2PD3A 3EMVA 1USKA 2EP5A 3FB4A 2EKPA 3LVFO 4JLMA 2CBXA 3REFA 4YJ3B 3ESXA 1E0KA 1LU9A 2BOVA 2Q4TA 2XOEA 1DMRA 2Z9DA 1E2JA 2ZWOA 3DEAA 3JWIA 5JYDA 4TPKA 4R84A 3QKSA 4I2NA 4IDQA 2F48A 3HFRA 2C7OA 3WL3A 2PU7A 2QVZX 2WSMA 3PEFA 1M8FA 3BRSA 4IS2A 4I8IA 4LNAA 4EDHA 3AM5A 4JMLA 3L46A 2WA2A 2VFAA 3OOEA 2P5UA 3JQ7B 2FPPA 4LYFA 4I1OA 2QRVB 2QR5A 4KU4A 3T52A 4X1YA 5AXDA 2AFIB 2EZUA 1N0UA 1GZ6A 3WK9A 5JSZB 2ZYIA 1Z0KA 4PQGA 4HKTA 5BSEA 3U6BA 5LDHA 4RULA 5MN6A 4Q39A 2G9UA 2M6SA 4Y6OA 5L45A 1YH3A 1GPUA 1K8RA 2DCMA 2HIMA 3QVVA 1NLZA 5JPCA 2PZKA 1X7XA 2VCHA 1HOXA 1ZQ1A 3CLTD 3EIWA 4F1WA 4LG1A 2HIGA 5LOVA 3HV2A 1PQUA 1VIDA 2NSHA 4HVTA 4R5HA 3JRNA 2Q07A 1PIWA 4YMLA 2WILA 4PC2A 4EL0A 3EH1A 3MT7A 1V1RA 3AQ4A 3DM5A 4IF6A 4M0LA 1FX1A 3RIXA 4Z9FA 1OH7A 2EJWA 1MC1A 3D4IA 4HH4A 2BEUA 4OHCA 2HU2A 2GEBA 4ECAA 2UV8A 3RYCB 2Y0EA 1AVTA 1YVUA 2XUDA 5G1NA 5ARBA 3P0HA 2R7KA 3U61B 4KWIA 5ERXA 2B94A 5EA2A 2VDNB 1SG0A 4UC0A 5AUPB 1AG9A 2FQQA 3FPHA 1ZEJA 4IOLA 1GY8A 2AC7A 3AVPA 1P7VA 2Q8QA 1YRHA 3IHTA 3UICA 4BVHA 5LFAA 3FUWA 2P4EA 3MLBA 2G4VA 1PTJC 4KYIB 4AP5A 2PRZA 2PMEA 4AL4A 1TYBE 2ZBRA 3UIEA 1GG2A 4X90A 3SX2A 3DBLA 4MMYB 1SHTX 1JEYA 2WB2A 3PB3A 4MDHA 3KOYA 4OBXA 5ALXA 4OXQA 1SOAA 4ZHQB 3LYLA 3OD1A 4CL3A 4EJ2A 3OU7A 3U9TA 3GROA 1C1YA 1TQ2A 4EAAA 3LAWA 3ONWA 2AEFA 3FUUA 1OVMA 3T1VA 4C7KA 4RM3A 1KZYC 1XLTA 7AT1A 2KBFA 3DD5A 4XASA 5CJPA 1SU6A 2GK4A 4QU0A 5CIYA 3OEEA 1EGHA 1R4MA 1XF1A 1HKUA 2BF4A 2P4SA 3AHJA 2P41A 3II6X 3ONEA 4QNRA 4RL4A 1CY6A 3B2EA 1FA9A 4H6XA 1ZGHA 4GZ5A 4Q93A 4YRLA 3EK2A 3PPWA 3WGZA 4F9TA 2GXAA 1E3TA 1QYVA 2EYQA 1H8EA 1JJFA 1KIMA 3DKIA 3NJ8A 2WVJA 4N3GA 2MSDB 2PCLA 1N6PA 2QVYX 3HJAA 4YMVA 5IJWA 2DY0A 1CIPA 5I8ZA 3G2MA 5KWVA 3L7NA 1OMOA 1FFSA 5IABA 1SUPA 3J80A 4FGKA 1IDN1 1ST2A 2YR0A 3HJUA 3HXLA 1EQ2A 1TW3A 3G13A 4PPNA 3VO8A 1Q0PA 2X4IA 4HNAB 4NZPA 3LQFA 3GUZA 1U2QA 1KZ9A 5FUMA 1SULA 5J47A 3TN7A 5LP6C 1YU9A 1MJHA 3R7FA 1A69A 4EA7A 4QFMA 1PDOA 3HU1A 4HAUA 4OV6B 2XVXA 1NURA 4HBGA 2DEUA 3LDAA 2J9ZB 1T6ZA 4FOPA 4JBWA 3EC7A 3COSA 1NLYA 4UEQA 2YYZA 4DCUA 3AB3A 4NZZA 5KMGB 2VSXA 2QD1A 4D0LB 4XVHA 1QBGA 3C5WP 3FCEA 3OZBA 3LFTA 4EPYA 3ZK7A 2OLJA 2CVFA 3VOBA 2QI9C 4W7HA 5K0BA 1NM5A 4KV9A 1JJ7A 3GRFA 3NWOA 3ZHZA 3USCS 1ZEMA 3AKZA 2C57A 4XIFA 1NKSA 2M1XA 3IAUA 2VR1A 4LOKA 5AK4A 2BFEA 4HTFB 1Q0TA 1CQJA 2EGHA 5NULA 5DP2A 2YRFA 5AK6A 5JU6A 4N76A 1YXMA 3EWNA 1VJRA 1BXGA 3V8NA 3EMDA 3JWEA 2HSZA 5KHLB 1JL3A 5JRZA 2VHJA 1AZWA 1KJQA 5FULA 2NZVG 1L8LA 1EZ4A 5F35A 3FZGA 1FP1D 3LPAA 5FA6A 2ZIXA 1YS7A 4OLAA 1XKXA 3BJEA 1UBTS 2G9NA 3IV7A 3G5UA 2YNMD 3L0DA 2WYOA 2GKOA 3BMOA 3JAWA 2ATEA 2PMCA 3JALB 1NVEA 2DFVA 2Q1YA 3T5AA 1JN0A 3B6IA 3ENZA 2E7ZA 4R05A 4M60A 4XDZA 1PUXA 3M6MD 2YICA 2C9DA 2NUTB 2WTNA 3EQ2A 2C4TA 5H7XA 4AS2A 2W4IA 3KLBA 4HB3A 1B26A 4E2ZA 5FNZA 1S8OA 3OIWA 2IPMA 4G1CA 1VMDA 3FVWA 5BSMA 4HAZA 4B3MB 1E63A 4O4IA 2QA5A 4Y1GA 4HUJA 2WJ3A 3SXUA 2QROA 3GEHA 3CWQA 4BAGA 3OEWA 1N8KA 2UAGA 4OL9A 3T4PA 2YY7A 2BGWA 4PVDA 2VLIA 1D2MA 1HDIA 2HPVA 3NHWA 2F3TA 4OYRA 4QYIB 4XXHA 4YUYA 2X8AA 3DMTC 3AVVA 2FWNA 1NW7A 4O4LF 4CYMA 1VI6A 4RM2A 5M34A 5I9BA 4Z7NB 4DIBA 3KB8A 3EG9A 4PQEA 1SKUA 5JZBA 2GT1A 5CXSA 3KWLA 1Z63A 3R0ZA 1O96B 2AH5A 4OOFA 1TU4A 3D6VA 3BCHA 3AVOA 5HIAA 4FQ8A 1RBQA 2GA8A 2V6IA 4H7EA 4NU8X 3SYNA 3TLYA 4OHFA 4A8HA 5KO2A 3IBTA 1ZJWA 2GB4A 1ORVA 1U5BA 2WJZB 3PHBE 4XUCA 3EVZA 3A0RB 4PINA 1MP0A 4QJ3A 4L5IA 1ZXLA 4MEJA 3EF3A 2XCUA 3AU9A 4YV2A 2COUA 2QQ0A 4WNAA 4QGSA 4ZVPA 1WMFA 2GZAA 4MUEA 5H0IA 1OLSB 3ICQB 3WMGA 5HILA 1RWNA 4RF5A 3ANTA 1J70A 1RMTA 2GN2A 1WHTA 3KYJB 3NVAA 4FGUA 3SHFA 4C4AA 2AR9A 2NSLA 4UDXX 1CR1A 4CIYA 4UHEA 3DAOA 5SV2A 2BD0A 2AVNA 2V65A 4N4AA 4C29A 2PZBA 4RZIA 4NX2A 3M4JA 5BW5A 1WB5A 3DZDA 2X9LA 3BJZA 3C8ZA 4IJVA 4FCVA 1QHXA 4M89A 4Z0HO 2O5EA 1Q6ZA 1CF2O 2G36A 1E6KA 5AKXA 2H57A 3P26A 4ZEVA 2CXHA 4QYMA 2WZQA 1Y1RA 5DTEA 1EGAA 1U3DA 2XYGA 2B99A 1BMDA 2JNWA 2H3HA 3Q10A 1UFVA 2RHTA 3H97A 4X6XA 2CXQA 3UY4A 1PF7E 3T34A 1TAHA 2NPIA 3RV4A 4EIWA 4F6LA 4YIKA 1ZVMA 3B1FA 1TJPB 3HFSA 4J7AA 4R8MA 3FOWA 4CR8A 4W5OA 1XRMA 1TVEA 2G7MC 2OHHA 3JQFA 4P34A 1BEUB 1XQ1A 1NOIA 4C87A 3R0IA 1YA8A 1UJNA 4E5SA 3HBAA 4M54A 5KQGA 2QG6A 2HNKA 4BMZA 3GFQA 4Q9AA 1KE1A 3PDJA 2KPOA 1M67A 2D6FA 3KQPA 4LVNA 4NBTA 1USGA 2VYVA 1G8YA 4IZIA 3ZWQA 5J1TB