4OVTA

Crystal structure of a trap periplasmic solute binding protein from ochrobacterium anthropi (oant_3902), target efi-510153, with bound l-fuconate
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
301
structure length
301
Chain Sequence
ANVSIKVAYENNPGEPFDEVMHYWKDDLAKRSNGEITLELYPSSQLGSKKDVTEQAMMGLNVVTISDVGFLAEYDPDLGVLYGPFLTDDPAQLFKVYDGPWFKEKSEELKKKGIHIVMPNYLYGIRQIISKKPIRTPEDLKGMKIRVPNNVMQIKTFEAMGATPTPMPLGETFPALAQGVIDGVENPISVLYGQKFQEEAKYLSKVGYLTNVALIVGGEAFFSTLPEDQLKMIHESAYDAGLYSQKLTIEKDNEMIEKMKEAGVEIIDVDRAPFKALAEKVYTQFPEWSPGLYDKIKAELN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRAP dicarboxylate transporter, DctP subunit
publication title Experimental strategies for functional annotation and metabolism discovery: targeted screening of solute binding proteins and unbiased panning of metabolomes.
pubmed doi rcsb
source organism Ochrobactrum anthropi
molecule tags Solute-binding protein
total genus 102
structure length 301
sequence length 301
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03480 DctP Bacterial extracellular solute-binding protein, family 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 4ovtA00
4O7MA 4MMPA 4PGNA 4N8GA 2WX9A 4NAPA 2XA5A 2XWOA 4MNPA 4P8BA 4DI3D 4PDHA 4P1LA 4PAIA 2WYKA 2WYPA 4OVRA 5IGAA 2XWIA 4N91A 4N6DA 4YZZA 4NN3A 4PE3A 2ZZVA 3B50A 4NF0A 2HZLA 4X04A 4OVPA 4PETA 4OA4A 4NHBA 2CEYA 2VPOA 4PFBA 5I5PA 4OANA 4DI4B 2PFYA 2ZZXA 4MNCA 4P9KA 4O8MA 4OVTA 2XXKA 4N17A 4NG7A 4PAKA 4XF5A 4PAFA 3GYYA 4YICA 2CEXA 2HZKA 4X8RA 3U65A 4PGPA 4UABA 4O94A 4NQ8A 2VPNA 4MHFA 4NGUA 4MCOA 4MAGA 4PC9A 5LTCA 4MNIA 4MIJA 5IM2A 4NX1A 4N4UA 4PBQA 4PCDA 2XWKA 4OVSA 4N15A 2ZZWA 4MX6A 4OVQA 4N8YA 4PBHA 4P3LA 4PFRA 4XFEA 2PFZA 4PFIA 4LN5A 4XEQA 4P56A 5CM6A 2XWVA 5IZZA 4N6KA 4PDDA 4MEVA 4P1EA 3FXBA 4PF6A 2V4CA 5I7IA 2HPGA 4PF8A 4P47A
chains in the Genus database with same CATH superfamily
4RNSA 1QUKA 4U23A 4UACA 1Y9UA 3R7XA 3VFJA 3N94A 3KC0A 3DP8A 1SBPA 2L5VA 1Y4TA 4G68C 1P1OA 1NNTA 4OVRA 5IGAA 3LV0A 4HTGA 4I1DA 4NN3A 3M3FA 4NF0A 1JEUA 4IO5A 3Q28A 4E0WA 4AS4A 1MPBA 1NKXA 2XXUA 4RPNA 4O8MA 1B6HA 2BJJX 1T0KA 5J1DA 3D4GA 2D5WA 2XXYA 3UN6A 4LZ7A 4QFOA 5F1QA 5H8NB 3TCFA 1QULA 3VXBA 2CZIA 1FBHA 3RQTA 5BUUA 5DEXA 3IORA 3DELB 3KJTA 1P99A 4GIZA 2HFBA 5DVFA 3H6UA 2MKZA 3GLBA 3KN8A 3VVDA 3OXNA 3MP8A 1QJMA 1BLFA 3HN0A 1MXWA 1S50A 3IK6B 2ZYMA 3O2AA 1LBYA 1FPJA 1LCTA 4JVCA 1JQFA 3TEPA 4XEQA 4OYVA 1NV6A 2Y84A 1R9QA 1FBPA 5I59B 3SERA 4GXAA 2B3FA 3K6WA 5L9MA 4MLQA 1XVYA 3FXBA 1B3EA 4F19A 4PF6A 3FVGA 5AA4B 2V4CA 4KD5A 2HPGA 5HBCA 4GXSB 1NV5A 1MXYA 2CZLA 1NV7A 3VLWA 1QUIA 1GR2A 3FATA 1ELJA 2DWHA 3H7MA 4P8BA 4KXPA 4R9FA 5T3JA 2X7QA 4P1LA 5K2YA 3U1OA 1M5CA 3D4CA 2UVIA 1BK4A 5H8FA 2ONKE 3RTFB 4NF8B 4X04A 3G3FA 2HXRA 4OANA 1O7TA 2AL5A 4FEBA 4ZDMA 1INPA 4NF5B 4GWOA 3U92A 1N84A 1CB6A 3TQWA 2DSFA 2Z8DA 2P2AA 4P11A 4AS5A 4HXVA 2O51A 2GRVA 2ALUA 3G3KA 2DXRA 2QFLA 2OLBA 1FPDA 1B7HA 5TP9A 1DSNA 1IUDA 2QS1A 2FIEA 3A09A 4N4UA 2XX9A 3MP1A 4PCDA 3UIFA 1MS7A 4G2ZA 4IO4A 3VLVA 2A5SA 5KCJA 1QVSA 2ZZWA 4XIGQ 2O1LA 4WXJA 1NV3A 4P0IA 2UVHA 1Y1MA 2VD2A 3MVXA 1TXFA 3PD8A 2Z23A 4EXLA 1NUXA 2DQVA 3DP6A 3UP9A 2F5XA 2H99A 2G29A 1QW0A 1FTJA 4EXKA 3RYDA 4I62A 5I2KA 1N0TA 1FJ6A 3C9HA 1XT8A 4BDLA 3NOHA 1N04A 1YTVA 2A5TB 3TTRA 1Y4CA 3K6VA 5I56A 2WYKA 3PUXE 1VSOA 1FW0A 4Q0CA 5ET8A 3H6WA 1Q9DA 5IZ1A 1PC3A 4PETA 4FBPA 1LEVA 1IMFA 3GZGA 3H6TA 5AA2A 3G3HA 4F18A 2ZXTA 4KQPA 4F29A 2D21A 1US4A 5ICQA 1D4NA 2F97A 2QJEA 4G4PA 1MM6A 3SEWA 3GBAA 1LB9A 1NFTA 1XS5A 2PBWA 1I6AA 1MQGA 2RC8A 3PUWE 4PC9A 4IB2A 1CE2A 4MNIA 1YAEA 5DVIA 2GHAA 2QPQA 4L17A 3THIA 2XWKA 1MH4A 3C4MA 2HCAA 1IIWA 2XD3A 1MH3A 4O7IA 4P3LA 3TKDA 3B7DA 4PFIA 1WDNA 3O29A 3O6HA 4IY6A 1MQDA 4ESXA 5FTIA 1YXIA 4MLVA 3OSRA 4GWWA 1LAXA 3G3GA 4O3BA 5I7IA 4F31B 1Q35A 4H46A 1B3GA 5DEXB 2REGA 3HO7A 3LSXA 5H8SA 3IAZA 1H44A 1B0HA 3SDFA 2F3BA 1D9QA 5JTYA 2IEEA 4YZZA 4DCXA 1MQHA 4U22A 1DK4A 4H6DA 2B4MA 4NHBA 4QFLA 4R2BA 4DLDA 4PFWA 3ILTB 4N6PA 1Q1KA 3MVWA 2FBPA 2ZYKA 3R6UA 4OTEA 5I2NA 4H67A 1MXVA 3SKPA 4FE8A 2V84A 2ABHA 2G93A 4JXIA 5LTCA 3IOUA 3PPRA 3GXAA 1IXIA 3ISPA 1XOCA 1EH3A 4POWA 5DTBA 5H8FB 4M1VA 2XXRA 3KC1A 4ZE9A 4PFRA 1LBVA 4ND9A 4G77A 3FVNA 2F7AA 4JWYA 1BP5A 1XVXA 3A3UA 2CZKA 4ELOA 2FVZA 4IO2A 3RUMA 4EQ7A 1MG1A 2LAOA 1PBPA 5AA1A 1MQJA 2QVUA 4HE1A 1LBWA 1G0IA 1FTOA 3G3IA 3TZAA 1ZU0A 3CG1A 1B3HA 5I58A 2RCBA 3E9XA 5EYFA 1MRPA 4WEPA 2IA4A 5TP9B 2UVJA 5LOMA 1N7XA 1BIYA 3ODBA 4YKPA 5KCJB 2WYPA 3BBRA 2ZYNA 1UQWA 2F6GA 3IFCA 1JW4A 4RXLA 2OX3A 5CC2A 3FJGA 4N07A 1KA0A 1TFAA 1LFGA 4H0WA 4GWXA 2P3NA 3E79A 1SQYA 1JEVA 4U21A 2QL3A 5I2KB 2HZKA 1HSLA 1FQEA 4GVOA 4GWYA 3ILUB 2ZNTA 4QFNA 3CFZA 1ZBMA 4NTLA 3EHUA 4MAGA 1FBEA 4XKPA 3RY3A 5I56B 1QUJA 2V93A 3WAEA 3K1NA 1MDQA 4N8YA 2UXAA 2DWJA 3B8BA 3FBPA 3PPPA 2Z8EA 1N3XA 4XFEA 3ONMA 1B4ZA 2I4CA 1SW5A 4BDRA 4WEDA 3U8QA 1SYIA 4KYSA 4QXDA 5JK4A 3FIRA 4FATA 4JSDA 3Q29A 5ET5A 1A8FA 3OMBA 5ITPA 1FSAA 1QKAA 1JVYA 1POY1 5ELVA 4QHQA 2ZYOA 4GX3A 4IO7A 5EYGA 4N8GA 2O7IA 3TFLA 3K1PA 4F2OA 3QYTA 1JW1A 5EQ7A 4KI0E 4PDHA 1FPFA 1AH5A 1MXZA 2XWIA 4GBWA 1NMUA 2RCAA 5CBSA 3L6GA 4PE3A 2UVGA 2XHDA 1MY2A 3B50A 3RPLA 3TAJA 3FASA 2X26A 1JNFA 2RKMA 4LQ2A 3LUYA 3FXRA 3CSGA 4N17A 3K6XA 4G8HA 4NG7A 2VHAA 1FPKA 3OELA 3QSLA 4UA8A 4ZZEA 3A29A 3MPKA 2Z22A 1POTA 3K1MA 4LQ5A 1DTGA 3PMVA 4LONB 4TOZA 2XXHA 3MYUA 4MHFA 1KZ8A 3UGWA 1IXCA 4GWSA 5JTYB 1UTHA 4Z0IA 4R9GA 1TT1A 2XXVA 3IOTA 4MX6A 4PBHA 2M8CA 1IQ7A 2ONSA 3FV1A 4U4XA 4ECFA 4LN5A 4LP2B 4DIGA 2XWVA 4YKJA 5IZ3A 5IAIA 4MEVA 4NWDA 4QFKA 1EZOA 2QS3A 3B6TA 4KCCA 3MSTA 3TTKA 1NV2A 2WKYA 3KOSA 3FUZA 5I2NB 3MVYA 4OZ9A 4KPTA 2F8DA 4JVDA 3IB0A 4R74A 3CFLA 4PFTA 4NEDA 3KBZA 4XKNA 3TYHA 4BLAA 2H98A 4MFIA 4H8IA 4HCYA 2H9BA 4QSCA 1B7UA 3I6VA 4FECA 3T9UA 3QXMA 1PBQA 3DLNA 3KZGA 1LFHA 1SPIA 4I8CA 4X9TA 2FA7A 4XTCQ 2YJPA 1NUZA 4QSEA 1GTKA 4U2RA 3CI8A 4RPOA 2R71A 2R8TA 4P9KA 2WEFA 1LLSA 5HPQA 3MW0A 4PAKA 2GH9A 3QIMA 2Q2AA 2CEXA 3KG2A 3TTMA 1ZJLA 5I58B 1B5IA 2B4LA 1OQGA 1P1UA 4ZEFA 2BJIA 4N81A 1L5TA 3PPQA 5CMCA 4GX4A 2I0CA 4EF2A 2O6AA 2Z8FA 2DOJA 2QS4A 1B51A 2V3QA 3DM0A 3C36A 1HSEA 4MF3A 3MPLA 1DOTA 2XXIA 3N26A 2R6GE 3ECRA 1NV4A 3QK6A 2ZNUA 2Y7PA 4M4GA 2Q8MA 4EQBA 5CMKA 3IOVA 2PCRA 2R9JA 3MUQA 2Y7RA 3KN3A 4HW8A 2XD2A 2Q88A 1Z7NE 2P0SA 5BWJA 1LBXA 3IB1A 3PMXA 1NV0A 2P3VA 1FQCA 4IY5A 2DVZA 3FJMA 1OVBA 2XXPA 2UYEA 3UK4A 4PQJA 1B32A 4AQ4A 3T9XB 4Q30B 4LZ8A 3W9WA 2ZZVA 2I48A 5KZTA 1SW1A 1LCFA 4DI4B 1MY4A 2DWAA 1B05A 4E0XA 2E1SA 4OVTA 1ZTYA 3KFMA 1SYHA 5KDTA 3O6IA 2WBDA 5TPAA 2O69A 3L6HA 4RJZA 3IR1A 3G3JA 3MQ9A 4Z7EA 2PT2A 3N5LA 1DMBA 3HV1A 5H8HA 2AYSA 1QGXA 1O64A 4ONYA 3FZVA 1Y3NA 1NV1A 3MZBA 5L8DA 1IZ1A 1UTBA 1FJ9A 1IITA 1A55A 3RPLB 3T93B 5M2VA 2XX7A 4GOTA 1LFIA 3SETA 4NMYA 4R2FA 4ZEBA 3MAMA 1VDWA 3SEXA 2D3IA 3IX1A 3OSQA 4GQOA 4N6DA 5EQ8A 4XXUA 3IO6A 5EYHA 2QVRA 3K01A 1IMBA 4FJPA 4I3YA 3OEMA 3Q26A 1B3LA 1UTHB 2AIXA 4HE2A 1J1NA 3QUJA 2HEUA 1FTMA 4PAIA 2HHMA 1ANFA 4WKMA 4ZEDA 3CRBA 1LAGE 3E78A 1B46A 3CVGA 3S9NC 3LUZA 1K9ZA 2FHYA 1RKMA 1GV8A 1A99A 4GWUA 2CMOA 2QRYA 5IZ3B 4F2QA 2Q89A 1LAFE 4YMBA 2QMWA 5H8QA 1US5A 1FQFA 4R73A 3Q27A 1S9TA 2Y5KA 5ITOA 4O94A 3D1RA 2NWJA 1A40A 2ANJA 4MCOA 3KEIA 1MY0A 3VV5A 3I3VA 4KR5A 2I4BA 1PB7A 1PDAA 5CI5A 3TDJA 4PE5B 3EHSA 5DYHA 3TMGA 4AB5A 1ATGA 1M5EA 2DVCA 5A5XA 3KSXA 2I49A 3LC8A 4RK9A 4LA9A 5DW8A 3K00A 4C0RA 1AOVA 4THIA 1R1NA 4PDDA 1FTLA 3E4RA 3FV2A 3RN8A 4TQUQ 3V5AA 4F1VA 1M5FA 1FQAA 3E13X 3MP6A 1MQIA 2FNCA 3V8XB 5ICTA 5CBRA 5FHNA 1OQHA 3MVZA 1EYIA 2F7BA 4GF8A 2YLNA 1BKAA 2DS9A 4OEVA 4U1ZA 1SW4A 1P1QA 4H1XA 2F35A 1YCJA 3PTYA 1RYXA 1Y3QA 4YB5A 3T22A 1LGBC 2Y7KA 4XKRA 3KGCA 2HZLA 1CNQA 2VT5A 4YB6A 4ELPA 4I3EA 1IXHA 4PFUA 2F78A 3FXQA 1B5HA 1TFDA 3UORA 4MH5A 1MM7A 3RLFE 1IXGA 2GFEA 2RINA 3MBPA 4GL0A 3PPNA 4UABA 3VVEA 2Y5LA 4NQ8A 3CSBA 4RY1A 3RGYA 4H65A 1H3DA 4H5FA 2XXWA 1R6ZA 2KR0A 2OWTA 1N3WA 1FBDA 4OVSA 4MJOA 1GGGA 3EPEA 3K6UA 4OWDA 1NH7A 4ZECA 3W9VA 2O7UA 5KDTB 4DE8A 5TPAB 3A3CA 3PUZE 3S2VA 3CR9A 4JVIA 3V83A 2NUVA 3TCHA 2FIXA 4OFLA 1FTKA 1XI6A 1FQDA 5H8HB 2WX9A 3H4ZA 3T96B 4F39A 2HXWA 3FXUA 3BFTA 3RNNA 4H5GA 2DE2A 1B7ZA 1UTBB 5L9OA 2ONRA 4OHNA 3SESA 3U72A 3PGFA 1H76A 3LSLA 3QAXA 5F24A 3S4UA 4LZ5A 4HS7A 5EHSA 2V25A 1F9BA 1Y1ZA 4KYDA 2CEYA 3OOAA 1YYZA 2DYXA 1TWYA 1D9YA 1JETA 1AL3A 4X1DA 2H5YA 1II5A 5FHMA 4RK2A 4DCYA 4PFYA 1PB8A 4R6KA 1XC1A 3LBSA 3LSWA 1HSJA 3CIJA 1JVXA 2NXOA 2I58A 2NOOA 3GBBA 4FIMA 1NNKA 3T66A 4KHZE 4G68A 3TELA 2Y7WA 4O3CA 4C1TA 1MPCA 3HHGA 2YPNA 2REJA 2RC7A 4QSDA 2VOZA 3C34A 3RT8A 1FTAA 5AE4A 2DDKA 3T9HB 3PV0E 2HQ0A 2OJTA 1NNPA 5H8QB 3LR1A 3MC2A 5CRYA 4N6KA 1B1HA 3KN7A 1JW5A 4F1UA 3IL1B 1USYE 5DVJA 3ZS6A 2B3BA 5ESYA 3EKIA 5I3SA 2ZNSA 4O7MA 1NI9A 1IMDA 1FPEA 3TTLA 4EF1A 2ESNA 2PT1A 1PEBA 3K02A 2QVVA 3TQLA 3CG3A 4F3BA 4H8JA 3MJNA 4MNPA 4ZE8A 2THIA 1LBZA 1OLAA 2Q2CA 5A5XB 4LUBA 3C32A 4DXBA 4HCWA 3RTWB 2F3DA 3H6VA 4IGRA 5ET6A 1RDXA 4JBZA 1OLCA 4PFBA 4QFPA 5CMMA 2VGQA 1MPDA 4GX6A 2PFYA 3Q25A 3KSJA 2ZZXA 2DE3A 1SW2A 4PAFA 1MDP1 4IO6A 3JYRA 4X8RA 4YU0A 3MZ1A 4DDDA 1XHYA 3V89B 2VPNA 2XXXA 3FJ7A 4EUOA 3ROJA 4TLMB 3N6TA 4OESA 4P0GA 2Q74A 4G61A 3SZPA 1JP4A 1S7YA 1IEJA 1PB9A 2PMSA 1EZ9A 2V3UA 1GVCA 1EU8A 5K2XA 1FBGA 1B9JA 4OVJA 1AMFA 2RC9A 5CM6A 3ZKKA 1AWBA 2W7YA 3AXFA 3B6QA 4KCDA 4FAJA 3ZKLA 4PF8A 4F22A 4OFOA 1FBCA 3BFUA 3S9MC 3T0JA 2GHBA 3JV9A 3TTNA 2QMXA 4JSOA 4N13A 5CMBA 2UYFA 2Q8JA 4F3SA 3HFUA 4NAPA 1Y3PA 3T9VA 4FORA 1N76A 4OERA 2P1SA 4RA1A 1NUYA 4OQOA 1D3KA 4GBVA 4IO3A 4GWZA 3PU5A 2PVUA 3W15C 1VR5A 2O68A 1SD3A 2E0SA 1B0LA 4DXUA 1URGA 3OD7A 2VD3A 3SEUA 2XXKA 3VDFA 3KJ7A 1MY1A 4FEDA 2Q9TA 3MZ9A 1LB8A 5A5LA 1ZMGA 3M8UA 4F1YA 4PTKA 1FPLA 3OEKA 5IM2A 3RT6B 1AIVA 1FPIA 4OMBA 1O63A 4QRZA 3PPOA 3BIGA 2PYYA 4N15A 2OZZA 1A7LA 2AL4A 1EYKA 4KFQA 5FTHA 1WODA 3IOWA 4F3PA 3RPWA 1UIUA 4OENA 1D9VA 4P56A 3O28A 2I6EA 1LSTA 3KOTA 4P1EA 3F11A 4LVQA 1IMCA 1NH8A 4HE0A 4NWCA 1N7WA 2OWZA 1FQBA 5HM4B 4OEUA 4MMPA 1A8EA 3FD3A 4G68B 1B4HA 1VFDA 3K2DA 2F7CA 3O6GA 4BDQA 4G8MA 5J16A 4Q8RA 1G0HA 4NF4A 3U94A 5ET7A 2F34A 5ISUA 1DCUA 4H45A 3O9PA 1LBBA 3WAFA 1YZ0A 4ELRA 1Y20A 4JWOA 1FCKA 4OVPA 3OO6A 4NF6A 4POXA 4YB7A 5I5PA 5LDZA 2ZMBA 3U93A 3OENA 4DXCA 1DBZA 1OVTA 5I57A 2DE4A 4C1UA 2X7PA 3UA8A 1OMPA 4OETA 4YKKA 2JJKA 3O97A 4U4SA 4YAHX 3E3KA 3CFXA 3OO8A 5DT6A 2Y7IA 1ZLQA 4YKIA 4ISUA 1NUWA 4EQ9A 4O3AA 5B70A 4ESWA 5EQ9A 3M3LA 2DWIA 1RDYA 4ZS9A 4JWXA 1KA1A 4OXVA 2XX8A 4IGTA 1SVXB 1FPGA 2WBBA 1MXUA 1DPEA 2XXTA 1K9YA 2HAUA 3H3GA 3H03A 3VXCA 3M3KA 4R6HA 3DP4A 3HSTA 1UIVA 2OWSA 2F36A 3FGSA 3HCQA 2DXYA 4R72A 5F7VA 1SI1A 4G8NA 5JEIA 1URSA 4ZZAA 5H8NA 2I3WA 4PGNA 3PUYE 4BDMA 1USYH 2XA5A 1OIBA 3QMFA 3BIHA 4X48A 1H45A 4DI3D 1MXXA 1H43A 2H25A 4BDNA 3QUFA 3SEYA 4I9DA 1LBCA 3USDA 2QS2A 5EQAA 1R9LA 2QSXA 3VVFA 5EHMA 1B3FA 4OA4A 3IFAA 3OO7A 5AA3A 1BTJA 5TU0A 1EYJA 4MNCA 3EQ1A 5I59A 3SEVA 2I3VA 2OCUA 4YICA 4X1BA 3N6UA 4EDPA 5AA4A 4QBAA 2I0BA 1NNFA 1A54A 2DP8A 3R26A 1RDZA 2GQ1A 2HAVA 3T1BA 1FPBA 1B2HA 3EHTA 4K3FA 4PP0A 2OBGA 4NX1A 3K0VA 1P1WA 1KWHA 4BDOA 5B7DA 3LSFB 1B1XA 3KBRA 3JZJA 2H4IA 4OVQA 1ZIUA 4ZEKA 5AA2D 3VLUA 4I40A 4NF8A 3G7WA 3S9LC 1YPNA 3TCGA 1M5BA 5IZZA 1IMAA 3IB2A 3IO4A 5FBPA 3I5OA 4GFRA 4NF5A 4U1OA 2KLFA 1EZPA 1URDA 3K4UA 4P47A 3CHGA 2V3TA 5L9SA 3HHFA 4GD5A 4RYAA 1IMEA 1NL5A 4AB6A 3IJXB 1B5JA 1I69A 1P1NA 1VFEA 2XWOA 3MWBA 4Q5TA 4R6YA 4LATA 1ZKBA 3H06B 5FHOA 3FVOA 4N91A 1B58A 1RYOA 1I6QA 1FBFA 4OFJA 1QKBA 3ZSFA 3PD9A 2VPOA 2O1MA 4JDFA 1MY3A 4ELQA 2RF1A 1SDXA 4TLLB 5IKBA 4XF5A 1B52A 3GYYA 3PUVE 3U65A 4PGPA 4DZ1A 3IJOB 3PMWA 5I84A 4MBPA 5AA2B 4YMAA 1DTZA 4GLIA 1LAHE 2XXQA 4NGUA 1WVJA 4NF4B 2A5TA 4XKQA 4F3GA 4MIJA 3BKIB 3P7IA 3VE1B 2B65A 3OO9A 2PX1A 4PBQA 1FRPA 4IR8A 3TODA 3HPIA 4GRKA 4QF9A 4NE4A 3O66A 3C35A 2OK2A 3EN3A 1M5DA 4NF6B 4ZEIA 2NVUB 1VE4A 4R75A 1SI0A 2FYIA 2PFZA 3S9EA 3TPAA 5I57B 3FVKA 2KQZA 3TUSA 1Z7ME 2CZHA 1B40A 2F6PA 2VP1A 4JB7A 1I6BA 3C31A 3EF7A 3B6WA 4GL8A 4KYEA 3C33A 2O84X 1DPPA
chains in the Genus database with same CATH topology
3T0JA 5EQ8A 5EYHA 2QVRA 1IMBA 3HFUA 4NAPA 4I3YA 3KC0A 4HE2A 2L5VA 1NUYA 2HHMA 2WYPA 4OVRA 4PAIA 5IGAA 3LV0A 3IFCA 4GBVA 2OX3A 3E78A 4NN3A 4GWZA 3LUZA 1KA0A 1K9ZA 4NF0A 2FHYA 4GWXA 2P3NA 4GWUA 3E79A 4AS4A 5IZ3B 4O8MA 2XXKA 5J1DA 2HZKA 2Y5KA 2Q9TA 5A5LA 4GWYA 4O94A 3D1RA 2CZIA 1FBHA 4PTKA 4MCOA 4MAGA 1FPLA 1FBEA 2MKZA 5IM2A 1FPIA 3BIGA 4N15A 1EYKA 4N8YA 3B8BA 3FBPA 1LBYA 1FPJA 5DW8A 4XFEA 4JVCA 4XEQA 4P56A 1NV6A 1FBPA 4QXDA 5JK4A 4PDDA 4P1EA 3FXBA 1IMCA 4HE0A 5ET5A 4F19A 4PF6A 2V4CA 1FSAA 2HPGA 4F1VA 2OWZA 1NV5A 4GX3A 4MMPA 5EYGA 4N8GA 1NV7A 1EYIA 5J16A 4P8BA 5EQ7A 1G0HA 4KXPA 4PDHA 5T3JA 5ET7A 1FPFA 3PTYA 4P1LA 1DCUA 4H45A 4GBWA 2XWIA 1BK4A 1YZ0A 4PE3A 3B50A 3RPLA 2HZLA 4X04A 1CNQA 2VT5A 4OVPA 2HXRA 5LDZA 5I5PA 4OANA 4I3EA 1INPA 1DBZA 2DE4A 4N17A 4NG7A 1FPKA 2JJKA 4AS5A 3A29A 4HXVA 4UABA 2Y5LA 4NQ8A 3MYUA 2QFLA 1NUWA 4MHFA 1KZ8A 1FPDA 4GWSA 2FIEA 2KR0A 4N4UA 5EQ9A 4PCDA 1FBDA 4OVSA 4MJOA 1RDYA 1KA1A 2ZZWA 4MX6A 4PBHA 1FPGA 2WBBA 1NV3A 1K9YA 3W9VA 4LN5A 1NUXA 2XWVA 5IZ3A 2F5XA 4MEVA 3MSTA 4JVIA 1NV2A 3RYDA 2FIXA 1FJ6A 1XI6A 4PGNA 2WX9A 3NOHA 4JVDA 2XA5A 3QMFA 3KBZA 3BIHA 2DE2A 4DI3D 2WYKA 5F24A 4HCYA 5ET8A 1Q9DA 1SPIA 5IZ1A 5EQAA 4X9TA 4PETA 4FBPA 1LEVA 1IMFA 4OA4A 2CEYA 1NUZA 3IFAA 1YYZA 1EYJA 4MNCA 2R8TA 4P9KA 2WEFA 4F18A 4PAKA 4YICA 2CEXA 2B4LA 4QBAA 2BJIA 4N81A 4GX4A 1RDZA 2V3QA 4PC9A 2GQ1A 3T1BA 1FPBA 4MNIA 4NX1A 2QPQA 1FTAA 2XWKA 1NV4A 4OVQA 4O7IA 4P3LA 2DDKA 2Q8MA 4I40A 4PFIA 1YXIA 5IZZA 1IMAA 2PCRA 4N6KA 5FBPA 4F1UA 4GWWA 5I7IA 5ESYA 3EKIA 4P47A 5I3SA 4O7MA 1NI9A 3CHGA 4H46A 1IMDA 1LBXA 1FPEA 1IMEA 1NV0A 2QVVA 2P3VA 2DVZA 2XWOA 4MNPA 2F3BA 1D9QA 1LBZA 4HCWA 4N91A 4YZZA 2F3DA 1FBFA 3W9WA 2ZZVA 1DK4A 5ET6A 1RDXA 2B4MA 4NHBA 2VPOA 4PFBA 4DI4B 4GX6A 2PFYA 2ZZXA 2DE3A 4OVTA 4XF5A 4PAFA 2WBDA 3GYYA 2FBPA 4X8RA 3U65A 4PGPA 2VPNA 3ROJA 4NGUA 2Q74A 1QGXA 5LTCA 1NV1A 4G61A 4MIJA 3SZPA 1JP4A 3ISPA 4PBQA 1FRPA 4IR8A 1FJ9A 4M1VA 3KC1A 3RPLB 4PFRA 1LBVA 1FBGA 2PFZA 2KQZA 2CZKA 2CZHA 2FVZA 5CM6A 1AWBA 2QVUA 4HE1A 1VDWA 1LBWA 1G0IA 4PF8A 4N6DA 1FBCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O7M A;  4MMP A;  4PGN A;  4N8G A;  2WX9 A;  4NAP A;  2XA5 A;  2XWO A;  4MNP A;  4P8B A;  4DI3 D;  4PDH A;  4P1L A;  4PAI A;  2WYK A;  2WYP A;  4OVR A;  5IGA A;  2XWI A;  4N91 A;  4N6D A;  4YZZ A;  4NN3 A;  4PE3 A;  2ZZV A;  3B50 A;  4NF0 A;  2HZL A;  4X04 A;  4OVP A;  4PET A;  4OA4 A;  4NHB A;  2CEY A;  2VPO A;  4PFB A;  5I5P A;  4OAN A;  4DI4 B;  2PFY A;  2ZZX A;  4MNC A;  4P9K A;  4O8M A;  4OVT A;  2XXK A;  4N17 A;  4NG7 A;  4PAK A;  4XF5 A;  4PAF A;  3GYY A;  4YIC A;  2CEX A;  2HZK A;  4X8R A;  3U65 A;  4PGP A;  4UAB A;  4O94 A;  4NQ8 A;  2VPN A;  4MHF A;  4NGU A;  4MCO A;  4MAG A;  4PC9 A;  5LTC A;  4MNI A;  4MIJ A;  5IM2 A;  4NX1 A;  4N4U A;  4PBQ A;  4PCD A;  2XWK A;  4OVS A;  4N15 A;  2ZZW A;  4MX6 A;  4OVQ A;  4N8Y A;  4PBH A;  4P3L A;  4PFR A;  4XFE A;  2PFZ A;  4PFI A;  4LN5 A;  4XEQ A;  4P56 A;  5CM6 A;  2XWV A;  5IZZ A;  4N6K A;  4PDD A;  4MEV A;  4P1E A;  3FXB A;  4PF6 A;  2V4C A;  5I7I A;  2HPG A;  4PF8 A;  4P47 A; 
#chains in the Genus database with same CATH topology
 4RNS A;  1QUK A;  4U23 A;  4UAC A;  1Y9U A;  3R7X A;  3VFJ A;  3N94 A;  3KC0 A;  3DP8 A;  1SBP A;  2L5V A;  1Y4T A;  4G68 C;  1P1O A;  1NNT A;  4OVR A;  5IGA A;  3LV0 A;  4HTG A;  4I1D A;  4NN3 A;  3M3F A;  4NF0 A;  1JEU A;  4IO5 A;  3Q28 A;  4E0W A;  4AS4 A;  1MPB A;  1NKX A;  2XXU A;  4RPN A;  4O8M A;  1B6H A;  2BJJ X;  1T0K A;  5J1D A;  3D4G A;  2D5W A;  2XXY A;  3UN6 A;  4LZ7 A;  4QFO A;  5F1Q A;  5H8N B;  3TCF A;  1QUL A;  3VXB A;  2CZI A;  1FBH A;  3RQT A;  5BUU A;  5DEX A;  3IOR A;  3DEL B;  3KJT A;  1P99 A;  4GIZ A;  2HFB A;  5DVF A;  3H6U A;  2MKZ A;  3GLB A;  3KN8 A;  3VVD A;  3OXN A;  3MP8 A;  1QJM A;  1BLF A;  3HN0 A;  1MXW A;  1S50 A;  3IK6 B;  2ZYM A;  3O2A A;  1LBY A;  1FPJ A;  1LCT A;  4JVC A;  1JQF A;  3TEP A;  4XEQ A;  4OYV A;  1NV6 A;  2Y84 A;  1R9Q A;  1FBP A;  5I59 B;  3SER A;  4GXA A;  2B3F A;  3K6W A;  5L9M A;  4MLQ A;  1XVY A;  3FXB A;  1B3E A;  4F19 A;  4PF6 A;  3FVG A;  5AA4 B;  2V4C A;  4KD5 A;  2HPG A;  5HBC A;  4GXS B;  1NV5 A;  1MXY A;  2CZL A;  1NV7 A;  3VLW A;  1QUI A;  1GR2 A;  3FAT A;  1ELJ A;  2DWH A;  3H7M A;  4P8B A;  4KXP A;  4R9F A;  5T3J A;  2X7Q A;  4P1L A;  5K2Y A;  3U1O A;  1M5C A;  3D4C A;  2UVI A;  1BK4 A;  5H8F A;  2ONK E;  3RTF B;  4NF8 B;  4X04 A;  3G3F A;  2HXR A;  4OAN A;  1O7T A;  2AL5 A;  4FEB A;  4ZDM A;  1INP A;  4NF5 B;  4GWO A;  3U92 A;  1N84 A;  1CB6 A;  3TQW A;  2DSF A;  2Z8D A;  2P2A A;  4P11 A;  4AS5 A;  4HXV A;  2O51 A;  2GRV A;  2ALU A;  3G3K A;  2DXR A;  2QFL A;  2OLB A;  1FPD A;  1B7H A;  5TP9 A;  1DSN A;  1IUD A;  2QS1 A;  2FIE A;  3A09 A;  4N4U A;  2XX9 A;  3MP1 A;  4PCD A;  3UIF A;  1MS7 A;  4G2Z A;  4IO4 A;  3VLV A;  2A5S A;  5KCJ A;  1QVS A;  2ZZW A;  4XIG Q;  2O1L A;  4WXJ A;  1NV3 A;  4P0I A;  2UVH A;  1Y1M A;  2VD2 A;  3MVX A;  1TXF A;  3PD8 A;  2Z23 A;  4EXL A;  1NUX A;  2DQV A;  3DP6 A;  3UP9 A;  2F5X A;  2H99 A;  2G29 A;  1QW0 A;  1FTJ A;  4EXK A;  3RYD A;  4I62 A;  5I2K A;  1N0T A;  1FJ6 A;  3C9H A;  1XT8 A;  4BDL A;  3NOH A;  1N04 A;  1YTV A;  2A5T B;  3TTR A;  1Y4C A;  3K6V A;  5I56 A;  2WYK A;  3PUX E;  1VSO A;  1FW0 A;  4Q0C A;  5ET8 A;  3H6W A;  1Q9D A;  5IZ1 A;  1PC3 A;  4PET A;  4FBP A;  1LEV A;  1IMF A;  3GZG A;  3H6T A;  5AA2 A;  3G3H A;  4F18 A;  2ZXT A;  4KQP A;  4F29 A;  2D21 A;  1US4 A;  5ICQ A;  1D4N A;  2F97 A;  2QJE A;  4G4P A;  1MM6 A;  3SEW A;  3GBA A;  1LB9 A;  1NFT A;  1XS5 A;  2PBW A;  1I6A A;  1MQG A;  2RC8 A;  3PUW E;  4PC9 A;  4IB2 A;  1CE2 A;  4MNI A;  1YAE A;  5DVI A;  2GHA A;  2QPQ A;  4L17 A;  3THI A;  2XWK A;  1MH4 A;  3C4M A;  2HCA A;  1IIW A;  2XD3 A;  1MH3 A;  4O7I A;  4P3L A;  3TKD A;  3B7D A;  4PFI A;  1WDN A;  3O29 A;  3O6H A;  4IY6 A;  1MQD A;  4ESX A;  5FTI A;  1YXI A;  4MLV A;  3OSR A;  4GWW A;  1LAX A;  3G3G A;  4O3B A;  5I7I A;  4F31 B;  1Q35 A;  4H46 A;  1B3G A;  5DEX B;  2REG A;  3HO7 A;  3LSX A;  5H8S A;  3IAZ A;  1H44 A;  1B0H A;  3SDF A;  2F3B A;  1D9Q A;  5JTY A;  2IEE A;  4YZZ A;  4DCX A;  1MQH A;  4U22 A;  1DK4 A;  4H6D A;  2B4M A;  4NHB A;  4QFL A;  4R2B A;  4DLD A;  4PFW A;  3ILT B;  4N6P A;  1Q1K A;  3MVW A;  2FBP A;  2ZYK A;  3R6U A;  4OTE A;  5I2N A;  4H67 A;  1MXV A;  3SKP A;  4FE8 A;  2V84 A;  2ABH A;  2G93 A;  4JXI A;  5LTC A;  3IOU A;  3PPR A;  3GXA A;  1IXI A;  3ISP A;  1XOC A;  1EH3 A;  4POW A;  5DTB A;  5H8F B;  4M1V A;  2XXR A;  3KC1 A;  4ZE9 A;  4PFR A;  1LBV A;  4ND9 A;  4G77 A;  3FVN A;  2F7A A;  4JWY A;  1BP5 A;  1XVX A;  3A3U A;  2CZK A;  4ELO A;  2FVZ A;  4IO2 A;  3RUM A;  4EQ7 A;  1MG1 A;  2LAO A;  1PBP A;  5AA1 A;  1MQJ A;  2QVU A;  4HE1 A;  1LBW A;  1G0I A;  1FTO A;  3G3I A;  3TZA A;  1ZU0 A;  3CG1 A;  1B3H A;  5I58 A;  2RCB A;  3E9X A;  5EYF A;  1MRP A;  4WEP A;  2IA4 A;  5TP9 B;  2UVJ A;  5LOM A;  1N7X A;  1BIY A;  3ODB A;  4YKP A;  5KCJ B;  2WYP A;  3BBR A;  2ZYN A;  1UQW A;  2F6G A;  3IFC A;  1JW4 A;  4RXL A;  2OX3 A;  5CC2 A;  3FJG A;  4N07 A;  1KA0 A;  1TFA A;  1LFG A;  4H0W A;  4GWX A;  2P3N A;  3E79 A;  1SQY A;  1JEV A;  4U21 A;  2QL3 A;  5I2K B;  2HZK A;  1HSL A;  1FQE A;  4GVO A;  4GWY A;  3ILU B;  2ZNT A;  4QFN A;  3CFZ A;  1ZBM A;  4NTL A;  3EHU A;  4MAG A;  1FBE A;  4XKP A;  3RY3 A;  5I56 B;  1QUJ A;  2V93 A;  3WAE A;  3K1N A;  1MDQ A;  4N8Y A;  2UXA A;  2DWJ A;  3B8B A;  3FBP A;  3PPP A;  2Z8E A;  1N3X A;  4XFE A;  3ONM A;  1B4Z A;  2I4C A;  1SW5 A;  4BDR A;  4WED A;  3U8Q A;  1SYI A;  4KYS A;  4QXD A;  5JK4 A;  3FIR A;  4FAT A;  4JSD A;  3Q29 A;  5ET5 A;  1A8F A;  3OMB A;  5ITP A;  1FSA A;  1QKA A;  1JVY A;  1POY 1;  5ELV A;  4QHQ A;  2ZYO A;  4GX3 A;  4IO7 A;  5EYG A;  4N8G A;  2O7I A;  3TFL A;  3K1P A;  4F2O A;  3QYT A;  1JW1 A;  5EQ7 A;  4KI0 E;  4PDH A;  1FPF A;  1AH5 A;  1MXZ A;  2XWI A;  4GBW A;  1NMU A;  2RCA A;  5CBS A;  3L6G A;  4PE3 A;  2UVG A;  2XHD A;  1MY2 A;  3B50 A;  3RPL A;  3TAJ A;  3FAS A;  2X26 A;  1JNF A;  2RKM A;  4LQ2 A;  3LUY A;  3FXR A;  3CSG A;  4N17 A;  3K6X A;  4G8H A;  4NG7 A;  2VHA A;  1FPK A;  3OEL A;  3QSL A;  4UA8 A;  4ZZE A;  3A29 A;  3MPK A;  2Z22 A;  1POT A;  3K1M A;  4LQ5 A;  1DTG A;  3PMV A;  4LON B;  4TOZ A;  2XXH A;  3MYU A;  4MHF A;  1KZ8 A;  3UGW A;  1IXC A;  4GWS A;  5JTY B;  1UTH A;  4Z0I A;  4R9G A;  1TT1 A;  2XXV A;  3IOT A;  4MX6 A;  4PBH A;  2M8C A;  1IQ7 A;  2ONS A;  3FV1 A;  4U4X A;  4ECF A;  4LN5 A;  4LP2 B;  4DIG A;  2XWV A;  4YKJ A;  5IZ3 A;  5IAI A;  4MEV A;  4NWD A;  4QFK A;  1EZO A;  2QS3 A;  3B6T A;  4KCC A;  3MST A;  3TTK A;  1NV2 A;  2WKY A;  3KOS A;  3FUZ A;  5I2N B;  3MVY A;  4OZ9 A;  4KPT A;  2F8D A;  4JVD A;  3IB0 A;  4R74 A;  3CFL A;  4PFT A;  4NED A;  3KBZ A;  4XKN A;  3TYH A;  4BLA A;  2H98 A;  4MFI A;  4H8I A;  4HCY A;  2H9B A;  4QSC A;  1B7U A;  3I6V A;  4FEC A;  3T9U A;  3QXM A;  1PBQ A;  3DLN A;  3KZG A;  1LFH A;  1SPI A;  4I8C A;  4X9T A;  2FA7 A;  4XTC Q;  2YJP A;  1NUZ A;  4QSE A;  1GTK A;  4U2R A;  3CI8 A;  4RPO A;  2R71 A;  2R8T A;  4P9K A;  2WEF A;  1LLS A;  5HPQ A;  3MW0 A;  4PAK A;  2GH9 A;  3QIM A;  2Q2A A;  2CEX A;  3KG2 A;  3TTM A;  1ZJL A;  5I58 B;  1B5I A;  2B4L A;  1OQG A;  1P1U A;  4ZEF A;  2BJI A;  4N81 A;  1L5T A;  3PPQ A;  5CMC A;  4GX4 A;  2I0C A;  4EF2 A;  2O6A A;  2Z8F A;  2DOJ A;  2QS4 A;  1B51 A;  2V3Q A;  3DM0 A;  3C36 A;  1HSE A;  4MF3 A;  3MPL A;  1DOT A;  2XXI A;  3N26 A;  2R6G E;  3ECR A;  1NV4 A;  3QK6 A;  2ZNU A;  2Y7P A;  4M4G A;  2Q8M A;  4EQB A;  5CMK A;  3IOV A;  2PCR A;  2R9J A;  3MUQ A;  2Y7R A;  3KN3 A;  4HW8 A;  2XD2 A;  2Q88 A;  1Z7N E;  2P0S A;  5BWJ A;  1LBX A;  3IB1 A;  3PMX A;  1NV0 A;  2P3V A;  1FQC A;  4IY5 A;  2DVZ A;  3FJM A;  1OVB A;  2XXP A;  2UYE A;  3UK4 A;  4PQJ A;  1B32 A;  4AQ4 A;  3T9X B;  4Q30 B;  4LZ8 A;  3W9W A;  2ZZV A;  2I48 A;  5KZT A;  1SW1 A;  1LCF A;  4DI4 B;  1MY4 A;  2DWA A;  1B05 A;  4E0X A;  2E1S A;  4OVT A;  1ZTY A;  3KFM A;  1SYH A;  5KDT A;  3O6I A;  2WBD A;  5TPA A;  2O69 A;  3L6H A;  4RJZ A;  3IR1 A;  3G3J A;  3MQ9 A;  4Z7E A;  2PT2 A;  3N5L A;  1DMB A;  3HV1 A;  5H8H A;  2AYS A;  1QGX A;  1O64 A;  4ONY A;  3FZV A;  1Y3N A;  1NV1 A;  3MZB A;  5L8D A;  1IZ1 A;  1UTB A;  1FJ9 A;  1IIT A;  1A55 A;  3RPL B;  3T93 B;  5M2V A;  2XX7 A;  4GOT A;  1LFI A;  3SET A;  4NMY A;  4R2F A;  4ZEB A;  3MAM A;  1VDW A;  3SEX A;  2D3I A;  3IX1 A;  3OSQ A;  4GQO A;  4N6D A;  5EQ8 A;  4XXU A;  3IO6 A;  5EYH A;  2QVR A;  3K01 A;  1IMB A;  4FJP A;  4I3Y A;  3OEM A;  3Q26 A;  1B3L A;  1UTH B;  2AIX A;  4HE2 A;  1J1N A;  3QUJ A;  2HEU A;  1FTM A;  4PAI A;  2HHM A;  1ANF A;  4WKM A;  4ZED A;  3CRB A;  1LAG E;  3E78 A;  1B46 A;  3CVG A;  3S9N C;  3LUZ A;  1K9Z A;  2FHY A;  1RKM A;  1GV8 A;  1A99 A;  4GWU A;  2CMO A;  2QRY A;  5IZ3 B;  4F2Q A;  2Q89 A;  1LAF E;  4YMB A;  2QMW A;  5H8Q A;  1US5 A;  1FQF A;  4R73 A;  3Q27 A;  1S9T A;  2Y5K A;  5ITO A;  4O94 A;  3D1R A;  2NWJ A;  1A40 A;  2ANJ A;  4MCO A;  3KEI A;  1MY0 A;  3VV5 A;  3I3V A;  4KR5 A;  2I4B A;  1PB7 A;  1PDA A;  5CI5 A;  3TDJ A;  4PE5 B;  3EHS A;  5DYH A;  3TMG A;  4AB5 A;  1ATG A;  1M5E A;  2DVC A;  5A5X A;  3KSX A;  2I49 A;  3LC8 A;  4RK9 A;  4LA9 A;  5DW8 A;  3K00 A;  4C0R A;  1AOV A;  4THI A;  1R1N A;  4PDD A;  1FTL A;  3E4R A;  3FV2 A;  3RN8 A;  4TQU Q;  3V5A A;  4F1V A;  1M5F A;  1FQA A;  3E13 X;  3MP6 A;  1MQI A;  2FNC A;  3V8X B;  5ICT A;  5CBR A;  5FHN A;  1OQH A;  3MVZ A;  1EYI A;  2F7B A;  4GF8 A;  2YLN A;  1BKA A;  2DS9 A;  4OEV A;  4U1Z A;  1SW4 A;  1P1Q A;  4H1X A;  2F35 A;  1YCJ A;  3PTY A;  1RYX A;  1Y3Q A;  4YB5 A;  3T22 A;  1LGB C;  2Y7K A;  4XKR A;  3KGC A;  2HZL A;  1CNQ A;  2VT5 A;  4YB6 A;  4ELP A;  4I3E A;  1IXH A;  4PFU A;  2F78 A;  3FXQ A;  1B5H A;  1TFD A;  3UOR A;  4MH5 A;  1MM7 A;  3RLF E;  1IXG A;  2GFE A;  2RIN A;  3MBP A;  4GL0 A;  3PPN A;  4UAB A;  3VVE A;  2Y5L A;  4NQ8 A;  3CSB A;  4RY1 A;  3RGY A;  4H65 A;  1H3D A;  4H5F A;  2XXW A;  1R6Z A;  2KR0 A;  2OWT A;  1N3W A;  1FBD A;  4OVS A;  4MJO A;  1GGG A;  3EPE A;  3K6U A;  4OWD A;  1NH7 A;  4ZEC A;  3W9V A;  2O7U A;  5KDT B;  4DE8 A;  5TPA B;  3A3C A;  3PUZ E;  3S2V A;  3CR9 A;  4JVI A;  3V83 A;  2NUV A;  3TCH A;  2FIX A;  4OFL A;  1FTK A;  1XI6 A;  1FQD A;  5H8H B;  2WX9 A;  3H4Z A;  3T96 B;  4F39 A;  2HXW A;  3FXU A;  3BFT A;  3RNN A;  4H5G A;  2DE2 A;  1B7Z A;  1UTB B;  5L9O A;  2ONR A;  4OHN A;  3SES A;  3U72 A;  3PGF A;  1H76 A;  3LSL A;  3QAX A;  5F24 A;  3S4U A;  4LZ5 A;  4HS7 A;  5EHS A;  2V25 A;  1F9B A;  1Y1Z A;  4KYD A;  2CEY A;  3OOA A;  1YYZ A;  2DYX A;  1TWY A;  1D9Y A;  1JET A;  1AL3 A;  4X1D A;  2H5Y A;  1II5 A;  5FHM A;  4RK2 A;  4DCY A;  4PFY A;  1PB8 A;  4R6K A;  1XC1 A;  3LBS A;  3LSW A;  1HSJ A;  3CIJ A;  1JVX A;  2NXO A;  2I58 A;  2NOO A;  3GBB A;  4FIM A;  1NNK A;  3T66 A;  4KHZ E;  4G68 A;  3TEL A;  2Y7W A;  4O3C A;  4C1T A;  1MPC A;  3HHG A;  2YPN A;  2REJ A;  2RC7 A;  4QSD A;  2VOZ A;  3C34 A;  3RT8 A;  1FTA A;  5AE4 A;  2DDK A;  3T9H B;  3PV0 E;  2HQ0 A;  2OJT A;  1NNP A;  5H8Q B;  3LR1 A;  3MC2 A;  5CRY A;  4N6K A;  1B1H A;  3KN7 A;  1JW5 A;  4F1U A;  3IL1 B;  1USY E;  5DVJ A;  3ZS6 A;  2B3B A;  5ESY A;  3EKI A;  5I3S A;  2ZNS A;  4O7M A;  1NI9 A;  1IMD A;  1FPE A;  3TTL A;  4EF1 A;  2ESN A;  2PT1 A;  1PEB A;  3K02 A;  2QVV A;  3TQL A;  3CG3 A;  4F3B A;  4H8J A;  3MJN A;  4MNP A;  4ZE8 A;  2THI A;  1LBZ A;  1OLA A;  2Q2C A;  5A5X B;  4LUB A;  3C32 A;  4DXB A;  4HCW A;  3RTW B;  2F3D A;  3H6V A;  4IGR A;  5ET6 A;  1RDX A;  4JBZ A;  1OLC A;  4PFB A;  4QFP A;  5CMM A;  2VGQ A;  1MPD A;  4GX6 A;  2PFY A;  3Q25 A;  3KSJ A;  2ZZX A;  2DE3 A;  1SW2 A;  4PAF A;  1MDP 1;  4IO6 A;  3JYR A;  4X8R A;  4YU0 A;  3MZ1 A;  4DDD A;  1XHY A;  3V89 B;  2VPN A;  2XXX A;  3FJ7 A;  4EUO A;  3ROJ A;  4TLM B;  3N6T A;  4OES A;  4P0G A;  2Q74 A;  4G61 A;  3SZP A;  1JP4 A;  1S7Y A;  1IEJ A;  1PB9 A;  2PMS A;  1EZ9 A;  2V3U A;  1GVC A;  1EU8 A;  5K2X A;  1FBG A;  1B9J A;  4OVJ A;  1AMF A;  2RC9 A;  5CM6 A;  3ZKK A;  1AWB A;  2W7Y A;  3AXF A;  3B6Q A;  4KCD A;  4FAJ A;  3ZKL A;  4PF8 A;  4F22 A;  4OFO A;  1FBC A;  3BFU A;  3S9M C;  3T0J A;  2GHB A;  3JV9 A;  3TTN A;  2QMX A;  4JSO A;  4N13 A;  5CMB A;  2UYF A;  2Q8J A;  4F3S A;  3HFU A;  4NAP A;  1Y3P A;  3T9V A;  4FOR A;  1N76 A;  4OER A;  2P1S A;  4RA1 A;  1NUY A;  4OQO A;  1D3K A;  4GBV A;  4IO3 A;  4GWZ A;  3PU5 A;  2PVU A;  3W15 C;  1VR5 A;  2O68 A;  1SD3 A;  2E0S A;  1B0L A;  4DXU A;  1URG A;  3OD7 A;  2VD3 A;  3SEU A;  2XXK A;  3VDF A;  3KJ7 A;  1MY1 A;  4FED A;  2Q9T A;  3MZ9 A;  1LB8 A;  5A5L A;  1ZMG A;  3M8U A;  4F1Y A;  4PTK A;  1FPL A;  3OEK A;  5IM2 A;  3RT6 B;  1AIV A;  1FPI A;  4OMB A;  1O63 A;  4QRZ A;  3PPO A;  3BIG A;  2PYY A;  4N15 A;  2OZZ A;  1A7L A;  2AL4 A;  1EYK A;  4KFQ A;  5FTH A;  1WOD A;  3IOW A;  4F3P A;  3RPW A;  1UIU A;  4OEN A;  1D9V A;  4P56 A;  3O28 A;  2I6E A;  1LST A;  3KOT A;  4P1E A;  3F11 A;  4LVQ A;  1IMC A;  1NH8 A;  4HE0 A;  4NWC A;  1N7W A;  2OWZ A;  1FQB A;  5HM4 B;  4OEU A;  4MMP A;  1A8E A;  3FD3 A;  4G68 B;  1B4H A;  1VFD A;  3K2D A;  2F7C A;  3O6G A;  4BDQ A;  4G8M A;  5J16 A;  4Q8R A;  1G0H A;  4NF4 A;  3U94 A;  5ET7 A;  2F34 A;  5ISU A;  1DCU A;  4H45 A;  3O9P A;  1LBB A;  3WAF A;  1YZ0 A;  4ELR A;  1Y20 A;  4JWO A;  1FCK A;  4OVP A;  3OO6 A;  4NF6 A;  4POX A;  4YB7 A;  5I5P A;  5LDZ A;  2ZMB A;  3U93 A;  3OEN A;  4DXC A;  1DBZ A;  1OVT A;  5I57 A;  2DE4 A;  4C1U A;  2X7P A;  3UA8 A;  1OMP A;  4OET A;  4YKK A;  2JJK A;  3O97 A;  4U4S A;  4YAH X;  3E3K A;  3CFX A;  3OO8 A;  5DT6 A;  2Y7I A;  1ZLQ A;  4YKI A;  4ISU A;  1NUW A;  4EQ9 A;  4O3A A;  5B70 A;  4ESW A;  5EQ9 A;  3M3L A;  2DWI A;  1RDY A;  4ZS9 A;  4JWX A;  1KA1 A;  4OXV A;  2XX8 A;  4IGT A;  1SVX B;  1FPG A;  2WBB A;  1MXU A;  1DPE A;  2XXT A;  1K9Y A;  2HAU A;  3H3G A;  3H03 A;  3VXC A;  3M3K A;  4R6H A;  3DP4 A;  3HST A;  1UIV A;  2OWS A;  2F36 A;  3FGS A;  3HCQ A;  2DXY A;  4R72 A;  5F7V A;  1SI1 A;  4G8N A;  5JEI A;  1URS A;  4ZZA A;  5H8N A;  2I3W A;  4PGN A;  3PUY E;  4BDM A;  1USY H;  2XA5 A;  1OIB A;  3QMF A;  3BIH A;  4X48 A;  1H45 A;  4DI3 D;  1MXX A;  1H43 A;  2H25 A;  4BDN A;  3QUF A;  3SEY A;  4I9D A;  1LBC A;  3USD A;  2QS2 A;  5EQA A;  1R9L A;  2QSX A;  3VVF A;  5EHM A;  1B3F A;  4OA4 A;  3IFA A;  3OO7 A;  5AA3 A;  1BTJ A;  5TU0 A;  1EYJ A;  4MNC A;  3EQ1 A;  5I59 A;  3SEV A;  2I3V A;  2OCU A;  4YIC A;  4X1B A;  3N6U A;  4EDP A;  5AA4 A;  4QBA A;  2I0B A;  1NNF A;  1A54 A;  2DP8 A;  3R26 A;  1RDZ A;  2GQ1 A;  2HAV A;  3T1B A;  1FPB A;  1B2H A;  3EHT A;  4K3F A;  4PP0 A;  2OBG A;  4NX1 A;  3K0V A;  1P1W A;  1KWH A;  4BDO A;  5B7D A;  3LSF B;  1B1X A;  3KBR A;  3JZJ A;  2H4I A;  4OVQ A;  1ZIU A;  4ZEK A;  5AA2 D;  3VLU A;  4I40 A;  4NF8 A;  3G7W A;  3S9L C;  1YPN A;  3TCG A;  1M5B A;  5IZZ A;  1IMA A;  3IB2 A;  3IO4 A;  5FBP A;  3I5O A;  4GFR A;  4NF5 A;  4U1O A;  2KLF A;  1EZP A;  1URD A;  3K4U A;  4P47 A;  3CHG A;  2V3T A;  5L9S A;  3HHF A;  4GD5 A;  4RYA A;  1IME A;  1NL5 A;  4AB6 A;  3IJX B;  1B5J A;  1I69 A;  1P1N A;  1VFE A;  2XWO A;  3MWB A;  4Q5T A;  4R6Y A;  4LAT A;  1ZKB A;  3H06 B;  5FHO A;  3FVO A;  4N91 A;  1B58 A;  1RYO A;  1I6Q A;  1FBF A;  4OFJ A;  1QKB A;  3ZSF A;  3PD9 A;  2VPO A;  2O1M A;  4JDF A;  1MY3 A;  4ELQ A;  2RF1 A;  1SDX A;  4TLL B;  5IKB A;  4XF5 A;  1B52 A;  3GYY A;  3PUV E;  3U65 A;  4PGP A;  4DZ1 A;  3IJO B;  3PMW A;  5I84 A;  4MBP A;  5AA2 B;  4YMA A;  1DTZ A;  4GLI A;  1LAH E;  2XXQ A;  4NGU A;  1WVJ A;  4NF4 B;  2A5T A;  4XKQ A;  4F3G A;  4MIJ A;  3BKI B;  3P7I A;  3VE1 B;  2B65 A;  3OO9 A;  2PX1 A;  4PBQ A;  1FRP A;  4IR8 A;  3TOD A;  3HPI A;  4GRK A;  4QF9 A;  4NE4 A;  3O66 A;  3C35 A;  2OK2 A;  3EN3 A;  1M5D A;  4NF6 B;  4ZEI A;  2NVU B;  1VE4 A;  4R75 A;  1SI0 A;  2FYI A;  2PFZ A;  3S9E A;  3TPA A;  5I57 B;  3FVK A;  2KQZ A;  3TUS A;  1Z7M E;  2CZH A;  1B40 A;  2F6P A;  2VP1 A;  4JB7 A;  1I6B A;  3C31 A;  3EF7 A;  3B6W A;  4GL8 A;  4KYE A;  3C33 A;  2O84 X;  1DPP A; 
#chains in the Genus database with same CATH homology
 3T0J A;  5EQ8 A;  5EYH A;  2QVR A;  1IMB A;  3HFU A;  4NAP A;  4I3Y A;  3KC0 A;  4HE2 A;  2L5V A;  1NUY A;  2HHM A;  2WYP A;  4OVR A;  4PAI A;  5IGA A;  3LV0 A;  3IFC A;  4GBV A;  2OX3 A;  3E78 A;  4NN3 A;  4GWZ A;  3LUZ A;  1KA0 A;  1K9Z A;  4NF0 A;  2FHY A;  4GWX A;  2P3N A;  4GWU A;  3E79 A;  4AS4 A;  5IZ3 B;  4O8M A;  2XXK A;  5J1D A;  2HZK A;  2Y5K A;  2Q9T A;  5A5L A;  4GWY A;  4O94 A;  3D1R A;  2CZI A;  1FBH A;  4PTK A;  4MCO A;  4MAG A;  1FPL A;  1FBE A;  2MKZ A;  5IM2 A;  1FPI A;  3BIG A;  4N15 A;  1EYK A;  4N8Y A;  3B8B A;  3FBP A;  1LBY A;  1FPJ A;  5DW8 A;  4XFE A;  4JVC A;  4XEQ A;  4P56 A;  1NV6 A;  1FBP A;  4QXD A;  5JK4 A;  4PDD A;  4P1E A;  3FXB A;  1IMC A;  4HE0 A;  5ET5 A;  4F19 A;  4PF6 A;  2V4C A;  1FSA A;  2HPG A;  4F1V A;  2OWZ A;  1NV5 A;  4GX3 A;  4MMP A;  5EYG A;  4N8G A;  1NV7 A;  1EYI A;  5J16 A;  4P8B A;  5EQ7 A;  1G0H A;  4KXP A;  4PDH A;  5T3J A;  5ET7 A;  1FPF A;  3PTY A;  4P1L A;  1DCU A;  4H45 A;  4GBW A;  2XWI A;  1BK4 A;  1YZ0 A;  4PE3 A;  3B50 A;  3RPL A;  2HZL A;  4X04 A;  1CNQ A;  2VT5 A;  4OVP A;  2HXR A;  5LDZ A;  5I5P A;  4OAN A;  4I3E A;  1INP A;  1DBZ A;  2DE4 A;  4N17 A;  4NG7 A;  1FPK A;  2JJK A;  4AS5 A;  3A29 A;  4HXV A;  4UAB A;  2Y5L A;  4NQ8 A;  3MYU A;  2QFL A;  1NUW A;  4MHF A;  1KZ8 A;  1FPD A;  4GWS A;  2FIE A;  2KR0 A;  4N4U A;  5EQ9 A;  4PCD A;  1FBD A;  4OVS A;  4MJO A;  1RDY A;  1KA1 A;  2ZZW A;  4MX6 A;  4PBH A;  1FPG A;  2WBB A;  1NV3 A;  1K9Y A;  3W9V A;  4LN5 A;  1NUX A;  2XWV A;  5IZ3 A;  2F5X A;  4MEV A;  3MST A;  4JVI A;  1NV2 A;  3RYD A;  2FIX A;  1FJ6 A;  1XI6 A;  4PGN A;  2WX9 A;  3NOH A;  4JVD A;  2XA5 A;  3QMF A;  3KBZ A;  3BIH A;  2DE2 A;  4DI3 D;  2WYK A;  5F24 A;  4HCY A;  5ET8 A;  1Q9D A;  1SPI A;  5IZ1 A;  5EQA A;  4X9T A;  4PET A;  4FBP A;  1LEV A;  1IMF A;  4OA4 A;  2CEY A;  1NUZ A;  3IFA A;  1YYZ A;  1EYJ A;  4MNC A;  2R8T A;  4P9K A;  2WEF A;  4F18 A;  4PAK A;  4YIC A;  2CEX A;  2B4L A;  4QBA A;  2BJI A;  4N81 A;  4GX4 A;  1RDZ A;  2V3Q A;  4PC9 A;  2GQ1 A;  3T1B A;  1FPB A;  4MNI A;  4NX1 A;  2QPQ A;  1FTA A;  2XWK A;  1NV4 A;  4OVQ A;  4O7I A;  4P3L A;  2DDK A;  2Q8M A;  4I40 A;  4PFI A;  1YXI A;  5IZZ A;  1IMA A;  2PCR A;  4N6K A;  5FBP A;  4F1U A;  4GWW A;  5I7I A;  5ESY A;  3EKI A;  4P47 A;  5I3S A;  4O7M A;  1NI9 A;  3CHG A;  4H46 A;  1IMD A;  1LBX A;  1FPE A;  1IME A;  1NV0 A;  2QVV A;  2P3V A;  2DVZ A;  2XWO A;  4MNP A;  2F3B A;  1D9Q A;  1LBZ A;  4HCW A;  4N91 A;  4YZZ A;  2F3D A;  1FBF A;  3W9W A;  2ZZV A;  1DK4 A;  5ET6 A;  1RDX A;  2B4M A;  4NHB A;  2VPO A;  4PFB A;  4DI4 B;  4GX6 A;  2PFY A;  2ZZX A;  2DE3 A;  4OVT A;  4XF5 A;  4PAF A;  2WBD A;  3GYY A;  2FBP A;  4X8R A;  3U65 A;  4PGP A;  2VPN A;  3ROJ A;  4NGU A;  2Q74 A;  1QGX A;  5LTC A;  1NV1 A;  4G61 A;  4MIJ A;  3SZP A;  1JP4 A;  3ISP A;  4PBQ A;  1FRP A;  4IR8 A;  1FJ9 A;  4M1V A;  3KC1 A;  3RPL B;  4PFR A;  1LBV A;  1FBG A;  2PFZ A;  2KQZ A;  2CZK A;  2CZH A;  2FVZ A;  5CM6 A;  1AWB A;  2QVU A;  4HE1 A;  1VDW A;  1LBW A;  1G0I A;  4PF8 A;  4N6D A;  1FBC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...