4OVTA

Crystal structure of a trap periplasmic solute binding protein from ochrobacterium anthropi (oant_3902), target efi-510153, with bound l-fuconate
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
301
structure length
301
Chain Sequence
ANVSIKVAYENNPGEPFDEVMHYWKDDLAKRSNGEITLELYPSSQLGSKKDVTEQAMMGLNVVTISDVGFLAEYDPDLGVLYGPFLTDDPAQLFKVYDGPWFKEKSEELKKKGIHIVMPNYLYGIRQIISKKPIRTPEDLKGMKIRVPNNVMQIKTFEAMGATPTPMPLGETFPALAQGVIDGVENPISVLYGQKFQEEAKYLSKVGYLTNVALIVGGEAFFSTLPEDQLKMIHESAYDAGLYSQKLTIEKDNEMIEKMKEAGVEIIDVDRAPFKALAEKVYTQFPEWSPGLYDKIKAELN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Experimental strategies for functional annotation and metabolism discovery: targeted screening of solute binding proteins and unbiased panning of metabolomes.
pubmed doi rcsb
source organism Ochrobactrum anthropi
molecule tags Solute-binding protein
molecule keywords TRAP dicarboxylate transporter, DctP subunit
total genus 102
structure length 301
sequence length 301
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03480 DctP Bacterial extracellular solute-binding protein, family 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 4ovtA00
4O8MA 4X8RA 2WX9A 4PGPA 2WYKA 4XEQA 4PBHA 4NN3A 4OANA 2PFZA 2VPOA 4PDDA 2VPNA 4P1LA 4P3LA 4MAGA 4N8YA 2WYPA 2PFYA 4N91A 2ZZWA 4PE3A 4PDHA 2HPGA 4DI3D 4P1EA 4MHFA 4MX6A 5LTCA 4NGUA 4PFBA 4PAFA 4P8BA 4PAKA 4P47A 4DI4B 2ZZVA 5IM2A 2XWVA 4P9KA 2HZLA 4MIJA 4N17A 5IGAA 4N6KA 4OVSA 4PFIA 5CM6A 3U65A 4MNPA 2HZKA 3B50A 4O7MA 2XA5A 2ZZXA 4LN5A 4OVPA 4OA4A 4N4UA 4MEVA 4N15A 2XWOA 4PETA 4OVTA 4PAIA 4PF8A 4MCOA 4O94A 2XWKA 4OVQA 4UABA 4PF6A 4N6DA 4PC9A 5IZZA 4XF5A 4NX1A 4PFRA 4YZZA 4NF0A 4PBQA 2XWIA 4NHBA 5I7IA 4NAPA 4MMPA 2V4CA 3FXBA 4YICA 4X04A 4NG7A 4XFEA 5I5PA 2XXKA 4NQ8A 2CEYA 4MNCA 4MNIA 4N8GA 4PCDA 4OVRA 3GYYA 2CEXA 4P56A 4PGNA
chains in the Genus database with same CATH superfamily
3ZKKA 3C33A 4ELPA 4POXA 4EF2A 4PGPA 1N7WA 4WKMA 2DE2A 2VPNA 4I40A 4ISUA 4OEVA 4U21A 4G4PA 3D4GA 5IZ1A 2UYFA 5ESYA 1JNFA 4ZS9A 5H8HB 3KG2A 2XXWA 1VFEA 4F3GA 2QMWA 2IEEA 5L8DA 3PU5A 4KHZE 5KCJA 4F1YA 4IGRA 1JQFA 1YZ0A 4EDPA 1NV0A 2RF1A 4N6PA 1XOCA 4DI4B 4OFOA 3G3FA 1B0HA 2A5TB 1B4ZA 4LVQA 2OWTA 2F3BA 2PMSA 3PD9A 5CM6A 2FYIA 2PVUA 4KPTA 4MNPA 1IMCA 4PQJA 2PYYA 1YPNA 3TZAA 4O7MA 3P7IA 5AA2D 3PMWA 1A8EA 1OVBA 1S9TA 4OVTA 5CI5A 4QFPA 1US4A 3TCFA 2RCBA 3MZ1A 4GL8A 3T22A 3OXNA 5CMMA 3R7XA 4NF0A 1Y3PA 4R6YA 5KDTB 4XIGQ 2V4CA 3FXBA 3THIA 5CRYA 3LR1A 3GLBA 1OQHA 4NQ8A 3FVOA 3I5OA 4GVOA 2QS4A 2CZLA 3H03A 3MZ9A 5AA3A 3O6HA 1BP5A 5CBSA 4FEBA 4LONB 3OSQA 3VXBA 1FQDA 1JVXA 1JEVA 3MPLA 4NF6B 2I0CA 1FPLA 1JW4A 3N5LA 1MXVA 4PFTA 2REGA 2W7YA 1KZ8A 3N6UA 2OJTA 2F7BA 3KOTA 3KSJA 2HPGA 3NOHA 1QUKA 4I3EA 3K2DA 3IFAA 1FQEA 3QYTA 3RT6B 1FW0A 3SEVA 4OEUA 4RK2A 3ILTB 5CMBA 3N94A 1ZBMA 1SI1A 1NUYA 2ZZVA 5KDTA 4JSOA 1YTVA 3M3LA 1Z7NE 3HHFA 4QF9A 4GBWA 1UTHA 4N6KA 1USYE 4TQUQ 1SDXA 2PX1A 3QUJA 2ZXTA 3ZSFA 4ELRA 3B6TA 1POTA 4R9FA 5I57A 4N13A 4YB7A 3O2AA 3H3GA 2Y7RA 3T9VA 1QULA 3IJOB 3OO9A 1LFIA 1JEUA 3FD3A 4HE1A 1XVXA 4F3SA 2PCRA 3QSLA 4C1TA 1P1NA 4P0GA 4JWOA 4O7IA 3MJNA 3BFTA 3UN6A 4MH5A 1IMEA 4MMPA 1PDAA 4OERA 2NWJA 4PTKA 1FPJA 2ZYMA 1LCTA 4BDLA 1S7YA 3F11A 3UK4A 1MH4A 3KSXA 4FAJA 1JVYA 3K6XA 5DT6A 1RKMA 2CMOA 3TDJA 2QJEA 2Q89A 1PBQA 4EXKA 1DCUA 1EYIA 1NUXA 3H6VA 4YB6A 5CC2A 3ISPA 3TODA 3IOTA 3PPPA 2QVRA 4PBHA 4IO7A 1AH5A 3E78A 4GWUA 4LA9A 3TTLA 1NH8A 4P3LA 5DVJA 1BTJA 2HXRA 3W15C 3G3IA 3RTFB 1SD3A 2PT1A 1Y20A 1UIVA 3SESA 1S50A 3TEPA 1Y9UA 3EHTA 5EHSA 4E0XA 2E1SA 3FVKA 4IR8A 3FGSA 1JETA 3O9PA 3FIRA 1LFGA 5I58B 4MF3A 4R75A 4P9KA 3FV2A 2QPQA 4G8HA 1LBVA 2OWZA 3IFCA 3PUXE 4R73A 3PPQA 3C4MA 3G3GA 1MPBA 3FJMA 3CG1A 2XD2A 3PUYE 3N26A 4U1OA 3M3KA 1MQHA 2Y7WA 3KBZA 3QAXA 3IOWA 3DELB 3K1PA 4JSDA 1KA1A 3IOUA 3C9HA 3ECRA 2O7IA 4H46A 2CZIA 2B65A 3KEIA 3MWBA 4OYVA 1PC3A 3RTWB 2HFBA 4GOTA 4TLMB 3OENA 3S9LC 2DSFA 4WXJA 3TAJA 3IR1A 2XXPA 1AWBA 2I6EA 4XKRA 1QW0A 3PMVA 5B70A 4ZDMA 2I48A 4I1DA 3OOAA 2DXYA 2F34A 4H6DA 3USDA 4X8RA 1LBZA 4R72A 4OHNA 1D4NA 3CFZA 2Q8JA 3TPAA 1EZPA 1ZLQA 2Z8FA 1EYKA 1NL5A 2NOOA 5B7DA 1OLCA 1M5FA 1MY4A 1B3LA 1D3KA 3TCHA 4YAHX 1MPCA 5CMCA 4F19A 3KFMA 3LSXA 4ZEIA 4YKPA 3QMFA 4IO5A 3TQWA 4OENA 5TPAB 2HAVA 2Y7IA 4ZEDA 1ZIUA 4RA1A 4ESWA 1J1NA 3S9MC 1NNKA 5H8NA 1O64A 1PB9A 3MC2A 4F29A 1II5A 4PETA 3UIFA 4JBZA 3MZBA 4H45A 4EQBA 3E4RA 4PF6A 4XF5A 3R6UA 4BDNA 4NX1A 4PP0A 3CHGA 3MP1A 4LQ2A 2AIXA 4X04A 5BUUA 3MBPA 4XFEA 1LLSA 3RYDA 4F1VA 1NV6A 4QHQA 5IZ3A 4P56A 4PE5B 2FHYA 2ONRA 3TTMA 3TFLA 1QJMA 3TELA 1MS7A 1M5BA 2Y5LA 3N6TA 1US5A 3TCGA 2Q2AA 4XEQA 1Y1ZA 3HSTA 4RK9A 4ECFA 4TOZA 1EH3A 4PDDA 1N7XA 3LUZA 2D21A 3KBRA 1FQAA 5I2KA 1OIBA 5ET8A 3SZPA 4RYAA 4IY5A 4WEDA 1MDQA 3IB1A 4P1EA 3SEWA 4MLVA 1FBPA 3Q29A 4XTCQ 1FPKA 5KCJB 3IB0A 4P0IA 2VD3A 2HEUA 1JW5A 1BLFA 1INPA 3PUZE 1B5IA 2F97A 1FRPA 3K1MA 3SEUA 4N17A 2H5YA 2QS3A 4PFIA 1FPIA 3UA8A 5AA1A 4YU0A 2KQZA 4N81A 5DEXA 3DLNA 1QUIA 1LCFA 1WDNA 4EF1A 4FEDA 3HPIA 1LAGE 3KZGA 5I59A 3TYHA 3H7MA 1NH7A 1ZU0A 5JEIA 1AOVA 1B40A 2QSXA 1YCJA 1JP4A 1IZ1A 4G8NA 2F35A 3PD8A 3CIJA 5I2NB 2RCAA 2O7UA 1SW2A 4HW8A 2HXWA 4HE2A 3IJXB 2H9BA 3GYYA 3MYUA 2Q74A 3LSLA 4DZ1A 1LAXA 2Q8MA 3O6GA 3FV1A 2B4MA 3FATA 1A40A 3VE1B 3EF7A 1NNFA 1RDZA 3V83A 2P3NA 2PFZA 4XKPA 2VPOA 1MM7A 5ET7A 2V3UA 4XXUA 3MVYA 4KQPA 4GLIA 1LBYA 3O66A 3T93B 3MP8A 4QRZA 4RPOA 3CSBA 1IUDA 1H76A 1LGBC 2XXVA 3Q26A 3FBPA 3LUYA 1NV7A 3C32A 3EHUA 4GWSA 4Q0CA 5ET5A 4NF8A 3T9UA 1IITA 3OO6A 3E3KA 4H67A 1TWYA 3JV9A 2P2AA 4DXUA 2Z23A 1XI6A 4KYEA 1R9QA 2ZYKA 5JTYA 1N3WA 3KJ7A 4GWXA 2P0SA 2HZKA 5F7VA 4JWXA 4PFWA 4JWYA 2ZYNA 5FHOA 4MEVA 2CZHA 1B3FA 1Y4CA 4UACA 4DCYA 3LSWA 3CFXA 4X1DA 5IKBA 4UABA 4N6DA 2FBPA 3OD7A 3DP6A 3S2VA 4X48A 1SBPA 3L6HA 2D5WA 5H8NB 1Q1KA 4DLDA 3RPLB 2F7CA 3LC8A 1FPGA 2BJJX 5ICQA 4ZEKA 2I4BA 2E0SA 1Y4TA 4HCYA 5M2VA 3H6WA 2DQVA 2XXXA 4DDDA 3VVFA 2OZZA 2CZKA 2XHDA 3O97A 2DXRA 3RPLA 4OANA 1P99A 1XS5A 4LP2B 4P1LA 3MUQA 2F6GA 4BDMA 1FBDA 2F8DA 4DIGA 3G3KA 1I6QA 1LAFE 5HBCA 3U72A 2ZZWA 3V89B 3R26A 2XX7A 4F3PA 1P1OA 4JXIA 4JVIA 2YJPA 2X26A 3EN3A 2YPNA 3I3VA 4PFBA 1RYXA 1NNTA 4FORA 4GXAA 4PAKA 1N84A 1VDWA 2A5TA 3CG3A 5A5XA 4H5GA 1N76A 1SYHA 1XHYA 5IGAA 4OVSA 4ZZEA 3MSTA 1B4HA 1IEJA 3K00A 5AA4A 4KCCA 5ELVA 3DP8A 1GVCA 3HCQA 1CE2A 2DE3A 1NV2A 3IORA 4PF8A 4MCOA 2QFLA 4OFJA 4AS4A 1TFAA 4G68A 3IOVA 3PGFA 4PFRA 1FBFA 2AL4A 4H5FA 1QUJA 2DWJA 1EYJA 3MP6A 3S9NC 1FTOA 1FBCA 4O3BA 2V3TA 1FPEA 4F1UA 4OVRA 4PFUA 5I56A 1OMPA 2F7AA 4PGNA 2F78A 2OCUA 2ABHA 1NV4A 2GFEA 4F2QA 4ZECA 4U23A 3KC1A 1A99A 2R71A 4O3AA 1L5TA 1FTLA 1RYOA 1CB6A 2B3BA 1FTAA 3RPWA 1B7ZA 4G2ZA 3SERA 4U4XA 1GV8A 3RN8A 3C31A 4PDHA 4JDFA 4ELOA 4RJZA 1DPEA 1LAHE 3B8BA 1FBGA 1P1WA 4MFIA 1BK4A 3B6QA 1FQBA 2F6PA 4JVDA 3GBBA 5I84A 4PAFA 3UORA 1FTMA 3A09A 5DEXB 1DMBA 1NUWA 3K1NA 4OZ9A 2VGQA 1LB8A 1FJ6A 4BDQA 4ND9A 3S4UA 2Q9TA 2X7QA 3MVXA 2HCAA 1B58A 2YLNA 5FHNA 4KR5A 3PV0E 2XA5A 4LN5A 4OA4A 1I6BA 4N15A 1TT1A 1SI0A 1ZTYA 4GWOA 1USYH 2V84A 4BDRA 5L9OA 1IMAA 3B6WA 1I6AA 4OVQA 2DOJA 3PPOA 4RXLA 4PBQA 4N07A 1FPFA 5I7IA 4Z0IA 2Z8EA 2OLBA 3V8XB 2Q88A 3H06B 4QBAA 4XKNA 4MNCA 3EKIA 3W9VA 1EU8A 2DS9A 4N8GA 1TXFA 3TKDA 2JJKA 3VXCA 5AA2B 3IB2A 2I49A 3LSFB 3ROJA 3CR9A 5EYHA 2WYKA 2ZYOA 1A8FA 2XXRA 1VFDA 5K2XA 1IXHA 3TTRA 5LDZA 3SEYA 2REJA 3U8QA 1DTZA 4U1ZA 1P1QA 4GWYA 5DYHA 1KA0A 1QKAA 2QVUA 1MY1A 4F18A 1RDXA 1MG1A 4MLQA 4GQOA 3PPNA 4LQ5A 1DBZA 4JB7A 5LTCA 1M5EA 4IO3A 4IO6A 5L9SA 4AS5A 1B0LA 1UQWA 2B4LA 2ZNTA 4NGUA 2ONKE 4P8BA 2DWAA 4OFLA 1ZKBA 1MQIA 4F22A 1MH3A 1NFTA 3UP9A 4QXDA 5FTIA 2H4IA 1MRPA 1LFHA 1SW5A 2DYXA 1KWHA 3G3JA 4H0WA 1OVTA 3KN8A 3WAEA 3TUSA 4NF4B 5HM4B 5I59B 4O94A 2QS1A 5DW8A 1MPDA 4YMBA 1VR5A 4PC9A 5IZZA 4O3CA 2H99A 4F31B 3HN0A 1WODA 3KN7A 4NAPA 3MPKA 3D4CA 4YICA 3JYRA 1JW1A 2Y84A 5AA2A 1M5CA 1MY0A 4LZ7A 2H25A 1N0TA 2I4CA 1FQFA 4NE4A 4ESXA 4Z7EA 4NMYA 1B1HA 3IL1B 3GBAA 2XX9A 1EZ9A 2H98A 3AXFA 4NN3A 4EUOA 3BIHA 2XXTA 3K02A 4KFQA 1ATGA 4R6HA 2G93A 3PTYA 2GHAA 1FTKA 3K6WA 1URDA 2XXQA 5H8HA 2FIXA 5IAIA 3A3UA 3HV1A 4DI3D 2F3DA 3I6VA 3OEMA 5TP9B 1MXZA 3PUVE 4P11A 2UVIA 1Q35A 4FECA 3SDFA 5TPAA 3VVEA 1I69A 4OQOA 2VT5A 1NUZA 2P1SA 5I58A 4K3FA 2VP1A 1A54A 3KGCA 1T0KA 3M8UA 4NF4A 2M8CA 2QRYA 1NV3A 2XWKA 3KJTA 3ONMA 5F1QA 3KC0A 3K6VA 5TP9A 3TQLA 4DXCA 3K6UA 1XT8A 4NWCA 1MXYA 3LV0A 3G7WA 4NHBA 4R2BA 1ZMGA 2ESNA 1SVXB 5FHMA 2UVGA 4GX3A 4QSEA 3FUZA 4THIA 4LUBA 4FE8A 5K2YA 1B7HA 2CEXA 4QFKA 3KN3A 1GGGA 1B3EA 1UTBB 3A3CA 4O8MA 1GTKA 5H8FB 5I2KB 1WVJA 4ZEBA 2V25A 5FBPA 1VSOA 4KD5A 5LOMA 5H8SA 3K01A 3OO7A 4HTGA 3OSRA 2QS2A 2PFYA 1FJ9A 1HSEA 4GX4A 4R9GA 4NF8B 3MQ9A 4L17A 1B2HA 2WBDA 4G8MA 1H3DA 1PB8A 5I57B 3PMXA 3DP4A 4KXPA 1FPBA 1H45A 3BKIB 1B46A 3M3FA 1B1XA 2FVZA 1UTHB 2HZLA 4UA8A 3TTKA 4OWDA 1CNQA 3U65A 4G61A 2ZNSA 2RINA 1B05A 1IXGA 4G77A 4OETA 5EQ9A 2VHAA 2X7PA 1BIYA 3BIGA 2QMXA 4X9TA 4XKQA 1BKAA 2VOZA 2I3VA 1SYIA 4NF5B 3IO6A 1LEVA 2XXUA 1NI9A 3QIMA 3VLVA 3FVNA 3CSGA 4NF6A 3VLUA 5I5PA 4F2OA 3MVWA 1DK4A 3PUWE 3T9XB 5F24A 1OLAA 1MY3A 2ALUA 4PFYA 1O63A 1URGA 4RNSA 2I0BA 5ISUA 5I3SA 2L5VA 1G0IA 3BFUA 4OVJA 1MXXA 2XXYA 2I58A 4H1XA 2O68A 4GXSB 1B9JA 3Q28A 2F36A 1N3XA 2XXHA 1R1NA 3EHSA 1SQYA 4BLAA 2FNCA 4NWDA 5HPQA 4POWA 1F9BA 4M1VA 1UIUA 2XX8A 2ZMBA 5IM2A 1DOTA 1QKBA 4Q8RA 3GXAA 4ZE8A 4MIJA 5KZTA 4KCDA 4C1UA 4DE8A 3ODBA 4G68B 1MXWA 1D9QA 4EXLA 5EYFA 3FASA 1P1UA 4PAIA 5EHMA 4H8JA 3T9HB 2UXAA 3G3HA 3S9EA 3H4ZA 1O7TA 1Y1MA 3LBSA 1M5DA 1URSA 2QL3A 4YZZA 3Q25A 4FJPA 4Q30B 4FBPA 3U92A 2O6AA 4DCXA 4TLLB 1N04A 4ELQA 3QXMA 5I2NA 3IAZA 4AB6A 4JVCA 4HE0A 1NNPA 4ZZAA 3IK6B 2D3IA 4DXBA 4LZ8A 1ELJA 2RC8A 4YKJA 3FXQA 4HCWA 2WX9A 5EQAA 3VVDA 4IO2A 1AIVA 1A7LA 2XXIA 1FPDA 4OTEA 1IXIA 3OO8A 5I56B 3TMGA 3IO4A 2GHBA 3UGWA 4N91A 4PE3A 2FIEA 4MX6A 4H65A 1FCKA 4GL0A 2UYEA 1QGXA 4GRKA 1YXIA 4G68C 3O28A 4WEPA 3C36A 3TTNA 4X1BA 2WBBA 5J1DA 1ANFA 1VE4A 1YAEA 5H8QB 3CI8A 1XC1A 3MAMA 4I9DA 5DTBA 4QFOA 2DVCA 2O51A 3MVZA 2KR0A 2HHMA 1SW1A 3H6UA 4N4UA 2GH9A 3D1RA 5JTYB 4BDOA 2VD2A 4QFNA 2R9JA 2OX3A 1PBPA 1B52A 1MQGA 4GFRA 4GIZA 1K9YA 5EQ7A 3SEXA 3T0JA 5ITPA 3RUMA 1MY2A 1ZJLA 2NVUB 4IGTA 3HFUA 3SKPA 1SW4A 1IIWA 4NG7A 3FXUA 4YMAA 4EQ7A 1OQGA 4ZEFA 2G29A 2F5XA 2I3WA 3VDFA 4PCDA 5ITOA 5IZ3B 1DTGA 4HS7A 3VLWA 2Y7PA 1TFDA 3W9WA 2PBWA 4I8CA 1FBHA 2UVJA 3OMBA 3FXRA 4IO4A 1IMBA 3H6TA 1DPPA 5H8QA 4HXVA 2R8TA 4H8IA 2V3QA 4EQ9A 3FJGA 2PT2A 1R6ZA 2GQ1A 4MAGA 3B7DA 3QK6A 4GD5A 2UVHA 2QVVA 2AL5A 4OMBA 4IB2A 3WAFA 1HSJA 4YKKA 3ZKLA 5AE4A 1IQ7A 1B32A 2R6GE 1QVSA 2DVZA 1G0HA 4IY6A 3JZJA 3K0VA 4FIMA 2ANJA 4M4GA 2XWVA 2RKMA 4NEDA 3FVGA 1R9LA 4QFLA 1POY1 4ONYA 3VV5A 1D9YA 4OVPA 5T3JA 1LB9A 4GF8A 4GX6A 3CFLA 1EZOA 3RY3A 3FJ7A 3T66A 3Q27A 4YB5A 2BJIA 3U94A 1FQCA 2XWIA 3E9XA 3RGYA 3HHGA 2DDKA 3A29A 1NV5A 2GRVA 3KOSA 1Z7ME 1IXCA 5ET6A 2XXKA 2O1LA 2NXOA 5EQ8A 2Z22A 3C35A 2LAOA 4GWWA 1FTJA 1Y3NA 4GBVA 4I3YA 5A5XB 3RNNA 2HQ0A 3PPRA 2Y5KA 2DE4A 2Y7KA 2OK2A 2O1MA 1AMFA 1DSNA 4ZE9A 4R2FA 5AA4B 3BBRA 3U1OA 2OBGA 2IA4A 3L6GA 4R6KA 1B5HA 5DVFA 1LBBA 2O84X 3RLFE 1MXUA 4U4SA 2O69A 2ZNUA 2RC7A 3EQ1A 4C0RA 4KI0E 1RDYA 4U2RA 3MW0A 3O29A 1LBXA 4P47A 2XD3A 4I62A 3DM0A 3HO7A 1B7UA 3T1BA 3O6IA 4YKIA 2RC9A 5L9MA 3RQTA 5FTHA 5TU0A 1B6HA 1YYZA 2A5SA 2ZZXA 4NTLA 2AYSA 3CRBA 1B3HA 3T96B 2XWOA 2OWSA 2ONSA 5ICTA 1IMDA 4LATA 3U93A 3ZS6A 4KYSA 1K9ZA 2KLFA 1GR2A 1MDP1 1Y3QA 1MQJA 1NMUA 3K4UA 4NF5A 5DVIA 1XVYA 1LBCA 3C34A 4RPNA 1H44A 2DWIA 3QUFA 4MNIA 1MQDA 4GWZA 2WKYA 3VFJA 1B51A 4KYDA 5BWJA 1B5JA 4E0WA 1Q9DA 4LZ5A 3V5AA 3IX1A 1H43A 2FA7A 4AQ4A 2WEFA 4MBPA 2Z8DA 5JK4A 2THIA 4QSCA 1D9VA 4N8YA 2DWHA 3ILUB 3RT8A 1PEBA 2WYPA 3EPEA 2HAUA 3OEKA 1SPIA 4MHFA 2NUVA 2B3FA 3FZVA 3E79A 3CVGA 1UTBA 3OELA 1B3GA 1FBEA 4F3BA 1IMFA 2Q2CA 4QSDA 4R74A 3SETA 4U22A 5CBRA 1AL3A 1HSLA 4OESA 3B50A 5H8FA 4RY1A 5A5LA 1NKXA 2P3VA 4Q5TA 3E13X 3GZGA 5J16A 4F39A 1LSTA 4MJOA 1NV1A 1MM6A 2V93A 1FSAA 1PB7A 4FATA 2DP8A 5EYGA 2CEYA 2MKZA 4OXVA 1A55A 1LBWA 4AB5A 5CMKA
chains in the Genus database with same CATH topology
2JJKA 3W9WA 4O8MA 1NV4A 1FBHA 1DCUA 1EYIA 2Y5KA 2DE4A 1NUXA 2Q8MA 1Q9DA 5I3SA 2Y5LA 2B4MA 2L5VA 3ROJA 2CZKA 4HCWA 1G0IA 3ISPA 1IMBA 1LBZA 2WX9A 4PGPA 4X8RA 2WYKA 5EQAA 4XEQA 5EYHA 2QVRA 3RPLA 3KC1A 4PBHA 1RDZA 4NN3A 4OANA 4HXVA 2R8TA 2P3NA 2PFZA 1FPLA 2V3QA 3E78A 5FBPA 4GWUA 2VPOA 2WEFA 3BIHA 1FPDA 1EYKA 2DE2A 2VPNA 4I40A 4P1LA 4PDDA 3LUZA 5JK4A 1FTAA 4P3LA 5ET7A 2HXRA 2GQ1A 3PTYA 4MAGA 4N8YA 5LDZA 1FBDA 5IZ1A 1KZ8A 4QXDA 5ET8A 1LBYA 2WYPA 4GWYA 2PFYA 5ESYA 1FJ9A 3SZPA 4NGUA 1KA0A 4GX4A 2ZZWA 4N91A 4PE3A 2HPGA 4PDHA 3NOHA 2FIXA 4I3EA 3IFAA 4DI3D 1SPIA 2QVUA 2F3DA 2QVVA 4P1EA 3B8BA 4MHFA 1RDXA 1FBGA 2FIEA 4F18A 1FBPA 2WBDA 1DBZA 4MX6A 4F19A 1FPKA 5LTCA 4JVIA 1BK4A 3E79A 4IR8A 1YZ0A 4AS5A 1FBEA 4KXPA 2B4LA 4M1VA 1QGXA 4JVDA 3FBPA 1FPBA 1IMFA 1RDYA 2DVZA 1G0HA 1NV7A 1NV0A 1YXIA 3QMFA 4GWSA 4PAKA 1LBXA 4PAFA 4P47A 4P8BA 1NUYA 2ZZVA 5ET5A 4DI4B 1INPA 5IM2A 1NUWA 2XWVA 4P9KA 1VDWA 2WBBA 3T1BA 2FVZA 1FRPA 2F3BA 1XI6A 2HZLA 2QPQA 5J1DA 2VT5A 1LBVA 1FJ6A 2OWZA 3IFCA 4GBWA 4MIJA 4N17A 4N6KA 4OVSA 3MSTA 4PFIA 5IGAA 5CM6A 1FPIA 1NUZA 2Q9TA 1CNQA 3U65A 4GWXA 2KQZA 4MNPA 1IMCA 4N81A 2HZKA 1YYZA 2KR0A 2HHMA 3B50A 4O7MA 2XA5A 1D9QA 2ZZXA 4G61A 4LN5A 4OVPA 4OA4A 5A5LA 4N4UA 3KBZA 5T3JA 2DE3A 1NV2A 3D1RA 4MEVA 4N15A 5EQ9A 2P3VA 2XWOA 4PETA 2CZHA 1IMDA 4OVTA 4PAIA 4PF8A 4MCOA 2QFLA 4GX6A 4H45A 4O94A 1NV3A 5J16A 2XWKA 3BIGA 4AS4A 1IMAA 4HE1A 4PFBA 4OVQA 3KC0A 4UABA 5DW8A 4PF6A 2PCRA 2FBPA 4N6DA 4PC9A 4X9TA 2OX3A 4XF5A 5IZZA 4MJOA 4NX1A 1K9ZA 1KA1A 4PFRA 4YZZA 1FBFA 1K9YA 1NV1A 5EQ7A 2BJIA 1JP4A 4NF0A 3T0JA 3LV0A 3CHGA 4O7IA 4PBQA 1FSAA 2XWIA 4NHBA 1FPFA 4FBPA 5I7IA 1LEVA 4H46A 2CZIA 1NI9A 4NAPA 2DDKA 1IMEA 4MMPA 2V4CA 3FXBA 3HFUA 3A29A 4I3YA 1EYJA 4GX3A 4PTKA 1NV5A 4X04A 4YICA 5EYGA 4NG7A 1FPJA 3RPLB 1FBCA 4XFEA 5ET6A 5I5PA 1FPEA 2XXKA 4F1VA 3RYDA 4QBAA 1FPGA 1DK4A 1NV6A 4HE2A 2F5XA 4NQ8A 2CEYA 4MNCA 3EKIA 4JVCA 4MNIA 3W9VA 5IZ3A 2MKZA 5F24A 5EQ8A 4F1UA 1LBWA 4HE0A 4N8GA 4PCDA 4OVRA 3GYYA 5IZ3B 2CEXA 3MYUA 4GWZA 2Q74A 4GWWA 1AWBA 4GBVA 4P56A 4HCYA 4PGNA 2FHYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O8M A;  4X8R A;  2WX9 A;  4PGP A;  2WYK A;  4XEQ A;  4PBH A;  4NN3 A;  4OAN A;  2PFZ A;  2VPO A;  4PDD A;  2VPN A;  4P1L A;  4P3L A;  4MAG A;  4N8Y A;  2WYP A;  2PFY A;  4N91 A;  2ZZW A;  4PE3 A;  4PDH A;  2HPG A;  4DI3 D;  4P1E A;  4MHF A;  4MX6 A;  5LTC A;  4NGU A;  4PFB A;  4PAF A;  4P8B A;  4PAK A;  4P47 A;  4DI4 B;  2ZZV A;  5IM2 A;  2XWV A;  4P9K A;  2HZL A;  4MIJ A;  4N17 A;  5IGA A;  4N6K A;  4OVS A;  4PFI A;  5CM6 A;  3U65 A;  4MNP A;  2HZK A;  3B50 A;  4O7M A;  2XA5 A;  2ZZX A;  4LN5 A;  4OVP A;  4OA4 A;  4N4U A;  4MEV A;  4N15 A;  2XWO A;  4PET A;  4OVT A;  4PAI A;  4PF8 A;  4MCO A;  4O94 A;  2XWK A;  4OVQ A;  4UAB A;  4PF6 A;  4N6D A;  4PC9 A;  5IZZ A;  4XF5 A;  4NX1 A;  4PFR A;  4YZZ A;  4NF0 A;  4PBQ A;  2XWI A;  4NHB A;  5I7I A;  4NAP A;  4MMP A;  2V4C A;  3FXB A;  4YIC A;  4X04 A;  4NG7 A;  4XFE A;  5I5P A;  2XXK A;  4NQ8 A;  2CEY A;  4MNC A;  4MNI A;  4N8G A;  4PCD A;  4OVR A;  3GYY A;  2CEX A;  4P56 A;  4PGN A; 
#chains in the Genus database with same CATH topology
 3ZKK A;  3C33 A;  4ELP A;  4POX A;  4EF2 A;  4PGP A;  1N7W A;  4WKM A;  2DE2 A;  2VPN A;  4I40 A;  4ISU A;  4OEV A;  4U21 A;  4G4P A;  3D4G A;  5IZ1 A;  2UYF A;  5ESY A;  1JNF A;  4ZS9 A;  5H8H B;  3KG2 A;  2XXW A;  1VFE A;  4F3G A;  2QMW A;  2IEE A;  5L8D A;  3PU5 A;  4KHZ E;  5KCJ A;  4F1Y A;  4IGR A;  1JQF A;  1YZ0 A;  4EDP A;  1NV0 A;  2RF1 A;  4N6P A;  1XOC A;  4DI4 B;  4OFO A;  3G3F A;  1B0H A;  2A5T B;  1B4Z A;  4LVQ A;  2OWT A;  2F3B A;  2PMS A;  3PD9 A;  5CM6 A;  2FYI A;  2PVU A;  4KPT A;  4MNP A;  1IMC A;  4PQJ A;  2PYY A;  1YPN A;  3TZA A;  4O7M A;  3P7I A;  5AA2 D;  3PMW A;  1A8E A;  1OVB A;  1S9T A;  4OVT A;  5CI5 A;  4QFP A;  1US4 A;  3TCF A;  2RCB A;  3MZ1 A;  4GL8 A;  3T22 A;  3OXN A;  5CMM A;  3R7X A;  4NF0 A;  1Y3P A;  4R6Y A;  5KDT B;  4XIG Q;  2V4C A;  3FXB A;  3THI A;  5CRY A;  3LR1 A;  3GLB A;  1OQH A;  4NQ8 A;  3FVO A;  3I5O A;  4GVO A;  2QS4 A;  2CZL A;  3H03 A;  3MZ9 A;  5AA3 A;  3O6H A;  1BP5 A;  5CBS A;  4FEB A;  4LON B;  3OSQ A;  3VXB A;  1FQD A;  1JVX A;  1JEV A;  3MPL A;  4NF6 B;  2I0C A;  1FPL A;  1JW4 A;  3N5L A;  1MXV A;  4PFT A;  2REG A;  2W7Y A;  1KZ8 A;  3N6U A;  2OJT A;  2F7B A;  3KOT A;  3KSJ A;  2HPG A;  3NOH A;  1QUK A;  4I3E A;  3K2D A;  3IFA A;  1FQE A;  3QYT A;  3RT6 B;  1FW0 A;  3SEV A;  4OEU A;  4RK2 A;  3ILT B;  5CMB A;  3N94 A;  1ZBM A;  1SI1 A;  1NUY A;  2ZZV A;  5KDT A;  4JSO A;  1YTV A;  3M3L A;  1Z7N E;  3HHF A;  4QF9 A;  4GBW A;  1UTH A;  4N6K A;  1USY E;  4TQU Q;  1SDX A;  2PX1 A;  3QUJ A;  2ZXT A;  3ZSF A;  4ELR A;  3B6T A;  1POT A;  4R9F A;  5I57 A;  4N13 A;  4YB7 A;  3O2A A;  3H3G A;  2Y7R A;  3T9V A;  1QUL A;  3IJO B;  3OO9 A;  1LFI A;  1JEU A;  3FD3 A;  4HE1 A;  1XVX A;  4F3S A;  2PCR A;  3QSL A;  4C1T A;  1P1N A;  4P0G A;  4JWO A;  4O7I A;  3MJN A;  3BFT A;  3UN6 A;  4MH5 A;  1IME A;  4MMP A;  1PDA A;  4OER A;  2NWJ A;  4PTK A;  1FPJ A;  2ZYM A;  1LCT A;  4BDL A;  1S7Y A;  3F11 A;  3UK4 A;  1MH4 A;  3KSX A;  4FAJ A;  1JVY A;  3K6X A;  5DT6 A;  1RKM A;  2CMO A;  3TDJ A;  2QJE A;  2Q89 A;  1PBQ A;  4EXK A;  1DCU A;  1EYI A;  1NUX A;  3H6V A;  4YB6 A;  5CC2 A;  3ISP A;  3TOD A;  3IOT A;  3PPP A;  2QVR A;  4PBH A;  4IO7 A;  1AH5 A;  3E78 A;  4GWU A;  4LA9 A;  3TTL A;  1NH8 A;  4P3L A;  5DVJ A;  1BTJ A;  2HXR A;  3W15 C;  3G3I A;  3RTF B;  1SD3 A;  2PT1 A;  1Y20 A;  1UIV A;  3SES A;  1S50 A;  3TEP A;  1Y9U A;  3EHT A;  5EHS A;  4E0X A;  2E1S A;  3FVK A;  4IR8 A;  3FGS A;  1JET A;  3O9P A;  3FIR A;  1LFG A;  5I58 B;  4MF3 A;  4R75 A;  4P9K A;  3FV2 A;  2QPQ A;  4G8H A;  1LBV A;  2OWZ A;  3IFC A;  3PUX E;  4R73 A;  3PPQ A;  3C4M A;  3G3G A;  1MPB A;  3FJM A;  3CG1 A;  2XD2 A;  3PUY E;  3N26 A;  4U1O A;  3M3K A;  1MQH A;  2Y7W A;  3KBZ A;  3QAX A;  3IOW A;  3DEL B;  3K1P A;  4JSD A;  1KA1 A;  3IOU A;  3C9H A;  3ECR A;  2O7I A;  4H46 A;  2CZI A;  2B65 A;  3KEI A;  3MWB A;  4OYV A;  1PC3 A;  3RTW B;  2HFB A;  4GOT A;  4TLM B;  3OEN A;  3S9L C;  2DSF A;  4WXJ A;  3TAJ A;  3IR1 A;  2XXP A;  1AWB A;  2I6E A;  4XKR A;  1QW0 A;  3PMV A;  5B70 A;  4ZDM A;  2I48 A;  4I1D A;  3OOA A;  2DXY A;  2F34 A;  4H6D A;  3USD A;  4X8R A;  1LBZ A;  4R72 A;  4OHN A;  1D4N A;  3CFZ A;  2Q8J A;  3TPA A;  1EZP A;  1ZLQ A;  2Z8F A;  1EYK A;  1NL5 A;  2NOO A;  5B7D A;  1OLC A;  1M5F A;  1MY4 A;  1B3L A;  1D3K A;  3TCH A;  4YAH X;  1MPC A;  5CMC A;  4F19 A;  3KFM A;  3LSX A;  4ZEI A;  4YKP A;  3QMF A;  4IO5 A;  3TQW A;  4OEN A;  5TPA B;  2HAV A;  2Y7I A;  4ZED A;  1ZIU A;  4RA1 A;  4ESW A;  1J1N A;  3S9M C;  1NNK A;  5H8N A;  1O64 A;  1PB9 A;  3MC2 A;  4F29 A;  1II5 A;  4PET A;  3UIF A;  4JBZ A;  3MZB A;  4H45 A;  4EQB A;  3E4R A;  4PF6 A;  4XF5 A;  3R6U A;  4BDN A;  4NX1 A;  4PP0 A;  3CHG A;  3MP1 A;  4LQ2 A;  2AIX A;  4X04 A;  5BUU A;  3MBP A;  4XFE A;  1LLS A;  3RYD A;  4F1V A;  1NV6 A;  4QHQ A;  5IZ3 A;  4P56 A;  4PE5 B;  2FHY A;  2ONR A;  3TTM A;  3TFL A;  1QJM A;  3TEL A;  1MS7 A;  1M5B A;  2Y5L A;  3N6T A;  1US5 A;  3TCG A;  2Q2A A;  4XEQ A;  1Y1Z A;  3HST A;  4RK9 A;  4ECF A;  4TOZ A;  1EH3 A;  4PDD A;  1N7X A;  3LUZ A;  2D21 A;  3KBR A;  1FQA A;  5I2K A;  1OIB A;  5ET8 A;  3SZP A;  4RYA A;  4IY5 A;  4WED A;  1MDQ A;  3IB1 A;  4P1E A;  3SEW A;  4MLV A;  1FBP A;  3Q29 A;  4XTC Q;  1FPK A;  5KCJ B;  3IB0 A;  4P0I A;  2VD3 A;  2HEU A;  1JW5 A;  1BLF A;  1INP A;  3PUZ E;  1B5I A;  2F97 A;  1FRP A;  3K1M A;  3SEU A;  4N17 A;  2H5Y A;  2QS3 A;  4PFI A;  1FPI A;  3UA8 A;  5AA1 A;  4YU0 A;  2KQZ A;  4N81 A;  5DEX A;  3DLN A;  1QUI A;  1LCF A;  1WDN A;  4EF1 A;  4FED A;  3HPI A;  1LAG E;  3KZG A;  5I59 A;  3TYH A;  3H7M A;  1NH7 A;  1ZU0 A;  5JEI A;  1AOV A;  1B40 A;  2QSX A;  1YCJ A;  1JP4 A;  1IZ1 A;  4G8N A;  2F35 A;  3PD8 A;  3CIJ A;  5I2N B;  2RCA A;  2O7U A;  1SW2 A;  4HW8 A;  2HXW A;  4HE2 A;  3IJX B;  2H9B A;  3GYY A;  3MYU A;  2Q74 A;  3LSL A;  4DZ1 A;  1LAX A;  2Q8M A;  3O6G A;  3FV1 A;  2B4M A;  3FAT A;  1A40 A;  3VE1 B;  3EF7 A;  1NNF A;  1RDZ A;  3V83 A;  2P3N A;  2PFZ A;  4XKP A;  2VPO A;  1MM7 A;  5ET7 A;  2V3U A;  4XXU A;  3MVY A;  4KQP A;  4GLI A;  1LBY A;  3O66 A;  3T93 B;  3MP8 A;  4QRZ A;  4RPO A;  3CSB A;  1IUD A;  1H76 A;  1LGB C;  2XXV A;  3Q26 A;  3FBP A;  3LUY A;  1NV7 A;  3C32 A;  3EHU A;  4GWS A;  4Q0C A;  5ET5 A;  4NF8 A;  3T9U A;  1IIT A;  3OO6 A;  3E3K A;  4H67 A;  1TWY A;  3JV9 A;  2P2A A;  4DXU A;  2Z23 A;  1XI6 A;  4KYE A;  1R9Q A;  2ZYK A;  5JTY A;  1N3W A;  3KJ7 A;  4GWX A;  2P0S A;  2HZK A;  5F7V A;  4JWX A;  4PFW A;  4JWY A;  2ZYN A;  5FHO A;  4MEV A;  2CZH A;  1B3F A;  1Y4C A;  4UAC A;  4DCY A;  3LSW A;  3CFX A;  4X1D A;  5IKB A;  4UAB A;  4N6D A;  2FBP A;  3OD7 A;  3DP6 A;  3S2V A;  4X48 A;  1SBP A;  3L6H A;  2D5W A;  5H8N B;  1Q1K A;  4DLD A;  3RPL B;  2F7C A;  3LC8 A;  1FPG A;  2BJJ X;  5ICQ A;  4ZEK A;  2I4B A;  2E0S A;  1Y4T A;  4HCY A;  5M2V A;  3H6W A;  2DQV A;  2XXX A;  4DDD A;  3VVF A;  2OZZ A;  2CZK A;  2XHD A;  3O97 A;  2DXR A;  3RPL A;  4OAN A;  1P99 A;  1XS5 A;  4LP2 B;  4P1L A;  3MUQ A;  2F6G A;  4BDM A;  1FBD A;  2F8D A;  4DIG A;  3G3K A;  1I6Q A;  1LAF E;  5HBC A;  3U72 A;  2ZZW A;  3V89 B;  3R26 A;  2XX7 A;  4F3P A;  1P1O A;  4JXI A;  4JVI A;  2YJP A;  2X26 A;  3EN3 A;  2YPN A;  3I3V A;  4PFB A;  1RYX A;  1NNT A;  4FOR A;  4GXA A;  4PAK A;  1N84 A;  1VDW A;  2A5T A;  3CG3 A;  5A5X A;  4H5G A;  1N76 A;  1SYH A;  1XHY A;  5IGA A;  4OVS A;  4ZZE A;  3MST A;  1B4H A;  1IEJ A;  3K00 A;  5AA4 A;  4KCC A;  5ELV A;  3DP8 A;  1GVC A;  3HCQ A;  1CE2 A;  2DE3 A;  1NV2 A;  3IOR A;  4PF8 A;  4MCO A;  2QFL A;  4OFJ A;  4AS4 A;  1TFA A;  4G68 A;  3IOV A;  3PGF A;  4PFR A;  1FBF A;  2AL4 A;  4H5F A;  1QUJ A;  2DWJ A;  1EYJ A;  3MP6 A;  3S9N C;  1FTO A;  1FBC A;  4O3B A;  2V3T A;  1FPE A;  4F1U A;  4OVR A;  4PFU A;  5I56 A;  1OMP A;  2F7A A;  4PGN A;  2F78 A;  2OCU A;  2ABH A;  1NV4 A;  2GFE A;  4F2Q A;  4ZEC A;  4U23 A;  3KC1 A;  1A99 A;  2R71 A;  4O3A A;  1L5T A;  1FTL A;  1RYO A;  1CB6 A;  2B3B A;  1FTA A;  3RPW A;  1B7Z A;  4G2Z A;  3SER A;  4U4X A;  1GV8 A;  3RN8 A;  3C31 A;  4PDH A;  4JDF A;  4ELO A;  4RJZ A;  1DPE A;  1LAH E;  3B8B A;  1FBG A;  1P1W A;  4MFI A;  1BK4 A;  3B6Q A;  1FQB A;  2F6P A;  4JVD A;  3GBB A;  5I84 A;  4PAF A;  3UOR A;  1FTM A;  3A09 A;  5DEX B;  1DMB A;  1NUW A;  3K1N A;  4OZ9 A;  2VGQ A;  1LB8 A;  1FJ6 A;  4BDQ A;  4ND9 A;  3S4U A;  2Q9T A;  2X7Q A;  3MVX A;  2HCA A;  1B58 A;  2YLN A;  5FHN A;  4KR5 A;  3PV0 E;  2XA5 A;  4LN5 A;  4OA4 A;  1I6B A;  4N15 A;  1TT1 A;  1SI0 A;  1ZTY A;  4GWO A;  1USY H;  2V84 A;  4BDR A;  5L9O A;  1IMA A;  3B6W A;  1I6A A;  4OVQ A;  2DOJ A;  3PPO A;  4RXL A;  4PBQ A;  4N07 A;  1FPF A;  5I7I A;  4Z0I A;  2Z8E A;  2OLB A;  3V8X B;  2Q88 A;  3H06 B;  4QBA A;  4XKN A;  4MNC A;  3EKI A;  3W9V A;  1EU8 A;  2DS9 A;  4N8G A;  1TXF A;  3TKD A;  2JJK A;  3VXC A;  5AA2 B;  3IB2 A;  2I49 A;  3LSF B;  3ROJ A;  3CR9 A;  5EYH A;  2WYK A;  2ZYO A;  1A8F A;  2XXR A;  1VFD A;  5K2X A;  1IXH A;  3TTR A;  5LDZ A;  3SEY A;  2REJ A;  3U8Q A;  1DTZ A;  4U1Z A;  1P1Q A;  4GWY A;  5DYH A;  1KA0 A;  1QKA A;  2QVU A;  1MY1 A;  4F18 A;  1RDX A;  1MG1 A;  4MLQ A;  4GQO A;  3PPN A;  4LQ5 A;  1DBZ A;  4JB7 A;  5LTC A;  1M5E A;  4IO3 A;  4IO6 A;  5L9S A;  4AS5 A;  1B0L A;  1UQW A;  2B4L A;  2ZNT A;  4NGU A;  2ONK E;  4P8B A;  2DWA A;  4OFL A;  1ZKB A;  1MQI A;  4F22 A;  1MH3 A;  1NFT A;  3UP9 A;  4QXD A;  5FTI A;  2H4I A;  1MRP A;  1LFH A;  1SW5 A;  2DYX A;  1KWH A;  3G3J A;  4H0W A;  1OVT A;  3KN8 A;  3WAE A;  3TUS A;  4NF4 B;  5HM4 B;  5I59 B;  4O94 A;  2QS1 A;  5DW8 A;  1MPD A;  4YMB A;  1VR5 A;  4PC9 A;  5IZZ A;  4O3C A;  2H99 A;  4F31 B;  3HN0 A;  1WOD A;  3KN7 A;  4NAP A;  3MPK A;  3D4C A;  4YIC A;  3JYR A;  1JW1 A;  2Y84 A;  5AA2 A;  1M5C A;  1MY0 A;  4LZ7 A;  2H25 A;  1N0T A;  2I4C A;  1FQF A;  4NE4 A;  4ESX A;  4Z7E A;  4NMY A;  1B1H A;  3IL1 B;  3GBA A;  2XX9 A;  1EZ9 A;  2H98 A;  3AXF A;  4NN3 A;  4EUO A;  3BIH A;  2XXT A;  3K02 A;  4KFQ A;  1ATG A;  4R6H A;  2G93 A;  3PTY A;  2GHA A;  1FTK A;  3K6W A;  1URD A;  2XXQ A;  5H8H A;  2FIX A;  5IAI A;  3A3U A;  3HV1 A;  4DI3 D;  2F3D A;  3I6V A;  3OEM A;  5TP9 B;  1MXZ A;  3PUV E;  4P11 A;  2UVI A;  1Q35 A;  4FEC A;  3SDF A;  5TPA A;  3VVE A;  1I69 A;  4OQO A;  2VT5 A;  1NUZ A;  2P1S A;  5I58 A;  4K3F A;  2VP1 A;  1A54 A;  3KGC A;  1T0K A;  3M8U A;  4NF4 A;  2M8C A;  2QRY A;  1NV3 A;  2XWK A;  3KJT A;  3ONM A;  5F1Q A;  3KC0 A;  3K6V A;  5TP9 A;  3TQL A;  4DXC A;  3K6U A;  1XT8 A;  4NWC A;  1MXY A;  3LV0 A;  3G7W A;  4NHB A;  4R2B A;  1ZMG A;  2ESN A;  1SVX B;  5FHM A;  2UVG A;  4GX3 A;  4QSE A;  3FUZ A;  4THI A;  4LUB A;  4FE8 A;  5K2Y A;  1B7H A;  2CEX A;  4QFK A;  3KN3 A;  1GGG A;  1B3E A;  1UTB B;  3A3C A;  4O8M A;  1GTK A;  5H8F B;  5I2K B;  1WVJ A;  4ZEB A;  2V25 A;  5FBP A;  1VSO A;  4KD5 A;  5LOM A;  5H8S A;  3K01 A;  3OO7 A;  4HTG A;  3OSR A;  2QS2 A;  2PFY A;  1FJ9 A;  1HSE A;  4GX4 A;  4R9G A;  4NF8 B;  3MQ9 A;  4L17 A;  1B2H A;  2WBD A;  4G8M A;  1H3D A;  1PB8 A;  5I57 B;  3PMX A;  3DP4 A;  4KXP A;  1FPB A;  1H45 A;  3BKI B;  1B46 A;  3M3F A;  1B1X A;  2FVZ A;  1UTH B;  2HZL A;  4UA8 A;  3TTK A;  4OWD A;  1CNQ A;  3U65 A;  4G61 A;  2ZNS A;  2RIN A;  1B05 A;  1IXG A;  4G77 A;  4OET A;  5EQ9 A;  2VHA A;  2X7P A;  1BIY A;  3BIG A;  2QMX A;  4X9T A;  4XKQ A;  1BKA A;  2VOZ A;  2I3V A;  1SYI A;  4NF5 B;  3IO6 A;  1LEV A;  2XXU A;  1NI9 A;  3QIM A;  3VLV A;  3FVN A;  3CSG A;  4NF6 A;  3VLU A;  5I5P A;  4F2O A;  3MVW A;  1DK4 A;  3PUW E;  3T9X B;  5F24 A;  1OLA A;  1MY3 A;  2ALU A;  4PFY A;  1O63 A;  1URG A;  4RNS A;  2I0B A;  5ISU A;  5I3S A;  2L5V A;  1G0I A;  3BFU A;  4OVJ A;  1MXX A;  2XXY A;  2I58 A;  4H1X A;  2O68 A;  4GXS B;  1B9J A;  3Q28 A;  2F36 A;  1N3X A;  2XXH A;  1R1N A;  3EHS A;  1SQY A;  4BLA A;  2FNC A;  4NWD A;  5HPQ A;  4POW A;  1F9B A;  4M1V A;  1UIU A;  2XX8 A;  2ZMB A;  5IM2 A;  1DOT A;  1QKB A;  4Q8R A;  3GXA A;  4ZE8 A;  4MIJ A;  5KZT A;  4KCD A;  4C1U A;  4DE8 A;  3ODB A;  4G68 B;  1MXW A;  1D9Q A;  4EXL A;  5EYF A;  3FAS A;  1P1U A;  4PAI A;  5EHM A;  4H8J A;  3T9H B;  2UXA A;  3G3H A;  3S9E A;  3H4Z A;  1O7T A;  1Y1M A;  3LBS A;  1M5D A;  1URS A;  2QL3 A;  4YZZ A;  3Q25 A;  4FJP A;  4Q30 B;  4FBP A;  3U92 A;  2O6A A;  4DCX A;  4TLL B;  1N04 A;  4ELQ A;  3QXM A;  5I2N A;  3IAZ A;  4AB6 A;  4JVC A;  4HE0 A;  1NNP A;  4ZZA A;  3IK6 B;  2D3I A;  4DXB A;  4LZ8 A;  1ELJ A;  2RC8 A;  4YKJ A;  3FXQ A;  4HCW A;  2WX9 A;  5EQA A;  3VVD A;  4IO2 A;  1AIV A;  1A7L A;  2XXI A;  1FPD A;  4OTE A;  1IXI A;  3OO8 A;  5I56 B;  3TMG A;  3IO4 A;  2GHB A;  3UGW A;  4N91 A;  4PE3 A;  2FIE A;  4MX6 A;  4H65 A;  1FCK A;  4GL0 A;  2UYE A;  1QGX A;  4GRK A;  1YXI A;  4G68 C;  3O28 A;  4WEP A;  3C36 A;  3TTN A;  4X1B A;  2WBB A;  5J1D A;  1ANF A;  1VE4 A;  1YAE A;  5H8Q B;  3CI8 A;  1XC1 A;  3MAM A;  4I9D A;  5DTB A;  4QFO A;  2DVC A;  2O51 A;  3MVZ A;  2KR0 A;  2HHM A;  1SW1 A;  3H6U A;  4N4U A;  2GH9 A;  3D1R A;  5JTY B;  4BDO A;  2VD2 A;  4QFN A;  2R9J A;  2OX3 A;  1PBP A;  1B52 A;  1MQG A;  4GFR A;  4GIZ A;  1K9Y A;  5EQ7 A;  3SEX A;  3T0J A;  5ITP A;  3RUM A;  1MY2 A;  1ZJL A;  2NVU B;  4IGT A;  3HFU A;  3SKP A;  1SW4 A;  1IIW A;  4NG7 A;  3FXU A;  4YMA A;  4EQ7 A;  1OQG A;  4ZEF A;  2G29 A;  2F5X A;  2I3W A;  3VDF A;  4PCD A;  5ITO A;  5IZ3 B;  1DTG A;  4HS7 A;  3VLW A;  2Y7P A;  1TFD A;  3W9W A;  2PBW A;  4I8C A;  1FBH A;  2UVJ A;  3OMB A;  3FXR A;  4IO4 A;  1IMB A;  3H6T A;  1DPP A;  5H8Q A;  4HXV A;  2R8T A;  4H8I A;  2V3Q A;  4EQ9 A;  3FJG A;  2PT2 A;  1R6Z A;  2GQ1 A;  4MAG A;  3B7D A;  3QK6 A;  4GD5 A;  2UVH A;  2QVV A;  2AL5 A;  4OMB A;  4IB2 A;  3WAF A;  1HSJ A;  4YKK A;  3ZKL A;  5AE4 A;  1IQ7 A;  1B32 A;  2R6G E;  1QVS A;  2DVZ A;  1G0H A;  4IY6 A;  3JZJ A;  3K0V A;  4FIM A;  2ANJ A;  4M4G A;  2XWV A;  2RKM A;  4NED A;  3FVG A;  1R9L A;  4QFL A;  1POY 1;  4ONY A;  3VV5 A;  1D9Y A;  4OVP A;  5T3J A;  1LB9 A;  4GF8 A;  4GX6 A;  3CFL A;  1EZO A;  3RY3 A;  3FJ7 A;  3T66 A;  3Q27 A;  4YB5 A;  2BJI A;  3U94 A;  1FQC A;  2XWI A;  3E9X A;  3RGY A;  3HHG A;  2DDK A;  3A29 A;  1NV5 A;  2GRV A;  3KOS A;  1Z7M E;  1IXC A;  5ET6 A;  2XXK A;  2O1L A;  2NXO A;  5EQ8 A;  2Z22 A;  3C35 A;  2LAO A;  4GWW A;  1FTJ A;  1Y3N A;  4GBV A;  4I3Y A;  5A5X B;  3RNN A;  2HQ0 A;  3PPR A;  2Y5K A;  2DE4 A;  2Y7K A;  2OK2 A;  2O1M A;  1AMF A;  1DSN A;  4ZE9 A;  4R2F A;  5AA4 B;  3BBR A;  3U1O A;  2OBG A;  2IA4 A;  3L6G A;  4R6K A;  1B5H A;  5DVF A;  1LBB A;  2O84 X;  3RLF E;  1MXU A;  4U4S A;  2O69 A;  2ZNU A;  2RC7 A;  3EQ1 A;  4C0R A;  4KI0 E;  1RDY A;  4U2R A;  3MW0 A;  3O29 A;  1LBX A;  4P47 A;  2XD3 A;  4I62 A;  3DM0 A;  3HO7 A;  1B7U A;  3T1B A;  3O6I A;  4YKI A;  2RC9 A;  5L9M A;  3RQT A;  5FTH A;  5TU0 A;  1B6H A;  1YYZ A;  2A5S A;  2ZZX A;  4NTL A;  2AYS A;  3CRB A;  1B3H A;  3T96 B;  2XWO A;  2OWS A;  2ONS A;  5ICT A;  1IMD A;  4LAT A;  3U93 A;  3ZS6 A;  4KYS A;  1K9Z A;  2KLF A;  1GR2 A;  1MDP 1;  1Y3Q A;  1MQJ A;  1NMU A;  3K4U A;  4NF5 A;  5DVI A;  1XVY A;  1LBC A;  3C34 A;  4RPN A;  1H44 A;  2DWI A;  3QUF A;  4MNI A;  1MQD A;  4GWZ A;  2WKY A;  3VFJ A;  1B51 A;  4KYD A;  5BWJ A;  1B5J A;  4E0W A;  1Q9D A;  4LZ5 A;  3V5A A;  3IX1 A;  1H43 A;  2FA7 A;  4AQ4 A;  2WEF A;  4MBP A;  2Z8D A;  5JK4 A;  2THI A;  4QSC A;  1D9V A;  4N8Y A;  2DWH A;  3ILU B;  3RT8 A;  1PEB A;  2WYP A;  3EPE A;  2HAU A;  3OEK A;  1SPI A;  4MHF A;  2NUV A;  2B3F A;  3FZV A;  3E79 A;  3CVG A;  1UTB A;  3OEL A;  1B3G A;  1FBE A;  4F3B A;  1IMF A;  2Q2C A;  4QSD A;  4R74 A;  3SET A;  4U22 A;  5CBR A;  1AL3 A;  1HSL A;  4OES A;  3B50 A;  5H8F A;  4RY1 A;  5A5L A;  1NKX A;  2P3V A;  4Q5T A;  3E13 X;  3GZG A;  5J16 A;  4F39 A;  1LST A;  4MJO A;  1NV1 A;  1MM6 A;  2V93 A;  1FSA A;  1PB7 A;  4FAT A;  2DP8 A;  5EYG A;  2CEY A;  2MKZ A;  4OXV A;  1A55 A;  1LBW A;  4AB5 A;  5CMK A; 
#chains in the Genus database with same CATH homology
 2JJK A;  3W9W A;  4O8M A;  1NV4 A;  1FBH A;  1DCU A;  1EYI A;  2Y5K A;  2DE4 A;  1NUX A;  2Q8M A;  1Q9D A;  5I3S A;  2Y5L A;  2B4M A;  2L5V A;  3ROJ A;  2CZK A;  4HCW A;  1G0I A;  3ISP A;  1IMB A;  1LBZ A;  2WX9 A;  4PGP A;  4X8R A;  2WYK A;  5EQA A;  4XEQ A;  5EYH A;  2QVR A;  3RPL A;  3KC1 A;  4PBH A;  1RDZ A;  4NN3 A;  4OAN A;  4HXV A;  2R8T A;  2P3N A;  2PFZ A;  1FPL A;  2V3Q A;  3E78 A;  5FBP A;  4GWU A;  2VPO A;  2WEF A;  3BIH A;  1FPD A;  1EYK A;  2DE2 A;  2VPN A;  4I40 A;  4P1L A;  4PDD A;  3LUZ A;  5JK4 A;  1FTA A;  4P3L A;  5ET7 A;  2HXR A;  2GQ1 A;  3PTY A;  4MAG A;  4N8Y A;  5LDZ A;  1FBD A;  5IZ1 A;  1KZ8 A;  4QXD A;  5ET8 A;  1LBY A;  2WYP A;  4GWY A;  2PFY A;  5ESY A;  1FJ9 A;  3SZP A;  4NGU A;  1KA0 A;  4GX4 A;  2ZZW A;  4N91 A;  4PE3 A;  2HPG A;  4PDH A;  3NOH A;  2FIX A;  4I3E A;  3IFA A;  4DI3 D;  1SPI A;  2QVU A;  2F3D A;  2QVV A;  4P1E A;  3B8B A;  4MHF A;  1RDX A;  1FBG A;  2FIE A;  4F18 A;  1FBP A;  2WBD A;  1DBZ A;  4MX6 A;  4F19 A;  1FPK A;  5LTC A;  4JVI A;  1BK4 A;  3E79 A;  4IR8 A;  1YZ0 A;  4AS5 A;  1FBE A;  4KXP A;  2B4L A;  4M1V A;  1QGX A;  4JVD A;  3FBP A;  1FPB A;  1IMF A;  1RDY A;  2DVZ A;  1G0H A;  1NV7 A;  1NV0 A;  1YXI A;  3QMF A;  4GWS A;  4PAK A;  1LBX A;  4PAF A;  4P47 A;  4P8B A;  1NUY A;  2ZZV A;  5ET5 A;  4DI4 B;  1INP A;  5IM2 A;  1NUW A;  2XWV A;  4P9K A;  1VDW A;  2WBB A;  3T1B A;  2FVZ A;  1FRP A;  2F3B A;  1XI6 A;  2HZL A;  2QPQ A;  5J1D A;  2VT5 A;  1LBV A;  1FJ6 A;  2OWZ A;  3IFC A;  4GBW A;  4MIJ A;  4N17 A;  4N6K A;  4OVS A;  3MST A;  4PFI A;  5IGA A;  5CM6 A;  1FPI A;  1NUZ A;  2Q9T A;  1CNQ A;  3U65 A;  4GWX A;  2KQZ A;  4MNP A;  1IMC A;  4N81 A;  2HZK A;  1YYZ A;  2KR0 A;  2HHM A;  3B50 A;  4O7M A;  2XA5 A;  1D9Q A;  2ZZX A;  4G61 A;  4LN5 A;  4OVP A;  4OA4 A;  5A5L A;  4N4U A;  3KBZ A;  5T3J A;  2DE3 A;  1NV2 A;  3D1R A;  4MEV A;  4N15 A;  5EQ9 A;  2P3V A;  2XWO A;  4PET A;  2CZH A;  1IMD A;  4OVT A;  4PAI A;  4PF8 A;  4MCO A;  2QFL A;  4GX6 A;  4H45 A;  4O94 A;  1NV3 A;  5J16 A;  2XWK A;  3BIG A;  4AS4 A;  1IMA A;  4HE1 A;  4PFB A;  4OVQ A;  3KC0 A;  4UAB A;  5DW8 A;  4PF6 A;  2PCR A;  2FBP A;  4N6D A;  4PC9 A;  4X9T A;  2OX3 A;  4XF5 A;  5IZZ A;  4MJO A;  4NX1 A;  1K9Z A;  1KA1 A;  4PFR A;  4YZZ A;  1FBF A;  1K9Y A;  1NV1 A;  5EQ7 A;  2BJI A;  1JP4 A;  4NF0 A;  3T0J A;  3LV0 A;  3CHG A;  4O7I A;  4PBQ A;  1FSA A;  2XWI A;  4NHB A;  1FPF A;  4FBP A;  5I7I A;  1LEV A;  4H46 A;  2CZI A;  1NI9 A;  4NAP A;  2DDK A;  1IME A;  4MMP A;  2V4C A;  3FXB A;  3HFU A;  3A29 A;  4I3Y A;  1EYJ A;  4GX3 A;  4PTK A;  1NV5 A;  4X04 A;  4YIC A;  5EYG A;  4NG7 A;  1FPJ A;  3RPL B;  1FBC A;  4XFE A;  5ET6 A;  5I5P A;  1FPE A;  2XXK A;  4F1V A;  3RYD A;  4QBA A;  1FPG A;  1DK4 A;  1NV6 A;  4HE2 A;  2F5X A;  4NQ8 A;  2CEY A;  4MNC A;  3EKI A;  4JVC A;  4MNI A;  3W9V A;  5IZ3 A;  2MKZ A;  5F24 A;  5EQ8 A;  4F1U A;  1LBW A;  4HE0 A;  4N8G A;  4PCD A;  4OVR A;  3GYY A;  5IZ3 B;  2CEX A;  3MYU A;  4GWZ A;  2Q74 A;  4GWW A;  1AWB A;  4GBV A;  4P56 A;  4HCY A;  4PGN A;  2FHY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...