4OVTA

Crystal structure of a trap periplasmic solute binding protein from ochrobacterium anthropi (oant_3902), target efi-510153, with bound l-fuconate
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
301
structure length
301
Chain Sequence
ANVSIKVAYENNPGEPFDEVMHYWKDDLAKRSNGEITLELYPSSQLGSKKDVTEQAMMGLNVVTISDVGFLAEYDPDLGVLYGPFLTDDPAQLFKVYDGPWFKEKSEELKKKGIHIVMPNYLYGIRQIISKKPIRTPEDLKGMKIRVPNNVMQIKTFEAMGATPTPMPLGETFPALAQGVIDGVENPISVLYGQKFQEEAKYLSKVGYLTNVALIVGGEAFFSTLPEDQLKMIHESAYDAGLYSQKLTIEKDNEMIEKMKEAGVEIIDVDRAPFKALAEKVYTQFPEWSPGLYDKIKAELN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Experimental strategies for functional annotation and metabolism discovery: targeted screening of solute binding proteins and unbiased panning of metabolomes.
pubmed doi rcsb
source organism Ochrobactrum anthropi
molecule tags Solute-binding protein
molecule keywords TRAP dicarboxylate transporter, DctP subunit
total genus 102
structure length 301
sequence length 301
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03480 DctP Bacterial extracellular solute-binding protein, family 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 4ovtA00
2PFZA 4P8BA 4PAFA 2XXKA 4DI3D 4OANA 2PFYA 2V4CA 4PC9A 4O7MA 5IZZA 4O94A 4OVRA 4P47A 4PFBA 4XEQA 2XWKA 5IGAA 2VPNA 4OVPA 4MNPA 4MNCA 2CEXA 4MIJA 4PE3A 4OVQA 4UABA 4PAKA 5CM6A 2WYPA 4NAPA 4P3LA 4N8YA 4OA4A 2WYKA 3FXBA 4YZZA 4MHFA 4MCOA 4PF6A 4NX1A 4N15A 2VPOA 4NQ8A 2HZKA 4PBQA 2ZZVA 4NF0A 2XWVA 4NHBA 5I5PA 4PETA 2CEYA 4PGNA 3U65A 4NGUA 4OVSA 4PAIA 2ZZWA 4P1LA 4PGPA 2ZZXA 2XA5A 4PCDA 4PDDA 3GYYA 4N4UA 4PF8A 4PFIA 4XFEA 4N91A 4N17A 4P56A 4MMPA 2HZLA 4OVTA 4DI4B 4N6KA 4PFRA 4NG7A 4MEVA 4P9KA 4N8GA 4MAGA 4X8RA 2WX9A 4PBHA 4NN3A 4XF5A 4X04A 4N6DA 2HPGA 4YICA 4LN5A 2XWIA 2XWOA 5I7IA 4O8MA 5IM2A 4MX6A 5LTCA 4PDHA 4P1EA 4MNIA 3B50A
chains in the Genus database with same CATH superfamily
2I49A 3MJNA 2RF1A 2O51A 4P8BA 3MC2A 2XXKA 2PFYA 2X7QA 4O7MA 3BBRA 1VR5A 4F1YA 1A55A 4ISUA 1FQCA 1Y1MA 4YKIA 1N84A 2FIXA 3RPWA 3ONMA 4MJOA 3KN8A 4FBPA 3VDFA 3TAJA 1UQWA 3HSTA 3FXBA 1GGGA 4NQ8A 4IO2A 2XXIA 2O68A 3IOTA 3B6WA 3F11A 4I8CA 3ILUB 1G0HA 4HE1A 3KGCA 5I5PA 1OIBA 3MZ1A 3A3UA 4QXDA 4QFLA 4PFYA 4NGUA 3EHTA 2Z8FA 1H45A 1ATGA 1JQFA 3KC0A 4PF8A 3OENA 1MS7A 2REGA 1VDWA 3M3LA 1YXIA 2Y5LA 1DBZA 1Q35A 3KN7A 4POWA 4LZ7A 3W15C 4KPTA 3C31A 4BDLA 2O1MA 1CE2A 2I48A 4XF5A 4FEDA 1FPKA 3TTNA 4GL8A 4LN5A 3PUVE 4ZZEA 4N6PA 1JVXA 2UVIA 5I7IA 3EHSA 3I5OA 5LTCA 3IJXB 3SEVA 4R2BA 5I57A 3VLUA 3LSFB 4GL0A 3K6UA 4EXLA 4JB7A 1DCUA 2P3NA 4ZS9A 1SW5A 3DP8A 1CB6A 2XWKA 1FJ9A 1NFTA 2QVRA 3MQ9A 1H43A 3S9MC 4NWDA 5ITOA 1SDXA 1A8FA 4QFKA 3R26A 3OO8A 1P99A 2F35A 1N76A 4OYVA 2P1SA 1NV3A 5DVJA 4NF8A 1QULA 4DDDA 3A29A 2NOOA 2UVHA 2HAUA 2XWVA 4WEPA 2PT2A 1XVYA 3GXAA 2PX1A 4RXLA 1PBQA 5FTIA 4BDRA 3T9VA 3K4UA 3VLWA 2ZZXA 1XT8A 4H8IA 4H46A 1MQDA 3IORA 5H8SA 4MLQA 1BLFA 3H06B 1NV4A 1M5CA 1R9QA 4DI4B 4G4PA 4MLVA 3E13X 4RY1A 2VP1A 4QFOA 5FTHA 4YMBA 1A54A 2B65A 2ZYOA 3T22A 1FPFA 1EZPA 3UIFA 1DSNA 4IB2A 1DMBA 4PBHA 1MM7A 4X04A 4TLLB 2V3UA 1YTVA 4G2ZA 2I3VA 1JEVA 3TCHA 3W9VA 3K1PA 5I59A 5CMBA 3TPAA 3IOUA 5KDTB 1R9LA 3CG3A 2ZNUA 2PFZA 5HM4B 1MQGA 4ZZAA 1LFIA 1NUYA 1LBCA 2H4IA 2G93A 3T93B 1OVBA 3N6TA 2P3VA 5I59B 5KCJA 4F3PA 4X1BA 4GXSB 4TOZA 2F3DA 1OQGA 4G68A 2XD2A 4OVQA 1J1NA 4ELRA 1B2HA 2PMSA 1AOVA 5TP9A 4HE0A 4YMAA 3SESA 4PF6A 4NX1A 2JJKA 3N26A 1SI1A 3U93A 3KOTA 2H25A 5EQ7A 3CFXA 2ONSA 3EN3A 2ZYKA 1MY3A 4POXA 2XX7A 1NV0A 1LAHE 1ZKBA 3K1NA 4ZDMA 3QXMA 4G8HA 5EYHA 1I6AA 4P56A 3VFJA 1O63A 4R74A 4F31B 2OWSA 2DWHA 5FBPA 1ZIUA 3QIMA 1FPIA 4NF5A 4N13A 3O6GA 1QKBA 1M5EA 4N8GA 2XHDA 3S2VA 3C33A 4X8RA 1GVCA 4H6DA 3RQTA 5ESYA 5TPAB 1RDXA 4RPNA 2HQ0A 4I3YA 2DWIA 3G7WA 2XXWA 1FPEA 1D9QA 4RJZA 4PDHA 1I69A 5IAIA 1FTJA 1RYOA 4KD5A 4ESXA 4G8MA 5IZZA 4O94A 4Q30B 3FXUA 4TQUQ 2CZKA 3RGYA 1S50A 3A09A 5EHMA 1B05A 4G68C 1MQHA 2V84A 4LQ2A 4ZEBA 3T0JA 5CMKA 4XIGQ 4LZ5A 5AA1A 4I9DA 4GFRA 3K00A 2DQVA 1FBGA 5B7DA 2DDKA 3TELA 2F6PA 4R9GA 1P1NA 2VGQA 1ZTYA 1IXIA 1N7XA 2PBWA 3GZGA 4KCDA 1P1OA 4P1LA 4ZEIA 1M5FA 3QAXA 1LBBA 4LZ8A 1XI6A 1UTHA 4MMPA 2R8TA 1MPDA 1SVXB 3K6XA 4AB6A 2R6GE 1MM6A 3U72A 1ZMGA 3FJMA 1FTMA 1H3DA 1UTHB 3PMXA 4R75A 5EQ9A 1AIVA 4NN3A 3Q29A 2DYXA 2I58A 5BWJA 4EQ7A 2F78A 4O8MA 4QFNA 1H76A 3K6VA 2VD3A 1BK4A 1SYHA 4F39A 4P1EA 2RCBA 5ET8A 3LSXA 3OD7A 1PB8A 2NVUB 3WAFA 3H4ZA 1NH7A 1B52A 4GQOA 5H8FB 4LA9A 5FHMA 4YKPA 1N7WA 2XXUA 3CFZA 1IZ1A 1URSA 3T9XB 1YPNA 2OK2A 2O7IA 3OO6A 4Q0CA 3MUQA 3PUYE 4DXUA 1Z7ME 4F19A 3TQWA 1VSOA 5F7VA 2X7PA 3E9XA 2WYKA 4MHFA 1OMPA 4GBVA 4RA1A 4F2OA 2FIEA 4NF5B 4KCCA 1M5BA 3FJGA 4H5GA 4I1DA 4F1UA 3SEUA 5JEIA 2Z8EA 3IL1B 1SBPA 2ZNTA 3CFLA 4IO4A 1NV2A 4FIMA 4H8JA 3O6IA 5KZTA 1LBWA 3O6HA 1BTJA 1S7YA 3H6TA 4R2FA 5LDZA 3PPRA 2LAOA 4IY5A 3Q25A 4XXUA 4GX6A 2GHAA 3FV1A 3JYRA 2UVGA 2D21A 1LAFE 1LB9A 1IMAA 3G3GA 4MEVA 4EF2A 3PD8A 4K3FA 3KSXA 4U4XA 1IIWA 3MW0A 4GVOA 3TTKA 2OZZA 1A40A 4DCXA 3U1OA 3RT6B 2I0CA 1R1NA 3QUJA 4O3CA 1B3FA 3CSGA 2AIXA 3I6VA 4PTKA 1FBFA 4U22A 3K2DA 2DWAA 3IB1A 2OWTA 3RT8A 4R72A 1K9ZA 4BDQA 2CEXA 4PFTA 2UYFA 4ZEDA 3TQLA 4P3LA 4U1ZA 3VXCA 5CMMA 4Z0IA 2F36A 3OELA 3SDFA 1BKAA 2ZZVA 1QUJA 1US4A 3FD3A 4DIGA 5CC2A 5CBSA 1FTAA 3TTLA 3U8QA 3HO7A 5A5LA 3QSLA 4X48A 5EQ8A 1K9YA 2QS1A 4P0GA 2OBGA 4PE5B 4OEUA 4RNSA 1B7ZA 3FVOA 1AL3A 2V3TA 1MPCA 2XXHA 4OZ9A 4KQPA 1FBEA 4ZE9A 5F24A 4H5FA 4OETA 2DVZA 4P9KA 1FCKA 3K0VA 4N6DA 1ZU0A 1WDNA 1R6ZA 3PU5A 3WAEA 3KN3A 4JDFA 3H3GA 4IR8A 1F9BA 3PPOA 2ALUA 1N04A 1QW0A 4FAJA 1FQBA 2QS2A 2R9JA 1MXYA 2DE2A 4I3EA 4OMBA 1D4NA 2D5WA 1EH3A 4KI0E 1UTBB 3HHGA 4F3SA 1B58A 4ZE8A 3DP6A 4FEBA 2GRVA 1B7UA 4MNPA 4MIJA 5AA3A 2CZLA 3C32A 4XKRA 4UA8A 3KC1A 2H9BA 1GTKA 5EQAA 4F3BA 4HCYA 4R6HA 2VPOA 3O66A 1GR2A 3TDJA 3IO4A 2GQ1A 4ND9A 4PETA 2L5VA 1MDQA 2UVJA 5FHOA 1TT1A 1S9TA 5T3JA 3TMGA 4PAIA 1O64A 4F29A 2I6EA 4OENA 3KFMA 3GYYA 3UA8A 3Q26A 1ZBMA 3ZKKA 1MRPA 1B40A 3IFAA 4OQOA 1LBZA 1P1QA 4NE4A 2P2AA 4PFUA 3KJ7A 3KG2A 1XHYA 2MKZA 1USYH 4QSEA 2D3IA 4GXAA 4L17A 1VFDA 4H1XA 5EYGA 4EQ9A 2HPGA 3IFCA 2Y7KA 2I3WA 1PC3A 5DEXA 3ROJA 1MG1A 2Q9TA 3MVWA 3MP8A 4UACA 1LGBC 4H45A 3MP6A 3EQ1A 4BDMA 1FJ6A 4DXCA 2F7AA 1SI0A 3I3VA 1TWYA 1YYZA 5M2VA 5DW8A 4QRZA 4LONB 4GWWA 1JP4A 2QVVA 2ZMBA 4PE3A 2DVCA 2WYPA 4O3AA 4GWYA 5I2KB 4IO3A 2OX3A 2Z22A 4OERA 1Y1ZA 2GH9A 2HZKA 3TYHA 1NV1A 5H8HB 5A5XB 3LSWA 2QVUA 3MVZA 4ELQA 1HSEA 2Q89A 3IJOB 4ESWA 3VVFA 1JETA 1LAGE 3HV1A 1BP5A 3UORA 1PEBA 3OEMA 2XXYA 2Q8JA 4RPOA 5EHSA 5IZ1A 1G0IA 1NKXA 3EHUA 3LC8A 3S9EA 1O7TA 3OSQA 3TFLA 3CI8A 3T9HB 4FJPA 1TFAA 3FVNA 1YAEA 2WX9A 1OVTA 3BIHA 2A5SA 3VE1B 1MY2A 3THIA 1I6QA 4FE8A 2DOJA 1QKAA 3KBZA 3C4MA 3EKIA 1FBHA 3FZVA 4R9FA 4AS5A 3RTWB 2QL3A 3B50A 4F3GA 1UIVA 3PTYA 1NNFA 3H03A 3V5AA 1LCTA 3CRBA 1NNTA 4I62A 4OVRA 4HE2A 3TZAA 3QYTA 3ZS6A 5IGAA 1B1HA 3E4RA 3MZBA 2V93A 3RN8A 2O7UA 3H6VA 4YKJA 3GBBA 5CM6A 1RDYA 3H6WA 2QJEA 3BFUA 1N0TA 2QRYA 3FXQA 2XXTA 1QVSA 2V3QA 4GOTA 2XXPA 3D4CA 1FBDA 1Y9UA 1NH8A 1DPPA 4PFWA 4OVSA 2FNCA 1OLAA 4KYSA 1MY1A 1FSAA 4XFEA 4N91A 3BFTA 5B70A 2YJPA 3L6HA 2B4LA 4N6KA 5I3SA 4PFRA 1BIYA 1MQIA 3FJ7A 5I2NB 4EF1A 3LV0A 1FPJA 2O84X 4MAGA 1FTOA 1MXWA 4YU0A 4OFOA 2VHAA 2QMWA 2F6GA 1NV7A 2RKMA 3FBPA 3M3FA 4GLIA 1KZ8A 2XD3A 2QPQA 4O7IA 4AB5A 2HEUA 4GX4A 3TKDA 4G8NA 1LBXA 1D9YA 4NEDA 4ZECA 4WXJA 1PBPA 1B1XA 1LEVA 1KA0A 3RLFE 4XKPA 4N07A 3Q28A 4LQ5A 4NF4B 1MXZA 1MY0A 3L6GA 2X26A 1MH3A 4AS4A 2HHMA 3G3JA 4YB7A 5CMCA 1SQYA 5I58A 4NTLA 4MNCA 5DEXB 4QF9A 2F7CA 1RKMA 4HCWA 2F5XA 4KXPA 2HXRA 3O29A 2O69A 4C1TA 1B0LA 1NL5A 4X9TA 4PGNA 1A7LA 1SPIA 2IEEA 2RC9A 5AA2D 3SKPA 1SW1A 5IZ3B 3AXFA 3S9LC 3C34A 5I2KA 3FATA 4E0WA 1SYIA 3PMVA 3SEYA 4H0WA 1Y3PA 3C35A 1H44A 2PVUA 4P11A 1B5HA 3ZKLA 1YCJA 1DOTA 2DE3A 4DCYA 1D3KA 1FQFA 3H7MA 1LSTA 4JBZA 5H8NA 4OTEA 4JSOA 3O9PA 3OMBA 1XS5A 2Q2CA 4EQBA 4GIZA 1RDZA 5IKBA 3T66A 3C36A 1B7HA 5TP9B 1USYE 3E78A 2XWOA 4MX6A 4EUOA 5EYFA 1NUXA 1JW5A 2QS4A 4MNIA 1FBCA 4JVIA 1VFEA 2R71A 1FQEA 3IOVA 4OANA 4YAHX 1SW2A 2REJA 1A99A 2QSXA 4HS7A 4P47A 3MZ9A 4QSCA 4FORA 2DXYA 4BDNA 3K02A 5ET5A 4MBPA 5L9OA 2Y7RA 4OVPA 3FVGA 5F1QA 4GWOA 1DTZA 1MH4A 4PAKA 2B4MA 3D1RA 3IAZA 1MXXA 4OA4A 2OWZA 4MCOA 4DZ1A 2DWJA 1B46A 4E0XA 1DTGA 2RCAA 4ELPA 4NF0A 5TPAA 2H5YA 4U21A 2KLFA 3HHFA 4QSDA 1TXFA 4GWUA 2Q2AA 4XKQA 5I56B 1LBYA 1T0KA 4PDDA 3FUZA 2YLNA 3V8XB 3RPLA 1EZ9A 1LFGA 3TTMA 2Y5KA 3T1BA 3MBPA 5DT6A 1AH5A 4U23A 3MP1A 2BJJX 4OWDA 5AA4B 3D4GA 3U94A 4LATA 4THIA 1POY1 1LB8A 4OFJA 5H8QB 1DK4A 4IGTA 3PD9A 3FGSA 2XXQA 4RYAA 1B5IA 1JNFA 5AA4A 1CNQA 3O97A 4BLAA 4F22A 2HXWA 5DVFA 5KDTA 2NXOA 3OEKA 4FATA 1TFDA 2KR0A 2CZHA 1URDA 1FTLA 1ZLQA 5A5XA 1HSLA 5JTYA 2OJTA 2XX8A 4NAPA 4YB5A 4ONYA 5AE4A 1AWBA 3B6QA 4PP0A 2Q8MA 1QJMA 2Y84A 4IO5A 4MF3A 1HSJA 4N15A 3B6TA 3IB0A 4PBQA 2I4CA 4IGRA 1I6BA 3FXRA 3HCQA 4U1OA 3V83A 2B3FA 3PPQA 3E3KA 3USDA 2B3BA 3OOAA 4NF4A 3ZSFA 3U65A 2GFEA 2ZNSA 4KHZE 1IXCA 1ELJA 2Y7IA 1IQ7A 2VT5A 3MPLA 1WVJA 2UYEA 3MSTA 4N81A 4PCDA 3IR1A 4N4UA 3ILTB 2WKYA 2Y7PA 2ESNA 1NMUA 3TEPA 5K2YA 4N17A 3P7IA 3RYDA 3VVDA 3CIJA 4OVTA 4MFIA 1QGXA 3K6WA 4NG7A 4OEVA 2FYIA 4ZEKA 1XVXA 4KFQA 1IMBA 1N3XA 2V25A 1FW0A 1LAXA 1N3WA 3G3HA 4BDOA 1XC1A 4R73A 1FTKA 4GWXA 3M8UA 1D9VA 5LOMA 3SETA 5ET7A 3JZJA 2H98A 1WODA 1Y4TA 3N94A 4JSDA 2UXAA 4LUBA 3KEIA 3B8BA 2RC8A 3KZGA 5CRYA 3TCGA 3TTRA 1B3EA 1MQJA 2IA4A 2HAVA 2WEFA 3OSRA 3VV5A 1Q1KA 5FHNA 4JWXA 3Q27A 3DM0A 3H6UA 4R6YA 3PPPA 3RY3A 3RPLB 5J16A 1Y20A 4GD5A 3U92A 4OVJA 4Q8RA 4X1DA 2CMOA 4QBAA 1GV8A 2PCRA 3B7DA 3NOHA 1MY4A 3DELB 2I0BA 3KOSA 4NWCA 4F1VA 1EYIA 2ZZWA 5CBRA 4IO7A 3FIRA 5H8QA 5DYHA 4EXKA 1MXVA 2Z8DA 1B3HA 1JEUA 3O28A 2XXXA 3UN6A 5L9MA 2HZLA 5JK4A 5H8NB 2E0SA 4RK2A 3S9NC 4XTCQ 3ODBA 1OLCA 3VLVA 3KJTA 1VE4A 1B32A 1QUKA 2A5TA 4WEDA 3OO9A 4DXBA 1P1WA 4DE8A 4GWSA 1SD3A 1NNKA 1FPLA 1OQHA 5AA2B 3CG1A 1EYKA 1LLSA 3PUXE 4RK9A 4GX3A 2DP8A 1IMEA 4G61A 3PV0E 3TCFA 3FASA 5I58B 4H65A 2DSFA 3VVEA 5HPQA 1FBPA 5ICQA 1AMFA 3G3KA 1DPEA 2VD2A 5H8FA 1PB9A 3DP4A 2XXRA 5I2NA 4LP2B 4DLDA 4HTGA 4QFPA 3IX1A 1NUWA 3K1MA 2CZIA 3JV9A 1FQAA 3MYUA 1IMCA 1INPA 4C0RA 2FHYA 4YZZA 1IUDA 4GF8A 4I40A 1SW4A 4F18A 3RUMA 1B0HA 1B6HA 1B51A 2NUVA 2Z23A 3G3IA 4HXVA 3LUYA 3OO7A 4MH5A 1JVYA 5ELVA 1UIUA 3MWBA 1IMFA 1KWHA 3SEXA 3HN0A 4PFIA 3CHGA 1FPBA 2HCAA 1Y4CA 1Y3QA 4WKMA 2XX9A 4ECFA 2THIA 2F97A 3BIGA 1UTBA 2QFLA 4NF6B 4OHNA 3MVYA 1PB7A 2QS3A 4P0IA 4OESA 1Z7NE 1B4HA 1II5A 2AL4A 5DVIA 4FECA 3OXNA 4XKNA 3GLBA 4NF6A 3EPEA 2Q74A 3N6UA 5TU0A 1P1UA 5BUUA 2F7BA 3C9HA 2ABHA 3PUWE 3G3FA 1Q9DA 2O6AA 1NV6A 2BJIA 2O1LA 4JWYA 5IZ3A 3QUFA 1FQDA 2AYSA 2ZYNA 3PPNA 1ZJLA 1RYXA 3A3CA 4ZEFA 2E1SA 2G29A 3IB2A 3MVXA 3N5LA 4PAFA 4DI3D 3RNNA 3FVKA 4PC9A 4U4SA 4JXIA 3SERA 5ITPA 1NUZA 1FPDA 3MPKA 4XEQA 4IY6A 1XOCA 1JW1A 2VPNA 2DXRA 3HFUA 1IITA 4H67A 5L9SA 4UABA 5L8DA 4C1UA 1B5JA 1EU8A 2RC7A 2GHBA 5J1DA 3O2AA 5I84A 4YKKA 3UK4A 5I56A 3QK6A 4PQJA 1MPBA 3MAMA 4GBWA 1EYJA 4IO6A 2I4BA 4O3BA 5DTBA 3S4UA 4YB6A 4NHBA 3PMWA 2DS9A 1B9JA 4F2QA 2A5TB 3UGWA 2KQZA 1IMDA 3TUSA 4JVDA 4GWZA 4KYEA 3PUZE 5HBCA 4JWOA 1QUIA 4OFLA 3LUZA 4QHQA 4NMYA 3IOWA 1KA1A 1IEJA 3QMFA 3R7XA 3BKIB 1NI9A 5I57B 1M5DA 3KSJA 1IXHA 2ZXTA 3KBRA 4JVCA 1URGA 4KYDA 3CR9A 1LCFA 4G77A 3FV2A 3LBSA 4YICA 2M8CA 4KR5A 2XWIA 1MXUA 5IM2A 2ONRA 5H8HA 1FPGA 1US5A 1B4ZA 2PYYA 2ONKE 1PDAA 2RINA 2P0SA 2QMXA 2WBDA 2OLBA 4NF8B 3EF7A 2FA7A 3LSLA 3M3KA 3K01A 3VXBA 1EZOA 2V4CA 1FRPA 2FBPA 4PFBA 1NV5A 4GRKA 1JW4A 3T96B 4R6KA 5KCJB 5AA2A 3TODA 2HFBA 1POTA 2NWJA 4G68B 3V89B 3CSBA 4ELOA 4N8YA 2VOZA 1YZ0A 3RTFB 3CVGA 3W9WA 2YPNA 2PT1A 2F8DA 4HW8A 2ANJA 2F3BA 4M1VA 2WBBA 4TLMB 3PGFA 2CEYA 3T9UA 2OCUA 5ET6A 1B3GA 2FVZA 3HPIA 1LBVA 3DLNA 1A8EA 4Z7EA 1LFHA 4PGPA 3R6UA 2XA5A 4M4GA 1IXGA 3SEWA 2AL5A 3IK6B 4EDPA 5K2XA 3UP9A 2ZYMA 1B3LA 3SZPA 1ANFA 2XXVA 5JTYB 5ICTA 1Y3NA 2F34A 4Q5TA 3ECRA 5ISUA 5CI5A 2Q88A 1MDP1 1L5TA 2Y7WA 3E79A 3LR1A 4AQ4A 2W7YA 3ISPA 2DE4A 4OXVA 3GBAA 2H99A 4LVQA 1NNPA 3IO6A 4U2RA
chains in the Genus database with same CATH topology
4G61A 5ET7A 3PTYA 1LEVA 2PFZA 1FBCA 2DE2A 4I3EA 4JVIA 4P8BA 5ET8A 1FJ6A 1KA0A 4PAFA 4PTKA 1FBPA 2XXKA 1FBFA 1NUYA 4OANA 1DCUA 2PFYA 2V4CA 4PC9A 4O7MA 5IZZA 1YYZA 2P3NA 1FRPA 4O94A 3B8BA 2FBPA 2KR0A 4OVRA 2P3VA 4HE2A 5DW8A 2CZKA 4P47A 3W9WA 2CZHA 4PFBA 1NUZA 1FPDA 1FJ9A 1NV5A 2QVRA 2XWKA 4GWWA 2WEFA 4XEQA 5IGAA 1JP4A 2VPNA 2FIXA 5ET5A 1K9ZA 4AS4A 2HHMA 2QVVA 3HFUA 4MJOA 2F3DA 4OVPA 4MNPA 4MNCA 2CEXA 1NUWA 2CZIA 4MIJA 4OVQA 4PE3A 4F19A 3T0JA 4UABA 4FBPA 4PAKA 5CM6A 2WYPA 4NAPA 4GWYA 4DI3D 1RDYA 3KC1A 3MYUA 4P3LA 1IMCA 5EQAA 4HCWA 1INPA 2B4MA 1AWBA 2F5XA 3D1RA 2FHYA 4N8YA 4OA4A 5J1DA 2WYKA 2OWZA 3FXBA 4YZZA 2Q8MA 1YZ0A 3RPLB 1FBGA 2OX3A 4MHFA 1NV3A 4HE0A 4HCYA 4I40A 4MCOA 5J16A 4PF6A 4NX1A 2DDKA 2JJKA 2VPOA 2HXRA 4GBVA 4KXPA 2HZKA 4N15A 4NQ8A 4F18A 2V3QA 4PBQA 4GBWA 1NV1A 1EYJA 2FIEA 4QBAA 3A29A 2ZZVA 4NF0A 2F3BA 2XWVA 2QVUA 1G0HA 4M1VA 5EQ7A 4NHBA 2WBBA 2GQ1A 2PCRA 4F1UA 4HE1A 1FBDA 3NOHA 5I5PA 1FTAA 2CEYA 4PETA 4HXVA 2L5VA 4X9TA 2KQZA 4PGNA 4QXDA 5T3JA 3U65A 4F1VA 1IMDA 1SPIA 4GWUA 4NGUA 1NV0A 4OVSA 2FVZA 4PAIA 1LBVA 5ET6A 1EYIA 2VT5A 2ZZWA 1LBYA 4P1LA 3MSTA 4PGPA 5IZ3B 2ZZXA 2XA5A 4JVDA 1IMFA 4GWZA 4N81A 4PCDA 4PDDA 1FSAA 5A5LA 1NV2A 3KC0A 3GYYA 4N4UA 1XI6A 4PF8A 4PFIA 4N91A 4XFEA 5EQ8A 3CHGA 1K9YA 5EYHA 4H46A 1FPBA 1LBWA 1VDWA 4N17A 4P56A 5IZ1A 3RYDA 1YXIA 1G0IA 2Y5LA 4MMPA 1DBZA 3LUZA 3RPLA 3IFAA 5LDZA 5FBPA 1KA1A 1LBZA 1NV4A 3BIGA 2HZLA 2R8TA 3QMFA 4OVTA 3SZPA 5JK4A 2QFLA 1NI9A 2B4LA 2DE3A 1FPIA 2Y5KA 4AS5A 4GX6A 4DI4B 4N6KA 5I3SA 4PFRA 1QGXA 4NG7A 1FBEA 3T1BA 2MKZA 5F24A 3LV0A 1FPJA 1IMAA 2DVZA 1IMBA 4JVCA 4MEVA 4P9KA 4N8GA 4MAGA 1FPFA 5EQ9A 4X8RA 1RDZA 2WX9A 3BIHA 4GWSA 4NN3A 4PBHA 4XF5A 5EYGA 1FPKA 5ESYA 4X04A 4N6DA 3E79A 1NV7A 1FPLA 1RDXA 2Q74A 3FBPA 2HPGA 3IFCA 4YICA 1DK4A 3ISPA 4I3YA 2DE4A 4LN5A 1KZ8A 1EYKA 2QPQA 3E78A 4O7IA 2XWIA 1Q9DA 2XWOA 5I7IA 1NV6A 4IR8A 4O8MA 5IM2A 1FPEA 2BJIA 4MX6A 3KBZA 3ROJA 3W9VA 5LTCA 1D9QA 3EKIA 1FPGA 1NUXA 4GX3A 1FBHA 4GX4A 2Q9TA 4GWXA 1BK4A 4PDHA 5IZ3A 1LBXA 1CNQA 1IMEA 4H45A 4P1EA 2WBDA 4MNIA 3B50A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PFZ A;  4P8B A;  4PAF A;  2XXK A;  4DI3 D;  4OAN A;  2PFY A;  2V4C A;  4PC9 A;  4O7M A;  5IZZ A;  4O94 A;  4OVR A;  4P47 A;  4PFB A;  4XEQ A;  2XWK A;  5IGA A;  2VPN A;  4OVP A;  4MNP A;  4MNC A;  2CEX A;  4MIJ A;  4PE3 A;  4OVQ A;  4UAB A;  4PAK A;  5CM6 A;  2WYP A;  4NAP A;  4P3L A;  4N8Y A;  4OA4 A;  2WYK A;  3FXB A;  4YZZ A;  4MHF A;  4MCO A;  4PF6 A;  4NX1 A;  4N15 A;  2VPO A;  4NQ8 A;  2HZK A;  4PBQ A;  2ZZV A;  4NF0 A;  2XWV A;  4NHB A;  5I5P A;  4PET A;  2CEY A;  4PGN A;  3U65 A;  4NGU A;  4OVS A;  4PAI A;  2ZZW A;  4P1L A;  4PGP A;  2ZZX A;  2XA5 A;  4PCD A;  4PDD A;  3GYY A;  4N4U A;  4PF8 A;  4PFI A;  4XFE A;  4N91 A;  4N17 A;  4P56 A;  4MMP A;  2HZL A;  4OVT A;  4DI4 B;  4N6K A;  4PFR A;  4NG7 A;  4MEV A;  4P9K A;  4N8G A;  4MAG A;  4X8R A;  2WX9 A;  4PBH A;  4NN3 A;  4XF5 A;  4X04 A;  4N6D A;  2HPG A;  4YIC A;  4LN5 A;  2XWI A;  2XWO A;  5I7I A;  4O8M A;  5IM2 A;  4MX6 A;  5LTC A;  4PDH A;  4P1E A;  4MNI A;  3B50 A; 
#chains in the Genus database with same CATH topology
 2I49 A;  3MJN A;  2RF1 A;  2O51 A;  4P8B A;  3MC2 A;  2XXK A;  2PFY A;  2X7Q A;  4O7M A;  3BBR A;  1VR5 A;  4F1Y A;  1A55 A;  4ISU A;  1FQC A;  1Y1M A;  4YKI A;  1N84 A;  2FIX A;  3RPW A;  3ONM A;  4MJO A;  3KN8 A;  4FBP A;  3VDF A;  3TAJ A;  1UQW A;  3HST A;  3FXB A;  1GGG A;  4NQ8 A;  4IO2 A;  2XXI A;  2O68 A;  3IOT A;  3B6W A;  3F11 A;  4I8C A;  3ILU B;  1G0H A;  4HE1 A;  3KGC A;  5I5P A;  1OIB A;  3MZ1 A;  3A3U A;  4QXD A;  4QFL A;  4PFY A;  4NGU A;  3EHT A;  2Z8F A;  1H45 A;  1ATG A;  1JQF A;  3KC0 A;  4PF8 A;  3OEN A;  1MS7 A;  2REG A;  1VDW A;  3M3L A;  1YXI A;  2Y5L A;  1DBZ A;  1Q35 A;  3KN7 A;  4POW A;  4LZ7 A;  3W15 C;  4KPT A;  3C31 A;  4BDL A;  2O1M A;  1CE2 A;  2I48 A;  4XF5 A;  4FED A;  1FPK A;  3TTN A;  4GL8 A;  4LN5 A;  3PUV E;  4ZZE A;  4N6P A;  1JVX A;  2UVI A;  5I7I A;  3EHS A;  3I5O A;  5LTC A;  3IJX B;  3SEV A;  4R2B A;  5I57 A;  3VLU A;  3LSF B;  4GL0 A;  3K6U A;  4EXL A;  4JB7 A;  1DCU A;  2P3N A;  4ZS9 A;  1SW5 A;  3DP8 A;  1CB6 A;  2XWK A;  1FJ9 A;  1NFT A;  2QVR A;  3MQ9 A;  1H43 A;  3S9M C;  4NWD A;  5ITO A;  1SDX A;  1A8F A;  4QFK A;  3R26 A;  3OO8 A;  1P99 A;  2F35 A;  1N76 A;  4OYV A;  2P1S A;  1NV3 A;  5DVJ A;  4NF8 A;  1QUL A;  4DDD A;  3A29 A;  2NOO A;  2UVH A;  2HAU A;  2XWV A;  4WEP A;  2PT2 A;  1XVY A;  3GXA A;  2PX1 A;  4RXL A;  1PBQ A;  5FTI A;  4BDR A;  3T9V A;  3K4U A;  3VLW A;  2ZZX A;  1XT8 A;  4H8I A;  4H46 A;  1MQD A;  3IOR A;  5H8S A;  4MLQ A;  1BLF A;  3H06 B;  1NV4 A;  1M5C A;  1R9Q A;  4DI4 B;  4G4P A;  4MLV A;  3E13 X;  4RY1 A;  2VP1 A;  4QFO A;  5FTH A;  4YMB A;  1A54 A;  2B65 A;  2ZYO A;  3T22 A;  1FPF A;  1EZP A;  3UIF A;  1DSN A;  4IB2 A;  1DMB A;  4PBH A;  1MM7 A;  4X04 A;  4TLL B;  2V3U A;  1YTV A;  4G2Z A;  2I3V A;  1JEV A;  3TCH A;  3W9V A;  3K1P A;  5I59 A;  5CMB A;  3TPA A;  3IOU A;  5KDT B;  1R9L A;  3CG3 A;  2ZNU A;  2PFZ A;  5HM4 B;  1MQG A;  4ZZA A;  1LFI A;  1NUY A;  1LBC A;  2H4I A;  2G93 A;  3T93 B;  1OVB A;  3N6T A;  2P3V A;  5I59 B;  5KCJ A;  4F3P A;  4X1B A;  4GXS B;  4TOZ A;  2F3D A;  1OQG A;  4G68 A;  2XD2 A;  4OVQ A;  1J1N A;  4ELR A;  1B2H A;  2PMS A;  1AOV A;  5TP9 A;  4HE0 A;  4YMA A;  3SES A;  4PF6 A;  4NX1 A;  2JJK A;  3N26 A;  1SI1 A;  3U93 A;  3KOT A;  2H25 A;  5EQ7 A;  3CFX A;  2ONS A;  3EN3 A;  2ZYK A;  1MY3 A;  4POX A;  2XX7 A;  1NV0 A;  1LAH E;  1ZKB A;  3K1N A;  4ZDM A;  3QXM A;  4G8H A;  5EYH A;  1I6A A;  4P56 A;  3VFJ A;  1O63 A;  4R74 A;  4F31 B;  2OWS A;  2DWH A;  5FBP A;  1ZIU A;  3QIM A;  1FPI A;  4NF5 A;  4N13 A;  3O6G A;  1QKB A;  1M5E A;  4N8G A;  2XHD A;  3S2V A;  3C33 A;  4X8R A;  1GVC A;  4H6D A;  3RQT A;  5ESY A;  5TPA B;  1RDX A;  4RPN A;  2HQ0 A;  4I3Y A;  2DWI A;  3G7W A;  2XXW A;  1FPE A;  1D9Q A;  4RJZ A;  4PDH A;  1I69 A;  5IAI A;  1FTJ A;  1RYO A;  4KD5 A;  4ESX A;  4G8M A;  5IZZ A;  4O94 A;  4Q30 B;  3FXU A;  4TQU Q;  2CZK A;  3RGY A;  1S50 A;  3A09 A;  5EHM A;  1B05 A;  4G68 C;  1MQH A;  2V84 A;  4LQ2 A;  4ZEB A;  3T0J A;  5CMK A;  4XIG Q;  4LZ5 A;  5AA1 A;  4I9D A;  4GFR A;  3K00 A;  2DQV A;  1FBG A;  5B7D A;  2DDK A;  3TEL A;  2F6P A;  4R9G A;  1P1N A;  2VGQ A;  1ZTY A;  1IXI A;  1N7X A;  2PBW A;  3GZG A;  4KCD A;  1P1O A;  4P1L A;  4ZEI A;  1M5F A;  3QAX A;  1LBB A;  4LZ8 A;  1XI6 A;  1UTH A;  4MMP A;  2R8T A;  1MPD A;  1SVX B;  3K6X A;  4AB6 A;  2R6G E;  1MM6 A;  3U72 A;  1ZMG A;  3FJM A;  1FTM A;  1H3D A;  1UTH B;  3PMX A;  4R75 A;  5EQ9 A;  1AIV A;  4NN3 A;  3Q29 A;  2DYX A;  2I58 A;  5BWJ A;  4EQ7 A;  2F78 A;  4O8M A;  4QFN A;  1H76 A;  3K6V A;  2VD3 A;  1BK4 A;  1SYH A;  4F39 A;  4P1E A;  2RCB A;  5ET8 A;  3LSX A;  3OD7 A;  1PB8 A;  2NVU B;  3WAF A;  3H4Z A;  1NH7 A;  1B52 A;  4GQO A;  5H8F B;  4LA9 A;  5FHM A;  4YKP A;  1N7W A;  2XXU A;  3CFZ A;  1IZ1 A;  1URS A;  3T9X B;  1YPN A;  2OK2 A;  2O7I A;  3OO6 A;  4Q0C A;  3MUQ A;  3PUY E;  4DXU A;  1Z7M E;  4F19 A;  3TQW A;  1VSO A;  5F7V A;  2X7P A;  3E9X A;  2WYK A;  4MHF A;  1OMP A;  4GBV A;  4RA1 A;  4F2O A;  2FIE A;  4NF5 B;  4KCC A;  1M5B A;  3FJG A;  4H5G A;  4I1D A;  4F1U A;  3SEU A;  5JEI A;  2Z8E A;  3IL1 B;  1SBP A;  2ZNT A;  3CFL A;  4IO4 A;  1NV2 A;  4FIM A;  4H8J A;  3O6I A;  5KZT A;  1LBW A;  3O6H A;  1BTJ A;  1S7Y A;  3H6T A;  4R2F A;  5LDZ A;  3PPR A;  2LAO A;  4IY5 A;  3Q25 A;  4XXU A;  4GX6 A;  2GHA A;  3FV1 A;  3JYR A;  2UVG A;  2D21 A;  1LAF E;  1LB9 A;  1IMA A;  3G3G A;  4MEV A;  4EF2 A;  3PD8 A;  4K3F A;  3KSX A;  4U4X A;  1IIW A;  3MW0 A;  4GVO A;  3TTK A;  2OZZ A;  1A40 A;  4DCX A;  3U1O A;  3RT6 B;  2I0C A;  1R1N A;  3QUJ A;  4O3C A;  1B3F A;  3CSG A;  2AIX A;  3I6V A;  4PTK A;  1FBF A;  4U22 A;  3K2D A;  2DWA A;  3IB1 A;  2OWT A;  3RT8 A;  4R72 A;  1K9Z A;  4BDQ A;  2CEX A;  4PFT A;  2UYF A;  4ZED A;  3TQL A;  4P3L A;  4U1Z A;  3VXC A;  5CMM A;  4Z0I A;  2F36 A;  3OEL A;  3SDF A;  1BKA A;  2ZZV A;  1QUJ A;  1US4 A;  3FD3 A;  4DIG A;  5CC2 A;  5CBS A;  1FTA A;  3TTL A;  3U8Q A;  3HO7 A;  5A5L A;  3QSL A;  4X48 A;  5EQ8 A;  1K9Y A;  2QS1 A;  4P0G A;  2OBG A;  4PE5 B;  4OEU A;  4RNS A;  1B7Z A;  3FVO A;  1AL3 A;  2V3T A;  1MPC A;  2XXH A;  4OZ9 A;  4KQP A;  1FBE A;  4ZE9 A;  5F24 A;  4H5F A;  4OET A;  2DVZ A;  4P9K A;  1FCK A;  3K0V A;  4N6D A;  1ZU0 A;  1WDN A;  1R6Z A;  3PU5 A;  3WAE A;  3KN3 A;  4JDF A;  3H3G A;  4IR8 A;  1F9B A;  3PPO A;  2ALU A;  1N04 A;  1QW0 A;  4FAJ A;  1FQB A;  2QS2 A;  2R9J A;  1MXY A;  2DE2 A;  4I3E A;  4OMB A;  1D4N A;  2D5W A;  1EH3 A;  4KI0 E;  1UTB B;  3HHG A;  4F3S A;  1B58 A;  4ZE8 A;  3DP6 A;  4FEB A;  2GRV A;  1B7U A;  4MNP A;  4MIJ A;  5AA3 A;  2CZL A;  3C32 A;  4XKR A;  4UA8 A;  3KC1 A;  2H9B A;  1GTK A;  5EQA A;  4F3B A;  4HCY A;  4R6H A;  2VPO A;  3O66 A;  1GR2 A;  3TDJ A;  3IO4 A;  2GQ1 A;  4ND9 A;  4PET A;  2L5V A;  1MDQ A;  2UVJ A;  5FHO A;  1TT1 A;  1S9T A;  5T3J A;  3TMG A;  4PAI A;  1O64 A;  4F29 A;  2I6E A;  4OEN A;  3KFM A;  3GYY A;  3UA8 A;  3Q26 A;  1ZBM A;  3ZKK A;  1MRP A;  1B40 A;  3IFA A;  4OQO A;  1LBZ A;  1P1Q A;  4NE4 A;  2P2A A;  4PFU A;  3KJ7 A;  3KG2 A;  1XHY A;  2MKZ A;  1USY H;  4QSE A;  2D3I A;  4GXA A;  4L17 A;  1VFD A;  4H1X A;  5EYG A;  4EQ9 A;  2HPG A;  3IFC A;  2Y7K A;  2I3W A;  1PC3 A;  5DEX A;  3ROJ A;  1MG1 A;  2Q9T A;  3MVW A;  3MP8 A;  4UAC A;  1LGB C;  4H45 A;  3MP6 A;  3EQ1 A;  4BDM A;  1FJ6 A;  4DXC A;  2F7A A;  1SI0 A;  3I3V A;  1TWY A;  1YYZ A;  5M2V A;  5DW8 A;  4QRZ A;  4LON B;  4GWW A;  1JP4 A;  2QVV A;  2ZMB A;  4PE3 A;  2DVC A;  2WYP A;  4O3A A;  4GWY A;  5I2K B;  4IO3 A;  2OX3 A;  2Z22 A;  4OER A;  1Y1Z A;  2GH9 A;  2HZK A;  3TYH A;  1NV1 A;  5H8H B;  5A5X B;  3LSW A;  2QVU A;  3MVZ A;  4ELQ A;  1HSE A;  2Q89 A;  3IJO B;  4ESW A;  3VVF A;  1JET A;  1LAG E;  3HV1 A;  1BP5 A;  3UOR A;  1PEB A;  3OEM A;  2XXY A;  2Q8J A;  4RPO A;  5EHS A;  5IZ1 A;  1G0I A;  1NKX A;  3EHU A;  3LC8 A;  3S9E A;  1O7T A;  3OSQ A;  3TFL A;  3CI8 A;  3T9H B;  4FJP A;  1TFA A;  3FVN A;  1YAE A;  2WX9 A;  1OVT A;  3BIH A;  2A5S A;  3VE1 B;  1MY2 A;  3THI A;  1I6Q A;  4FE8 A;  2DOJ A;  1QKA A;  3KBZ A;  3C4M A;  3EKI A;  1FBH A;  3FZV A;  4R9F A;  4AS5 A;  3RTW B;  2QL3 A;  3B50 A;  4F3G A;  1UIV A;  3PTY A;  1NNF A;  3H03 A;  3V5A A;  1LCT A;  3CRB A;  1NNT A;  4I62 A;  4OVR A;  4HE2 A;  3TZA A;  3QYT A;  3ZS6 A;  5IGA A;  1B1H A;  3E4R A;  3MZB A;  2V93 A;  3RN8 A;  2O7U A;  3H6V A;  4YKJ A;  3GBB A;  5CM6 A;  1RDY A;  3H6W A;  2QJE A;  3BFU A;  1N0T A;  2QRY A;  3FXQ A;  2XXT A;  1QVS A;  2V3Q A;  4GOT A;  2XXP A;  3D4C A;  1FBD A;  1Y9U A;  1NH8 A;  1DPP A;  4PFW A;  4OVS A;  2FNC A;  1OLA A;  4KYS A;  1MY1 A;  1FSA A;  4XFE A;  4N91 A;  3BFT A;  5B70 A;  2YJP A;  3L6H A;  2B4L A;  4N6K A;  5I3S A;  4PFR A;  1BIY A;  1MQI A;  3FJ7 A;  5I2N B;  4EF1 A;  3LV0 A;  1FPJ A;  2O84 X;  4MAG A;  1FTO A;  1MXW A;  4YU0 A;  4OFO A;  2VHA A;  2QMW A;  2F6G A;  1NV7 A;  2RKM A;  3FBP A;  3M3F A;  4GLI A;  1KZ8 A;  2XD3 A;  2QPQ A;  4O7I A;  4AB5 A;  2HEU A;  4GX4 A;  3TKD A;  4G8N A;  1LBX A;  1D9Y A;  4NED A;  4ZEC A;  4WXJ A;  1PBP A;  1B1X A;  1LEV A;  1KA0 A;  3RLF E;  4XKP A;  4N07 A;  3Q28 A;  4LQ5 A;  4NF4 B;  1MXZ A;  1MY0 A;  3L6G A;  2X26 A;  1MH3 A;  4AS4 A;  2HHM A;  3G3J A;  4YB7 A;  5CMC A;  1SQY A;  5I58 A;  4NTL A;  4MNC A;  5DEX B;  4QF9 A;  2F7C A;  1RKM A;  4HCW A;  2F5X A;  4KXP A;  2HXR A;  3O29 A;  2O69 A;  4C1T A;  1B0L A;  1NL5 A;  4X9T A;  4PGN A;  1A7L A;  1SPI A;  2IEE A;  2RC9 A;  5AA2 D;  3SKP A;  1SW1 A;  5IZ3 B;  3AXF A;  3S9L C;  3C34 A;  5I2K A;  3FAT A;  4E0W A;  1SYI A;  3PMV A;  3SEY A;  4H0W A;  1Y3P A;  3C35 A;  1H44 A;  2PVU A;  4P11 A;  1B5H A;  3ZKL A;  1YCJ A;  1DOT A;  2DE3 A;  4DCY A;  1D3K A;  1FQF A;  3H7M A;  1LST A;  4JBZ A;  5H8N A;  4OTE A;  4JSO A;  3O9P A;  3OMB A;  1XS5 A;  2Q2C A;  4EQB A;  4GIZ A;  1RDZ A;  5IKB A;  3T66 A;  3C36 A;  1B7H A;  5TP9 B;  1USY E;  3E78 A;  2XWO A;  4MX6 A;  4EUO A;  5EYF A;  1NUX A;  1JW5 A;  2QS4 A;  4MNI A;  1FBC A;  4JVI A;  1VFE A;  2R71 A;  1FQE A;  3IOV A;  4OAN A;  4YAH X;  1SW2 A;  2REJ A;  1A99 A;  2QSX A;  4HS7 A;  4P47 A;  3MZ9 A;  4QSC A;  4FOR A;  2DXY A;  4BDN A;  3K02 A;  5ET5 A;  4MBP A;  5L9O A;  2Y7R A;  4OVP A;  3FVG A;  5F1Q A;  4GWO A;  1DTZ A;  1MH4 A;  4PAK A;  2B4M A;  3D1R A;  3IAZ A;  1MXX A;  4OA4 A;  2OWZ A;  4MCO A;  4DZ1 A;  2DWJ A;  1B46 A;  4E0X A;  1DTG A;  2RCA A;  4ELP A;  4NF0 A;  5TPA A;  2H5Y A;  4U21 A;  2KLF A;  3HHF A;  4QSD A;  1TXF A;  4GWU A;  2Q2A A;  4XKQ A;  5I56 B;  1LBY A;  1T0K A;  4PDD A;  3FUZ A;  2YLN A;  3V8X B;  3RPL A;  1EZ9 A;  1LFG A;  3TTM A;  2Y5K A;  3T1B A;  3MBP A;  5DT6 A;  1AH5 A;  4U23 A;  3MP1 A;  2BJJ X;  4OWD A;  5AA4 B;  3D4G A;  3U94 A;  4LAT A;  4THI A;  1POY 1;  1LB8 A;  4OFJ A;  5H8Q B;  1DK4 A;  4IGT A;  3PD9 A;  3FGS A;  2XXQ A;  4RYA A;  1B5I A;  1JNF A;  5AA4 A;  1CNQ A;  3O97 A;  4BLA A;  4F22 A;  2HXW A;  5DVF A;  5KDT A;  2NXO A;  3OEK A;  4FAT A;  1TFD A;  2KR0 A;  2CZH A;  1URD A;  1FTL A;  1ZLQ A;  5A5X A;  1HSL A;  5JTY A;  2OJT A;  2XX8 A;  4NAP A;  4YB5 A;  4ONY A;  5AE4 A;  1AWB A;  3B6Q A;  4PP0 A;  2Q8M A;  1QJM A;  2Y84 A;  4IO5 A;  4MF3 A;  1HSJ A;  4N15 A;  3B6T A;  3IB0 A;  4PBQ A;  2I4C A;  4IGR A;  1I6B A;  3FXR A;  3HCQ A;  4U1O A;  3V83 A;  2B3F A;  3PPQ A;  3E3K A;  3USD A;  2B3B A;  3OOA A;  4NF4 A;  3ZSF A;  3U65 A;  2GFE A;  2ZNS A;  4KHZ E;  1IXC A;  1ELJ A;  2Y7I A;  1IQ7 A;  2VT5 A;  3MPL A;  1WVJ A;  2UYE A;  3MST A;  4N81 A;  4PCD A;  3IR1 A;  4N4U A;  3ILT B;  2WKY A;  2Y7P A;  2ESN A;  1NMU A;  3TEP A;  5K2Y A;  4N17 A;  3P7I A;  3RYD A;  3VVD A;  3CIJ A;  4OVT A;  4MFI A;  1QGX A;  3K6W A;  4NG7 A;  4OEV A;  2FYI A;  4ZEK A;  1XVX A;  4KFQ A;  1IMB A;  1N3X A;  2V25 A;  1FW0 A;  1LAX A;  1N3W A;  3G3H A;  4BDO A;  1XC1 A;  4R73 A;  1FTK A;  4GWX A;  3M8U A;  1D9V A;  5LOM A;  3SET A;  5ET7 A;  3JZJ A;  2H98 A;  1WOD A;  1Y4T A;  3N94 A;  4JSD A;  2UXA A;  4LUB A;  3KEI A;  3B8B A;  2RC8 A;  3KZG A;  5CRY A;  3TCG A;  3TTR A;  1B3E A;  1MQJ A;  2IA4 A;  2HAV A;  2WEF A;  3OSR A;  3VV5 A;  1Q1K A;  5FHN A;  4JWX A;  3Q27 A;  3DM0 A;  3H6U A;  4R6Y A;  3PPP A;  3RY3 A;  3RPL B;  5J16 A;  1Y20 A;  4GD5 A;  3U92 A;  4OVJ A;  4Q8R A;  4X1D A;  2CMO A;  4QBA A;  1GV8 A;  2PCR A;  3B7D A;  3NOH A;  1MY4 A;  3DEL B;  2I0B A;  3KOS A;  4NWC A;  4F1V A;  1EYI A;  2ZZW A;  5CBR A;  4IO7 A;  3FIR A;  5H8Q A;  5DYH A;  4EXK A;  1MXV A;  2Z8D A;  1B3H A;  1JEU A;  3O28 A;  2XXX A;  3UN6 A;  5L9M A;  2HZL A;  5JK4 A;  5H8N B;  2E0S A;  4RK2 A;  3S9N C;  4XTC Q;  3ODB A;  1OLC A;  3VLV A;  3KJT A;  1VE4 A;  1B32 A;  1QUK A;  2A5T A;  4WED A;  3OO9 A;  4DXB A;  1P1W A;  4DE8 A;  4GWS A;  1SD3 A;  1NNK A;  1FPL A;  1OQH A;  5AA2 B;  3CG1 A;  1EYK A;  1LLS A;  3PUX E;  4RK9 A;  4GX3 A;  2DP8 A;  1IME A;  4G61 A;  3PV0 E;  3TCF A;  3FAS A;  5I58 B;  4H65 A;  2DSF A;  3VVE A;  5HPQ A;  1FBP A;  5ICQ A;  1AMF A;  3G3K A;  1DPE A;  2VD2 A;  5H8F A;  1PB9 A;  3DP4 A;  2XXR A;  5I2N A;  4LP2 B;  4DLD A;  4HTG A;  4QFP A;  3IX1 A;  1NUW A;  3K1M A;  2CZI A;  3JV9 A;  1FQA A;  3MYU A;  1IMC A;  1INP A;  4C0R A;  2FHY A;  4YZZ A;  1IUD A;  4GF8 A;  4I40 A;  1SW4 A;  4F18 A;  3RUM A;  1B0H A;  1B6H A;  1B51 A;  2NUV A;  2Z23 A;  3G3I A;  4HXV A;  3LUY A;  3OO7 A;  4MH5 A;  1JVY A;  5ELV A;  1UIU A;  3MWB A;  1IMF A;  1KWH A;  3SEX A;  3HN0 A;  4PFI A;  3CHG A;  1FPB A;  2HCA A;  1Y4C A;  1Y3Q A;  4WKM A;  2XX9 A;  4ECF A;  2THI A;  2F97 A;  3BIG A;  1UTB A;  2QFL A;  4NF6 B;  4OHN A;  3MVY A;  1PB7 A;  2QS3 A;  4P0I A;  4OES A;  1Z7N E;  1B4H A;  1II5 A;  2AL4 A;  5DVI A;  4FEC A;  3OXN A;  4XKN A;  3GLB A;  4NF6 A;  3EPE A;  2Q74 A;  3N6U A;  5TU0 A;  1P1U A;  5BUU A;  2F7B A;  3C9H A;  2ABH A;  3PUW E;  3G3F A;  1Q9D A;  2O6A A;  1NV6 A;  2BJI A;  2O1L A;  4JWY A;  5IZ3 A;  3QUF A;  1FQD A;  2AYS A;  2ZYN A;  3PPN A;  1ZJL A;  1RYX A;  3A3C A;  4ZEF A;  2E1S A;  2G29 A;  3IB2 A;  3MVX A;  3N5L A;  4PAF A;  4DI3 D;  3RNN A;  3FVK A;  4PC9 A;  4U4S A;  4JXI A;  3SER A;  5ITP A;  1NUZ A;  1FPD A;  3MPK A;  4XEQ A;  4IY6 A;  1XOC A;  1JW1 A;  2VPN A;  2DXR A;  3HFU A;  1IIT A;  4H67 A;  5L9S A;  4UAB A;  5L8D A;  4C1U A;  1B5J A;  1EU8 A;  2RC7 A;  2GHB A;  5J1D A;  3O2A A;  5I84 A;  4YKK A;  3UK4 A;  5I56 A;  3QK6 A;  4PQJ A;  1MPB A;  3MAM A;  4GBW A;  1EYJ A;  4IO6 A;  2I4B A;  4O3B A;  5DTB A;  3S4U A;  4YB6 A;  4NHB A;  3PMW A;  2DS9 A;  1B9J A;  4F2Q A;  2A5T B;  3UGW A;  2KQZ A;  1IMD A;  3TUS A;  4JVD A;  4GWZ A;  4KYE A;  3PUZ E;  5HBC A;  4JWO A;  1QUI A;  4OFL A;  3LUZ A;  4QHQ A;  4NMY A;  3IOW A;  1KA1 A;  1IEJ A;  3QMF A;  3R7X A;  3BKI B;  1NI9 A;  5I57 B;  1M5D A;  3KSJ A;  1IXH A;  2ZXT A;  3KBR A;  4JVC A;  1URG A;  4KYD A;  3CR9 A;  1LCF A;  4G77 A;  3FV2 A;  3LBS A;  4YIC A;  2M8C A;  4KR5 A;  2XWI A;  1MXU A;  5IM2 A;  2ONR A;  5H8H A;  1FPG A;  1US5 A;  1B4Z A;  2PYY A;  2ONK E;  1PDA A;  2RIN A;  2P0S A;  2QMX A;  2WBD A;  2OLB A;  4NF8 B;  3EF7 A;  2FA7 A;  3LSL A;  3M3K A;  3K01 A;  3VXB A;  1EZO A;  2V4C A;  1FRP A;  2FBP A;  4PFB A;  1NV5 A;  4GRK A;  1JW4 A;  3T96 B;  4R6K A;  5KCJ B;  5AA2 A;  3TOD A;  2HFB A;  1POT A;  2NWJ A;  4G68 B;  3V89 B;  3CSB A;  4ELO A;  4N8Y A;  2VOZ A;  1YZ0 A;  3RTF B;  3CVG A;  3W9W A;  2YPN A;  2PT1 A;  2F8D A;  4HW8 A;  2ANJ A;  2F3B A;  4M1V A;  2WBB A;  4TLM B;  3PGF A;  2CEY A;  3T9U A;  2OCU A;  5ET6 A;  1B3G A;  2FVZ A;  3HPI A;  1LBV A;  3DLN A;  1A8E A;  4Z7E A;  1LFH A;  4PGP A;  3R6U A;  2XA5 A;  4M4G A;  1IXG A;  3SEW A;  2AL5 A;  3IK6 B;  4EDP A;  5K2X A;  3UP9 A;  2ZYM A;  1B3L A;  3SZP A;  1ANF A;  2XXV A;  5JTY B;  5ICT A;  1Y3N A;  2F34 A;  4Q5T A;  3ECR A;  5ISU A;  5CI5 A;  2Q88 A;  1MDP 1;  1L5T A;  2Y7W A;  3E79 A;  3LR1 A;  4AQ4 A;  2W7Y A;  3ISP A;  2DE4 A;  4OXV A;  3GBA A;  2H99 A;  4LVQ A;  1NNP A;  3IO6 A;  4U2R A; 
#chains in the Genus database with same CATH homology
 4G61 A;  5ET7 A;  3PTY A;  1LEV A;  2PFZ A;  1FBC A;  2DE2 A;  4I3E A;  4JVI A;  4P8B A;  5ET8 A;  1FJ6 A;  1KA0 A;  4PAF A;  4PTK A;  1FBP A;  2XXK A;  1FBF A;  1NUY A;  4OAN A;  1DCU A;  2PFY A;  2V4C A;  4PC9 A;  4O7M A;  5IZZ A;  1YYZ A;  2P3N A;  1FRP A;  4O94 A;  3B8B A;  2FBP A;  2KR0 A;  4OVR A;  2P3V A;  4HE2 A;  5DW8 A;  2CZK A;  4P47 A;  3W9W A;  2CZH A;  4PFB A;  1NUZ A;  1FPD A;  1FJ9 A;  1NV5 A;  2QVR A;  2XWK A;  4GWW A;  2WEF A;  4XEQ A;  5IGA A;  1JP4 A;  2VPN A;  2FIX A;  5ET5 A;  1K9Z A;  4AS4 A;  2HHM A;  2QVV A;  3HFU A;  4MJO A;  2F3D A;  4OVP A;  4MNP A;  4MNC A;  2CEX A;  1NUW A;  2CZI A;  4MIJ A;  4OVQ A;  4PE3 A;  4F19 A;  3T0J A;  4UAB A;  4FBP A;  4PAK A;  5CM6 A;  2WYP A;  4NAP A;  4GWY A;  4DI3 D;  1RDY A;  3KC1 A;  3MYU A;  4P3L A;  1IMC A;  5EQA A;  4HCW A;  1INP A;  2B4M A;  1AWB A;  2F5X A;  3D1R A;  2FHY A;  4N8Y A;  4OA4 A;  5J1D A;  2WYK A;  2OWZ A;  3FXB A;  4YZZ A;  2Q8M A;  1YZ0 A;  3RPL B;  1FBG A;  2OX3 A;  4MHF A;  1NV3 A;  4HE0 A;  4HCY A;  4I40 A;  4MCO A;  5J16 A;  4PF6 A;  4NX1 A;  2DDK A;  2JJK A;  2VPO A;  2HXR A;  4GBV A;  4KXP A;  2HZK A;  4N15 A;  4NQ8 A;  4F18 A;  2V3Q A;  4PBQ A;  4GBW A;  1NV1 A;  1EYJ A;  2FIE A;  4QBA A;  3A29 A;  2ZZV A;  4NF0 A;  2F3B A;  2XWV A;  2QVU A;  1G0H A;  4M1V A;  5EQ7 A;  4NHB A;  2WBB A;  2GQ1 A;  2PCR A;  4F1U A;  4HE1 A;  1FBD A;  3NOH A;  5I5P A;  1FTA A;  2CEY A;  4PET A;  4HXV A;  2L5V A;  4X9T A;  2KQZ A;  4PGN A;  4QXD A;  5T3J A;  3U65 A;  4F1V A;  1IMD A;  1SPI A;  4GWU A;  4NGU A;  1NV0 A;  4OVS A;  2FVZ A;  4PAI A;  1LBV A;  5ET6 A;  1EYI A;  2VT5 A;  2ZZW A;  1LBY A;  4P1L A;  3MST A;  4PGP A;  5IZ3 B;  2ZZX A;  2XA5 A;  4JVD A;  1IMF A;  4GWZ A;  4N81 A;  4PCD A;  4PDD A;  1FSA A;  5A5L A;  1NV2 A;  3KC0 A;  3GYY A;  4N4U A;  1XI6 A;  4PF8 A;  4PFI A;  4N91 A;  4XFE A;  5EQ8 A;  3CHG A;  1K9Y A;  5EYH A;  4H46 A;  1FPB A;  1LBW A;  1VDW A;  4N17 A;  4P56 A;  5IZ1 A;  3RYD A;  1YXI A;  1G0I A;  2Y5L A;  4MMP A;  1DBZ A;  3LUZ A;  3RPL A;  3IFA A;  5LDZ A;  5FBP A;  1KA1 A;  1LBZ A;  1NV4 A;  3BIG A;  2HZL A;  2R8T A;  3QMF A;  4OVT A;  3SZP A;  5JK4 A;  2QFL A;  1NI9 A;  2B4L A;  2DE3 A;  1FPI A;  2Y5K A;  4AS5 A;  4GX6 A;  4DI4 B;  4N6K A;  5I3S A;  4PFR A;  1QGX A;  4NG7 A;  1FBE A;  3T1B A;  2MKZ A;  5F24 A;  3LV0 A;  1FPJ A;  1IMA A;  2DVZ A;  1IMB A;  4JVC A;  4MEV A;  4P9K A;  4N8G A;  4MAG A;  1FPF A;  5EQ9 A;  4X8R A;  1RDZ A;  2WX9 A;  3BIH A;  4GWS A;  4NN3 A;  4PBH A;  4XF5 A;  5EYG A;  1FPK A;  5ESY A;  4X04 A;  4N6D A;  3E79 A;  1NV7 A;  1FPL A;  1RDX A;  2Q74 A;  3FBP A;  2HPG A;  3IFC A;  4YIC A;  1DK4 A;  3ISP A;  4I3Y A;  2DE4 A;  4LN5 A;  1KZ8 A;  1EYK A;  2QPQ A;  3E78 A;  4O7I A;  2XWI A;  1Q9D A;  2XWO A;  5I7I A;  1NV6 A;  4IR8 A;  4O8M A;  5IM2 A;  1FPE A;  2BJI A;  4MX6 A;  3KBZ A;  3ROJ A;  3W9V A;  5LTC A;  1D9Q A;  3EKI A;  1FPG A;  1NUX A;  4GX3 A;  1FBH A;  4GX4 A;  2Q9T A;  4GWX A;  1BK4 A;  4PDH A;  5IZ3 A;  1LBX A;  1CNQ A;  1IME A;  4H45 A;  4P1E A;  2WBD A;  4MNI A;  3B50 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...