4OVXA

Crystal structure of xylose isomerase domain protein from planctomyces limnophilus dsm 3776
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
270
structure length
270
Chain Sequence
SPFEISLAQWSLHKAFFDKKADPMDFAKIAKEEFGINAIEYVNQFYKGKAEDQAFLADLKKRADDHGVKSLLIMCDGEGALGDADEAKRKKAVENHYKWVAAAKYLGCHSIRVNAQSGGSYDEQLARAADGLRRLTEFAATHDINVIVENHGGLSSNGAWLAAVMKKVDHPRCGTLPDFGNFRVSKDEMYDRYKGVEELMPFAKAVSAKSHDFDAAGNEIHTDYRKMMKIVASFGYKGYVGIEYEGSKISEADGIKATKKLLETVRSEMA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Xylose isomerase domain protein TIM barrel
publication title Crystal structure of Xylose isomerase domain protein from Planctomyces limnophilus DSM 3776
rcsb
source organism Planctomyces limnophilus
molecule tags Isomerase
total genus 101
structure length 270
sequence length 270
ec nomenclature
pdb deposition date 2014-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01261 AP_endonuc_2 Xylose isomerase-like TIM barrel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 4ovxA00
1MUWA 1XLDA 3KBVA 3KCOA 4YTTA 3VNMA 2J6VA 3QYSA 2X7VA 4K3ZA 3BZGA 2GYIA 1DIDA 3KTCA 3AYVA 9XIMA 4EAYA 3ITXA 1XLAA 1XLMA 3C0QA 1XLBA 3DX5A 2QUNA 3CQHA 4A8RA 1CLKA 2GVEA 4GQBA 1O1HA 4A8IA 3OBEA 4GLEA 1XYCA 3JU2A 1XP3A 3TC3A 1A0DA 2I57A 2G0WA 3C0LA 4HHMA 1XIIA 1OADA 1XIEA 1XINA 1XICA 4QE1A 1GW9A 4YTQA 3KBMA 3KWSA 2I56A 2ZVRA 3BZJA 3XINA 5XINA 1XLEA 3KBJA 3WQOA 4X63A 6XIAA 4A8NA 3M0YA 4YTRA 2XIMA 1XLFA 4W4QA 5B80A 2NQ9A 2OU4A 2Q02A 3C0SA 4HNOA 4XISA 3UU0A 1XYAA 1TZ9A 1XIHA 3M0LA 4QE4A 4QEHA 2HCVA 2XINA 3ITOA 2GLKA 4OVXA 3ITLA 7XIMA 5B7YA 5H1WA 4DVOA 4J4KA 1D8WA 3U0HA 2XISA 4ZB2A 5I7GA 2QUMA 3QC0A 3GNXA 1BXBA 1K77A 3CQJA 2QW5A 1DIEA 3NGFA 1XLLA 1A0EA 4A8LA 3IUHA 4ZB5A 3M0XA 3P6LA 4X60A 3QXBA 4QEEA 4QDPA 1XIBA 3IUIA 3KCJA 5XIAA 1QT1A 1XIGA 1XYBA 4XIAA 1XISA 3L23A 3FVMA 3KCLA 9XIAA 1XLCA 1DXIA 3LMZA 3ITVA 5EMJA 2X7WA 3BANA 1XLIA 2G4JA 3TVAA 3N4AA 1S5MA 3AYTA 3UVAA 4QE5A 2NQHA 3UXIA 6XIMA 5B7ZA 1I60A 4XSLA 1XIJA 3UA3A 3KBWA 3XISA 1XLJA 1I6NA 1BXCA 4XKMA 5XIMA 5EMKA 2HK1A 4DUOA 5J8LA 1XYLA 3P14A 4US6A 3ITYA 1XLGA 1XIFA 3BWWA 4LNCA 4G56A 1DE6A 5AVHA 3BDKA 4EACA 4HHLA 8XIAA 3M0MA 5EMLA 5FA5A 3VNJA 3CWHA 3CQIA 4ZB0A 1XIDA 1S5NA 3VNLA 2ZDSA 1MNZA 4YTSA 1XIMA 3AALA 1XLHA 1YX1A 3DBNA 3XIMA 3KBNA 4Q7IA 3M0VA 5H6HA 8XIMA 1QTWA 4YTUA 4GJIA 3CQKA 1DE5A 3UA4A 4GJJA 4PFHA 4QDWA 4E3VA 3AAMA 1QUMA 3QZAA 4HGXA 5AVNA 2NQJA 1A0CA 3ITTA 3VNIA 2HK0A 4XSMA 4K1GA 3U3HA 3VYLA 1XLKA 4X61A 1XYMA 3M0HA 3VNKA 3IUDA 3KBSA 4KW2A 4PGLA 5TNVA 4ZBCA 5C9ZA 3CNYA 4XIMA 2GUBA 2QULA 5EMMA
chains in the Genus database with same CATH superfamily
3T05A 3NZ1A 2J6VA 1KW1A 3M0KA 1OZMA 2WBKA 4CN4A 1XLBA 4N9BA 1GYLA 1O1HA 1RJRA 3G3DA 1I2RA 5HATA 4H83A 2FIQA 4NNBA 2W92A 4C6DA 1DXFA 3WD2A 3GZAA 3MKVA 1J0YA 1GVIA 4NJJA 3GNXA 3WLTA 1O1ZA 1DYSA 1GQJA 5DCEA 3UR5A 4JTQA 5CJNA 1TZ7A 1KM6A 3DFYA 1G01A 5FEZA 1XUUA 2NQHA 3STCA 4PTNA 5E9XA 3A24A 3VGEA 1H1ZA 3AS3A 2W61A 1K6AA 2FJKA 1M3UA 4D6HA 2BP1A 3O16A 4AAJA 2CEQA 3BDKA 4PSRA 1UCWA 5D05A 3AS2A 3G24A 1BF2A 3E0IA 1XIMA 5EBAA 1AL8A 2CW6A 3NCOA 5DRCA 3GH5A 1ZP4A 4PTWA 3UY8A 1ZNNA 1FRBA 2J75A 1DQXA 2E3ZA 3DYOA 4F9JA 2I1OA 3O6CA 3FEMA 3HBLA 3QSRA 1TPC1 4JNYA 1LBMA 8TIMA 1WDRA 3PUOA 4W5ZA 3OTRA 3LYEA 1H7WA 4MNMA 2EQDA 3PWAA 3MYPA 4TMCA 3FA5A 3HU7A 1R3TA 3UYIA 3V5FA 4JTKA 3GIYA 3KVKA 2BGNE 1Z7AA 2GGGA 1M7XA 1W1PA 1UR1A 3PPFA 1HG3A 4LVBA 1XSIA 1HGYA 2CITA 4DYJA 3KBMA 1V3IA 1VCGA 4HSHA 4A8NA 1JPDX 3N4FA 3UWWA 2XN2A 3UGVA 3A5FA 4MHBA 6CGTA 3SSZA 3VCRA 1L6YA 1XS2A 2IXUA 4FXRA 1QT1A 3W7OA 1XISA 5J5RA 1O5QA 1Q5MA 3B9NA 4ZOCA 4RV8A 3OQEA 1J12A 4RDYA 3R8GA 1ZLPA 3PPHA 3INPA 5GQBA 5I00A 1DJGA 2WV8A 2QMKA 3GXNA 3U48A 2Q01A 1OFQA 3T6CA 4B15A 5K3VA 3QF0A 1U1HA 1T8QA 1J18A 4LNYA 3SCUA 5EPDA 1UB3A 4IJCA 3OU8A 3W86A 3IIPA 4O1DA 1EB3A 1GVFA 1Y7VA 4OHQA 2EO7A 2CHNA 2NXGA 3IUDA 3GIQA 5F7UA 3NTYA 1VPXA 4MF4A 5K9CA 3WD4A 3OG3A 4XB3A 1TG7A 3BLLA 2BVTA 3L4XA 2C18A 4HA4A 2B7QA 4GYKA 3MMDA 1EP1A 3AJ7A 2X1RA 2Y8VA 2X1SA 3DHUA 2GSHA 1Y0EA 3BZJA 2ZX7A 4GVFA 2PI6A 1R9XA 3HQOA 4OUEA 3NUKA 1UKOA 3N3MA 2GGJA 1IIHA 1F61A 2WJEA 1Y5XA 1W5OA 5A8PA 3PZIA 4ZCWA 4JFVA 2OEMA 4GUJA 3IJ7A 1F8IA 2QUMA 1W1YA 2Z2UA 1YHTA 3RO8A 4OQVA 1G6CA 4HKPA 5I3GA 4X60A 3C56A 1CNVA 5LIKX 1BTCA 3AU2A 3NXFA 4JCLA 4A3RA 2CLEA 3V35A 5LA1A 3OA3A 1OGSA 4WOQA 2X1IA 1IEIA 5AYBA 1VBHA 4LAZA 2NX9A 3W01A 3OYXA 4YYFA 2XH7A 2ZXDA 4FAMA 3W26A 4W7UA 1KTNA 3K4WA 1IE7C 3V1PA 4H9TA 1P6CA 3H2EA 1R87A 1E4IA 5MF5A 3A5VA 4M56A 2PDUA 4AVFA 2Y5EA 5FJPA 2F2HA 1RCQA 3VFLA 1TPDA 1U33A 3MI6A 3CUZA 4BI7A 4LOCA 2DUZA 3S5NA 2C8NA 2WPBA 1S3TC 4EIVA 3G1AA 3K5XA 2X0SA 1DIKA 3RLGA 2G3IA 5T9CE 2J24A 1HNYA 3TN3A 4FEZA 4MKSA 1R3QA 1XL9A 2GVYA 5AYIA 1OQFA 4H9MA 4PEEA 3N9KA 3LLDA 3WUFA 5A2BA 3S83A 1JUEA 1EUNA 4HA3A 3WF1A 2XHYA 2FYMA 2ZZ7A 4FPSA 3I68A 4LBUA 5G4EA 1Q6RA 5CSYA 1ZHAA 1E9YB 1IZJA 2O7QA 1NJJA 1FFQA 1OFDA 1KCLA 1XYBA 1QASA 1UZDA 3KCLA 4BR1A 1TPB1 3GU1A 4IQJA 4TR9A 2Y62A 4J5NA 3VOHA 2E77A 4TUFA 2G41A 2HXUA 1ESWA 1B30A 1Q2SA 3SAZA 4EACA 3LV5A 4H9YA 4ZA0A 1A5LC 1PWLA 1P5BA 2PPGA 4NYUA 3GFYA 4U28A 4WX2A 3RM4A 4GXWA 4PA8A 2WVUA 2X2YA 4ZOBA 3SBFA 1BRLB 2D3LA 2XTKA 1MW0A 1X7FA 3MHUA 3LI0A 5M5DA 4CQ8A 4JFWA 2WNZA 3OVPA 1XH2A 3R10A 4E8DA 2RGMA 3CPGA 3TAOA 2OFJA 1XLDA 4R53A 3G8EA 3TH6A 3EX3A 3BZGA 4HCDA 9XIMA 5T26A 5F2GA 1ODUA 3CTLA 2XWDA 1PZ1A 1TX0A 4PODA 3TJLA 4HD5A 4Q22A 1OYBA 1Q6LA 4Z1YA 1JYWA 2FZMA 3N2TA 4R5EA 4D6GA 1VPYA 4NJKA 2ZTKA 1KTCA 4L65A 4FF5A 2ZX5A 5BRPA 1TJ1A 7XIMA 2AOSA 1QNOA 3W1NA 3SN1A 3O07A 3W7RA 1YTDA 2PF0A 5EMUA 1RJPA 2CWNA 3BXWA 4XVEA 4FX6M 2F2KA 4DHGA 1RA0A 3NOYA 1B3VA 4QX4A 4MWAD 1YTEA 3DFPA 1DJWA 2DV0A 3F5KA 1I2PA 3MTWA 4UTTC 3PTDA 3LTSA 4E8CA 3KUMA 4LUSB 3A22A 3LMYA 3P14A 4DM1A 5IFPA 3GDRA 1VS1A 5E70A 5AC7A 4DJEA 2DT1A 1UD4A 4QLKA 3A23A 3QGKC 3LBOA 1X38A 2PA6A 1HKIA 4EE9A 2OO0A 5HWJA 1QCWA 2OR2A 1D2KA 3NL2A 1ZL1A 4EAYA 1A4LA 1OC6A 1PKLA 4HMNA 4QLLA 3EEZA 4BJHA 1PIGA 1V08A 4HYRA 2YBVA 5DMLA 5D9OA 2Y63A 1BGAA 4I6KA 5E6YA 2HBXA 1B9ZA 3OZPA 3RPMA 3L68A 5K9XA 4N9DA 2Y70A 1OYCA 2BXZA 3PPCA 2PUZA 2DH2A 1GZGA 4YU1A 2D2GA 3NQDA 4WJEA 3DHFA 3SUSA 3NQFA 2QJIA 2VZOA 1S3HA 5BRBA 5AOUA 4ZQRA 3IUIA 2OSYA 3EX6A 4XIAA 5BMXA 5CPSA 3UERA 3CUXA 4YCOA 3FK4A 4OKDA 2H90A 3VD3A 1FWNA 3GAYA 3E0LA 1T41A 4A35A 1KM2A 4C5YA 4EK7A 4AZ6A 2BGQA 1S46A 4GNKB 4AZ7A 5JIPA 1EZWA 1F6PA 4REQB 4WDTA 3JZUA 2W6RA 1LWJA 1TV4A 3DHPA 5J04A 4JOMA 4R85A 2J7HA 3I3DA 3KTXA 3W70A 2P76A 3AC0A 3RMJA 3GZ3A 1S2VA 4W86A 1H41A 2QIWA 4XO7A 4CQCA 2IKHA 2PD9A 4A2SA 1X6NA 3GNDA 1KGUA 1F07A 4A21A 3GHTA 2CZFA 2R1LA 4GY1A 4D71A 1JXKA 2NT0A 3ARQA 2DSKA 2A3HA 3JUGA 3ZVIA 1H7PA 3C86A 4PFMA 4UFHA 4RX0A 3T9PA 4URIA 3F5JA 2VOTA 2CLMA 1REQB 3AUOA 2ADAA 2HPMA 2VR2A 3F2BA 5C2CA 2IQTA 2PDQA 2OOGA 2XFWA 2A1YA 4OWGA 4AH7A 4GCXA 5C6MA 4NRRA 1SJDA 1BXBA 1DQWA 2B0MA 4Q33A 1KO0A 2PWFA 2JKPA 4Q8MA 4HCHA 4XWUA 1F74A 2RAGA 2XZ7A 4LQ1A 3UWUA 3AIBA 2CLHA 1TFVA 1TWIA 2VGGA 5I3DA 1UBPC 2YBUA 1J01A 1B9BA 3UESA 4FF7A 3UXIA 1A5MC 4QAWA 3AIEA 2BV9A 2P3ZA 3BG9A 1VIWA 4H2HA 4GNVA 4PUWA 4Z2HA 1QW9A 5A8NA 3MSRA 2DZPA 1T6MA 4DAFA 3LPGA 3P0WA 4ADTA 1EHAA 3WBEA 3I6RA 2RDUA 3CZKA 4UNKA 3E3HA 3UG5A 1A3HA 4AMAA 4ZE4A 3LHVA 2WJZA 5AVNA 1AJ0A 2WJDA 2X40A 3VGDA 4JTEA 2V81A 2C16A 3QY6A 1GKQA 4DBSA 4DQWA 5LXEA 3KM8A 2GJXA 4R7WA 5HQEA 2X30A 3DXIA 3W7HA 3PG8A 1Y65A 5EYWA 1Q2RA 1WBHA 2FVKA 4ZZ9A 4UMAA 4IPIA 2D0FA 1XFBA 4WXZA 3TWBA 2QMJA 3GD6A 1E55A 1Y8BA 1V6XA 1GQIA 3UFYA 3MSDA 1WZAA 3O0KA 2WXDM 4JN6A 5FESA 4J4KA 2ZWZA 1GOIA 3L2LA 4L4PA 1KM0A 3GDTA 4M51A 3RPDA 1VFFA 3IPWA 1RP8A 4PBEA 4I9MA 3K8KA 4PB5A 1KFBA 1UD3A 2GWNA 1US2A 3M5VA 2QCHA 3EX2A 1AW2A 4RE3A 1IT7A 2FB2A 5JBEA 3WFAA 5AYYA 2ISFA 1DWHM 5GVJA 1ZJAA 2V5BA 2FTYA 4XO6A 3CUHA 1QWGA 4HJFA 1LL7A 3U6WA 2WKJA 4I9TA 1NOUA 4DEFA 2EG7A 4O0KA 3AAMA 1NWRA 2VZTA 3TFCA 4JFTA 3UWYA 4YN5A 1O5KA 4QROA 1A50A 4D8LA 1R9ZA 3LX9A 4F0SA 4AD2A 1JI1A 1PE1A 2G4FA 6REQB 3VKKA 4HBKA 1MXDA 3FXYA 4ZQCA 3L0KA 3LM3A 3I6EA 3AIVA 5GNYA 3NDYA 4IIEA 3W6MA 5AHIA 4S39A 1CXIA 5MHBA 1KXTA 4UOZA 3M0YA 5F4SA 3IRSA 3OIHA 1TTJA 3MI2A 4JPGA 5HNRA 4PULA 4P7NA 2HDJA 1NEYA 3T1GA 4L6OA 4NNAA 3WLLA 1PVNA 4P8XA 1TVPA 4QJ1A 4W87A 1FHUA 3FKKA 1KA9F 1P7TA 2JK2A 5A6JA 4Z2LA 1TR1A 4W8BA 3EX4A 4AG0A 3TK7A 3SCTA 2CZVA 3QQ1A 1J0ZA 1JAEA 2VUNA 3O8AA 2NSOA 2NQ5A 3W1MA 4DZHA 2Z2AA 2OKTA 1J0HA 3ABQA 5DT7A 4V33A 1ZJHA 4KRTA 1OBAA 3LB0A 4KCTA 1HO4A 4ROPA 1LBFA 4PMRA 1EQPA 2AKZA 5DXYA 2PTYA 2Z1SA 4Z17A 1DJYA 4QR6A 4E3VA 5F2LA 3QR3A 7CGTA 2TSYA 4P2VA 1FCBA 4MNKA 3RCMA 2C1HA 4FLSA 4DWSC 2PODA 4X3ZA 3WG6A 3NWRA 4QCFA 1HFBA 4GRSA 3O1NA 2C7FA 1EWDA 1KRMA 4Z2KA 4KERA 1PTDA 1XJBA 5KZMA 5CH9A 1LT7A 1WXZA 2R1NA 1HW6A 4A3YA 4J7RA 4XAYA 4Q8TA 4LC8A 1MW2A 1XLEA 2I7GA 2A3AA 5FI8A 4D6FA 2WVTA 1JAKA 4TX9A 4IMCA 1BFNA 3WZ0E 3RRAA 3N19B 4GUGA 1Z3NA 2WZIA 2NVCA 4EP8C 5CC3A 2BODX 3ZT6A 3WNOA 3IS4A 1XIGA 4U3CA 4DI9A 3RCNA 3B04A 3T7VA 1JJKA 4F0LA 1KM4A 3LRKA 4JTGA 1M03A 1S38A 3LTPA 1YADA 1I9CB 1NOFA 1WZKA 4P8UA 3HQPA 1EBHA 4DUVA 3BAXA 3PZOA 1JD7A 4I8YA 3S1UA 1YX1A 3PBMA 1BD0A 5HUPA 1XDJA 1NWTA 2PDIA 7REQA 5CJMA 3TNBA 3WQEA 3ARVA 4DM2A 4L9YA 2ZRUA 3BUVA 4O53A 4XBSA 4OT7A 2GZXA 1XH1A 3WFLA 4GKLA 2O9TA 2F61A 3LS9A 1K8YA 3NM3A 4N4QA 3W1QA 3TYAA 5FAJA 4NKCA 1U5JA 3OGVA 3QPYA 3NVTA 4HHMA 3K1DA 3W53A 3OVGA 4ASTA 1FBAA 1LBLA 5HPCA 6XIAA 1OT1A 4G2DA 3ISIX 1QMLA 4QGCA 3FSUA 2YW4A 3MBFA 3B0UX 1UQYA 3UCQA 2J25A 2TAAA 4Z2GA 1WKFA 1W5QA 5F1UA 2WKGA 3S1WA 3N2XA 5IDIA 4AUBA 2CXGA 1KFEA 1GCYA 4XUGA 1OINA 3MHFA 5HQMA 3WDIA 2CZ5A 4PCTA 3PJWA 1OG6A 2PBOA 3CZJA 4MDPA 3EXRA 3H4GA 3T55A 4GACA 1W2VA 4LF2A 3P5ZA 1R5YA 4X9SA 1YRRA 3GDLA 3VIGA 4IX2A 4NZCA 1JCLA 2EG6A 2X42A 2W3ZA 4GQGA 2PEVA 5BXRA 1F3TA 4PTMA 4R3UA 3GG0A 1HL9A 3STPA 3T44A 3ZIZA 2VEFA 3H26A 1OC5A 4N6EA 4NX0A 4XIMA 5LIYX 1DIOA 3N73A 1VRDA 2YSWA 2EPKX 3T0AA 3STFA 1FWAC 2CLOA 2FZNA 2QUTA 4JL1A 2V8ZA 4JKMA 3C2OA 4C1NB 1H11A 1UH3A 3G6MA 2DUXA 4ZODA 2O9OA 3ARSA 5I23A 2VEMA 2ZCGA 4PMQA 2Y8UA 4C6FA 2DGAA 4WZHA 3G0XA 3IIXA 3MS8A 4XISA 2O4MA 3DERA 1XYFA 2E9BA 3LOTA 3T4CA 3ATYA 4MFDA 4IXHA 3NDOA 4PL2A 2QIIA 1XSJA 5I07A 1JL8A 1GZJA 1ZALA 2VUYA 3CT2A 3TW6A 3WLOA 3ONCA 1FTXA 4D8AA 5B7ZA 3UWVA 1JCYA 1GVQA 4XD3A 1XYLA 1VYRA 3DG7A 2HROA 3F5LA 5KITA 3BH4A 1DXEA 3GTFA 1ONXA 1R46A 4O10A 4HMEA 3SI9A 2GVLA 3ZWTA 3VPLA 4AMCA 1S5TA 3LHYA 4HGXA 2Y8KA 5EU9A 1MW3A 3THAA 1M41A 2D2JA 1MUMA 3GVRA 3CNYA 2JEPA 3DKJA 2DZBA 2EPHA 2QCDA 1J93A 4UTIA 4NZ1A 1FWSA 3C52A 4LCRA 3W2NA 2VX4A 2DSZA 1L6WA 4JX5A 1HGWA 4FX7A 1VFHA 1M68A 2YYUA 4B9YA 1B3YA 4GJ1A 3TW7A 1WKEA 3MU7A 2X09A 4LH8A 4AWTA 3RPTA 1MUCA 2WOQA 3UETA 3WQWA 3W4RA 3CTTA 1TWSA 1A47A 3I10A 4H3DA 2ISSA 3W2KA 1H1NA 3V3WA 2IPJA 4AHOA 4RDWA 5DANA 5M3WA 2VJXA 3AROA 4P5UA 1B5TA 3WQ8A 2DZUA 4C1KA 2C1GA 4C6LA 1GHSA 4J35A 3SCQA 2DZWA 3UQNA 3R58A 2WWDA 2YGYA 3PSVA 1KFJA 1TPWA 1HQTA 2GSEA 4TX6A 2OSXA 5XIMA 3LCFA 3RR4A 4IP7A 2WYSA 2OLSA 1ITXA 3A6OA 1X8CA 1ENUA 1LLOA 4ILSA 4B5UA 3XIMA 4WD0A 3O6AA 1FXQA 3KFTA 4RCXA 1DJQA 4Q4QA 3TLLA 1FWEC 1W9PA 3O7UA 3TA9A 3W74A 2VEGA 4UQ9A 2HQAA 1XDMA 1ME7A 1AZ2A 4GQRA 3CB3A 1ZPTA 3C2RA 6ALDA 3MWCA 4JHMA 4RZ5A 1TMHA 5D30A 2C79A 1JR1A 3HO8A 3H7RA 1J0KA 4AXKA 3WEZA 3ITGA 3BMVA 3M6YA 3VUSA 1J96A 1XKJA 4IIHA 2Z29A 1K7FA 1XIIA 4RE0A 4PMYA 3UR7A 4GH1A 4K1WA 1Q6FA 3OW1A 2FQIA 2VM8A 5JU6A 3IJLA 1H7OA 5H8MA 4S3BA 2HCVA 3M07A 2IPFA 2WSPA 3UZYA 4PL1A 3FN9A 4EXBA 5C70A 1XF0A 1TQJA 3ID7A 1VJIA 5HDRA 4NZFA 4O18A 3GU9A 5JH2A 5AZ0A 1OK6A 4S3CA 1GVEA 4IICA 4QHRA 1C7TA 1PZ3A 3W7MA 1PIFA 2PRLA 3CUFA 2CLIA 1XD1A 3G0UA 1RA5A 1ZCOA 4BY3A 2QCMA 2VYOA 1PUDA 5DCBA 1F3WA 4NHVA 1DE6A 3PPGA 1XGDA 4HHLA 4GC3A 3S1VA 1ECEA 4N9EA 3BO9A 3VM5A 4FIQA 2UY3A 4R34A 4W89A 3MMWA 4M5PA 2PDGA 1K8XA 3C5QA 2V67A 3S2NA 1QUMA 1B57A 3QPEA 1XYMA 5CPLA 4PSPA 4WHBA 3RITA 1LQ0A 5GJPA 4RNIA 2QJHA 5E0FA 2PTXA 2JFEX 3BV7A 1PZ0A 5F2MA 3SY1A 3W22A 3A3XA 1GPWA 1LUCB 2G50A 4LPCA 3GRIA 1RPXA 1XKYA 3W6LA 3KOYA 2QPSA 1IT0A 4X22A 3QKZA 3LBCA 4IIBA 1W6TA 1VYSX 4BEUA 4A29A 1JPIA 4H1ZA 1ICPA 4D6IA 4WF7A 2XFRA 3P82A 1V77A 1HL8A 4A05A 2RHGA 3M0ZA 4U5KA 5JBDA 1CGXA 5HAOA 1XPYA 2E67A 1FHDA 3MP3A 2JGQA 1A5UA 3UVAA 3IK2A 3H53A 4U5IA 3VX0A 1IXOA 1ZUAX 3QHNA 1ALDA 1W32A 2AL2A 3EXTA 2VL4A 3LTYA 4O8AA 3BG5A 3OZYA 3EOUA 4JTFA 2YL8A 4D8ZA 3U57A 4FNSA 2XFFA 3NFUA 4FLQA 3HG5A 3DBNA 9RUBA 1XSKA 1QTWA 3GB6A 5LNVA 2OOFA 2IPGA 3WDPP 1A0CA 2VFDA 2ZICA 3CH0A 1I1WA 2BASA 1UYQA 1IEWA 1G7VA 1W54A 2X8RA 3AYRA 4NASA 3IJIA 2INZA 4AY7A 2QPXA 1SZEA 2QS8A 3MUZ1 1MYRA 3N3TA 3B9AA 4G7EB 5E0CA 2PDLA 3BGJA 3RX4A 5FCZA 1A5BA 4TVUA 3E2SA 4P7RA 3HZ3A 3GW3A 4QCEA 1XI3A 2CYGA 3ARPA 5M17A 4LWWA 3NQGA 5K2ZA 1V03A 5KMYA 5LIWX 4FXSA 2F7FA 3BAIA 4TQTA 5CG0A 3C2VA 1J10A 3WDJA 4HU4A 1FWIC 4JNMA 4MJMA 2CKSA 2NUWA 1FCQA 3N2MA 4HOZA 3V0UA 4K8HA 4Q7BA 5BROA 1VIZA 3PZGA 3WNPA 1EF2A 3M46A 4CU8A 4FK9A 3B8WA 2BOEX 4PCSA 3F4NA 3AXIA 3PK7A 1AH0A 2WSQA 1IV8A 3WQ6A 4ACYA 4GINA 4IPLA 4XAPA 1WUEA 1E5NA 2Y2WA 1NTHA 1V6TA 3T4WA 2WVVB 2OGJA 2XIJA 4AXNA 4NRSA 1V3HA 2L5HA 1CXHA 3O0FA 5DO8A 3KP0A 4LB4A 2FHFA 4JTUA 3PFRA 1LOSA 4IMGA 5FEWA 4CD5A 1HP5A 3G1RA 3R25A 1FCVA 4OJYA 2BY0A 3KWXA 5BU9A 4B2DA 1R86A 2IQ0A 1O12A 1W1B1 3IGXA 4WOZA 3WUGA 4IGHA 3TAKA 3PS7A 2E9MA 4GIYA 4OGZA 5A5WA 4TX8A 4LFYA 4AWEA 3SR7A 4HNVA 1SR0A 3VZXA 1UA3A 4BFAA 2WZTA 3GG1A 3VKBA 2I5GA 2Y85A 1IYXA 2GQ9A 1WA3A 2IUZA 5AY7A 3BLDA 4CVWA 4D1IA 4GY0A 3LRLA 1K03A 3A3HA 1XLIA 4FS9A 3W1LA 3AYTA 3H70A 1UPMB 4NX5A 4B5XA 1VFSA 4ORIA 3GVVA 3FXGA 1DJNA 2J78A 3N9RA 3LXAA 4BI5A 1IR2A 4FX8A 1JPHA 2PDHA 1VGAA 1XBYA 2ALRA 4W8LA 1C8QA 1BPLB 5M03A 2FHCA 4YL2A 3DI0A 4UXDA 2OXNA 5I3IA 3R4IA 1UWSA 3VD9A 5I77A 1NWSA 2VCBA 1OCNA 4NP7A 5BMWA 5KZ6A 3LQLA 4QLJA 3WQFA 1R3WA 1P0EA 4AZBA 1ZB5A 4K37A 1R7AA 1WXJA 1YPIA 5DMYA 3EA1A 3CZGA 1IF2A 4IX0A 3T0TA 3WIJA 1GONA 2CXEA 1YMYA 2Y0FA 2XVGA 1RY0A 2PP3A 4X0NA 3U5UA 3M7WA 2GOUA 1XBXA 3WDQA 2OEJA 1V6YA 2ABAA 2OU4A 1UD8A 1EEXA 1KRBC 1OX4A 3QR1A 4PMXA 3FAXA 4MJZA 2HEJA 3E02A 2E25A 1JNEA 1DJZA 1RQEA 2Q8XA 2DT2A 2XIIA 5CQ1A 4J9JA 5HANA 2R24A 1EP2A 2IW0A 3U4AA 2HISA 4O13A 1BG4A 2HE8A 1XD0A 5K7JA 2BZNA 4MB1A 1HP4A 1UR4A 1JQXA 1SSDA 1Q3NA 3EDJA 3RLVA 3NQMA 3L5LA 1A5NC 1QBAA 3WQ5A 1YQ2A 5BXTA 1AODA 1YEYA 4JYDA 3WLQA 3C4UA 1UA7A 4ZL1A 1V93A 1S5VA 3TP4A 3T07A 3WK0A 4G6CA 1UH4A 4MPQA 2JE8A 3S9YA 1Z6KA 4O0QA 1JQVA 1GT8A 2FFIA 4IQLA 3WX7A 4EANA 4JHZA 1KB3A 5HULA 2FVMA 3PBGA 1NQKA 1JF5A 4ZOAA 3B0VC 1H60A 4G1NA 2WCGA 1PPIA 2HS8A 4BKNA 2BOGX 2W91A 3COTA 2ZE0A 3EGJA 4DUXA 1L9WA 2QCCA 1E9ZB 2DJLA 3ZLGA 4YNGA 3DFSA 3JU2A 4RNHA 3PB2A 1FOBA 4Q4PA 3UJ2A 3TWAA 5DBUA 5EGRA 4AZGA 5H8PA 3W1UA 2XIMA 1XLFA 1VZWA 4MNJA 2GGEA 3B06A 4N7QA 3QLDA 1UR9A 4WY0F 2BWGA 1ZAIA 3FDKA 4B16A 1RR2A 1UKPA 3QXBA 1FWFC 1XIBA 1YBQA 3QV8A 3WH6A 4XZIA 5REQB 3W6YA 3LXCA 4YVPA 3M47A 1PYFA 4PCFA 4S3EA 1T8XA 3THQA 1UJPA 3LNMA 3BW2A 1ONWA 1TREA 2YBTA 1SUXA 1V3KA 1R3YA 1LOQA 1IEQA 1UWAA 3MVTA 3CPUA 2CESA 1SFTA 1TV7A 1FWCC 1V5XA 3E5PA 4YMZA 4EXAA 5CSUA 1A4MA 1EDGA 3DUGA 3NR0A 5A8QA 1ODZA 5CZSA 2OTDA 1S1RA 3ALFA 4R88A 3B8DA 3K2GA 4DWSD 4JQ3A 2DQXA 2OLHA 1F05A 3W84A 5F1VA 3W02A 3LA4A 4BQ5A 4CEUC 3F2CA 2NX3A 1G4TA 2ZZ3A 1V3MA 1I2NA 4L56A 3AMCA 2CIPA 3FEQA 5CGTA 3OVRA 4JIPA 4C6OA 1SM9A 3UF9A 4GLEA 3TE9A 1F5ZA 4HIBA 1XINA 3O15A 1XCXA 2PLCA 4GKTA 5D9PA 3W7DA 1LM1A 4BF7A 4WR3A 4FNRA 3TFXA 5I3HA 4EOUA 4DWDA 2DT3A 4AD1A 1OGGA 2NLIA 5I2UA 3KCJA 1SW3A 5DN1A 4U4MA 1PWMA 1UKTA 3CC1A 5CZTA 3HGOA 2J9YA 3NSXA 4PMOA 1S5WA 2ISWA 3SIZA 1QPQA 1XIJA 1N55A 4AF0B 5FF0A 1LORA 1S2CA 5A6BA 5C9XA 3EOSA 1I2QA 4JS3A 2C1IA 1O68A 4EXQA 4NAFA 3CAVA 1LOLA 1GTEA 1HTIA 3PTQA 1E1EA 2WHJA 1JIBA 4CCCA 3VKJA 4CLMA 3F2DA 1NDYA 4TU1A 1KM5A 3THUA 3NURA 3CV6A 3I3EA 1CGYA 3U2EA 1W5MA 2GJXB 1WO2A 1U1JA 3S5SA 4F66A 4R7JA 3BG3A 2NZLA 5D2TA 1L2UA 3PBVA 3O6YX 4B91A 1P0KA 3SB0A 4ZFMA 1RK6A 1B90A 2XH2A 2GGIA 2E8YA 3PZMA 1TKKA 3BICA 4KFOA 3N1AA 5B80A 3EMQA 1UWQA 2X1TA 4ERAA 4JAWA 3CUGA 1DWIM 3SY5A 4O52A 3LPOA 3T0DA 2FPYA 4QISA 2EGZA 4LY8A 1J6OA 2OX4A 4GABA 3M0XA 3BGAA 4JXCA 2EPMX 1P48A 2EXOA 3LY0A 3K1GA 5HXMA 4XSLA 2XM2A 3FY1A 5LHFA 4JDYA 4CQAA 1RPKA 2Z1WA 3NL3A 2D2HA 3EEGA 4QFUA 3S6OA 4BK9A 3TROA 4YHEA 4NY2A 2OZ3A 4K6AA 1EPVA 5HMEA 4NL1A 2V6AA 1E73M 4DJFC 4HU8A 4JYFA 3SURA 1SSGA 3GUWA 1WV2A 2BHUA 1ZBWA 1T99A 1BWVA 4RW3A 4UC5A 4AVOA 3UY7A 4NZ3A 3BMXA 2QULA 4A22A 2AQWA 1FWRA 3H54A 1VF8A 2X2GA 1KXHA 1CENA 1TA3A 1AQHA 1AW1A 1WYIA 2F6XA 4H4IA 3PWGA 5A2AA 3NSMA 1PS9A 1ZFJA 4BF9A 1TWWA 3W83A 1SW0A 1YDYA 4OBTA 3CHFA 3M6DA 1W8GA 1D3HA 3HA1A 1EJ7L 2ZZ1A 1E72M 3MA8A 1N8WA 1UASA 2QVNA 3IVTA 3EDDA 2OQYA 4Q4KA 4RDZA 3EB2A 1WB0A 4F79A 2WC3A 3RYSA 4RJEA 2YXXA 3PULA 3W82A 3WKZA 6TAAA 3QGAC 1GOMA 4QEEA 3QSTA 4ICMA 1U30A 1VEPA 1P7TB 3SO7A 3FA3A 2PWEA 3R89A 4UR8A 5KTLA 5C8BB 3BANA 2VX7A 2YFOA 4J2PA 1DKWA 3FKRA 4LUIA 4GIAA 4WCJA 1ZJBA 1E56A 1MDLA 2H6RA 1E1FA 3I65A 5T9BG 2BTMA 2LLEA 4J1OA 3CO4A 3CQIA 2C6QA 4EPEC 4AZ5A 3ZWSA 2Q8LA 2E6DA 4DUWA 5LNSA 2PDBA 1WP6A 3ZR5A 4HZ6A 1ISXA 1RP9A 2QEZA 2QF7A 4XBJA 3W29A 1DQUA 2WQDA 3FYPA 4S3FA 4ML4A 5HJXA 3WLIA 3T42A 3HGJA 3NZGA 1BYBA 3WH7A 4HPJA 2HWGA 3DENA 4C90A 2DEPA 2ACUA 3ARXA 3C3UA 4QS6A 3WLHA 4EAMA 1EJUC 3APTA 2E4TA 3W9ZA 5J5DA 1EFZA 4LS0A 4JBRA 4YTQA 4N0RA 3PFMA 3IJ6A 1YW1A 3W75A 3BE7A 2B81A 2PP0A 3R5EA 5FACA 3NAVA 1EL3A 3LRMA 2DZXA 3CHDA 3GHSA 1RUSA 4UQCA 1HVQA 2QW5A 1L6GA 2BSLA 3W7JA 1F4HA 2H8XA 4M6UA 3CQ0A 3VDHA 3AHYA 3W7GA 3K13A 4PMVA 2A79A 4L1GA 3P67A 1I2OA 1FCUA 5BWAA 1VH7A 1CXFA 3VCNA 3WUBA 4GI8A 6XIMA 1PAMA 3DG3A 1SPQA 4C6MA 1IQ8A 4C5ZA 4KCUA 1JF6A 2P88A 2R94A 1O5XA 2FZDA 4MNLA 5I0DA 2QF8A 4CQBA 1PO9A 2J8GA 2V9DA 4QQ3A 2XN0A 2FGZA 4P8VA 4ZSTA 1ADOA 3VKCA 4DO6A 3W3OA 1OFEA 3HPAA 4ZQMA 2E6FA 3M41A 1V0LA 3A4WA 4QP0A 1XRTA 1ZRQA 2FPTA 2VP8A 3W7EA 3P74A 1H7NA 4K3ZA 4Q4RA 3ABXA 4LALA 2VEPA 3MKKA 1B3XA 4O57A 4H8NA 2ZTJA 2JGYA 1XYCA 5BYWA 4IISA 5FJTA 1W8SA 4M1BA 3GH4A 5AFDA 3DEQA 2ATMA 4L1WA 3SM0A 2AAMA 3F4DA 5FJJA 4PYSA 2FTPA 3LLXA 1DL3A 2PWDA 3FS2A 5CC6A 3S5YA 4DVOA 1NARA 4JCMA 4MSSA 3ZJ7A 5HWMA 4FOUA 1QNPA 2BB0A 5XIAA 1EJXC 1GG0A 5G2WA 2QHAA 3AU6A 3ZJKA 5GJNA 4Q4MA 1XUZA 2C0AA 2G96A 2RKXA 5AECA 3TR9A 3PR2A 4IQEA 1NDZA 4OE7A 1S1PA 4GIEA 3RFAA 3DDMA 4PMNA 3TYUA 2YDQA 3WH5A 5HJLA 4GYPA 1M7OA 2RH9A 2PC8A 1MEHA 1E6SM 3EZ4A 1FVPA 1UHVA 4NU7A 2GQ8A 4Q8QA 1K6WA 3AO0A 3LG3A 4QNWA 1R3VA 1S39A 1IZCA 2VX6A 3VZZA 5HNTA 1QXLA 2J7CA 3MZ2A 3RN6A 1JZ5A 1UP2A 1WUFA 4L61A 1JI2A 5KEZA 4S3GA 1MUWA 3RILA 5HWNA 2XIOA 3QYSA 3P2VA 2PCQA 4MUPA 2VQTA 1JZ3A 4MY1A 1NF0A 2R91A 2Y5JA 3RJYA 3RU6A 2Y24A 1GWJA 2QUNA 4N9CA 1CZ1A 1F76A 4A3UA 1W3HA 4TTUA 3H7UA 3WELA 2Q09A 3NZQA 3LM7A 5H8UA 2I56A 3KHJA 4BHYA 3K30A 2XGZA 3W76A 3QMRA 3G18A 3R11A 4TTGA 1YE4A 3M5YA 2XSBA 2XPKA 4M1RA 1OB0A 3P84A 3UWZA 1X7IA 1GEHA 4QDMA 3QOMA 4L1XA 4Q8OA 1RLCL 2XJ7A 3ICJA 3OB8A 1Z9AA 4GGHA 4LBRA 1OF6A 3ELFA 3KLKA 4WKFA 4PCPA 3PZQA 3VMPA 4GIRA 5DMMA 4I7VA 3TU9A 5D9MA 2DUAA 5IM51 3BURA 4DYEA 4LNCA 1M01A 3OO2A 3MW7A 1MNZA 1V7YA 3AALA 3KRZA 1EO7A 3VOGA 2YDRA 3UXDA 2VVSA 3ARWA 1TR9A 4LVAA 3MPGA 2ZXBA 1Q45A 3BAJA 1SFJA 4O28A 1K7EA 1U5HA 1J0IA 4MUZA 1A53A 2PWUA 3VIJA 3CIVA 3V0SA 4UTWA 5IHRA 5CZ0A 1BYAA 4D2JA 1DOSA 2QCDB 4L4OA 3DFTA 3MANA 4R33A 1KBLA 1CPUA 1VC4A 5A6LA 4FR6A 4MB3A 3NQEA 1SO3A 2FZBA 3DFQA 2J9ZA 4LX4A 2Z1BA 1IWAA 3MCOA 4CNNA 1YE6A 5CPMA 1WX0A 3GTHA 1WOAA 1LLWA 3HG2A 5ECUA 2OT0A 1O7AA 4UZSA 1XM3A 4UFIA 3SGUA 3HFTA 1YDVA 2J88A 2J7EA 4KCWA 3KRBA 2XSAA 3KLLA 3UJRA 2ZUNA 2O9PA 3QMSA 2H8ZA 3LNPA 4WUIA 4DBUA 5BW6A 2PTZA 2F38A 3VCCA 1KBKA 1DTNA 4ICCX 3SUVA 3H2MA 1E0UA 2CERA 2DY3A 4I9JA 3M0MA 4FR1A 3CWHA 3RLHA 3VNLA 2YDAA 1TUFA 1OCBA 4JKLA 2HS6A 1WQ5A 1ZJIA 4BQ2A 4XKYB 3MWAA 3LI1A 1X39A 5CPQA 4B5WA 2MNRA 4E4PA 4PGLA 5LNUA 2ISDA 5E1QA 2KAUC 4IM4A 5FKYA 1GQNA 2A7PA 4IHCA 1K3UA 2QDGA 3H2NA 4H01A 4TMBA 1W3IA 4W85A 3BW4A 2Y7EA 5G4WA 1KR0A 1VAHA 3U2ZA 4CNTA 1Q4WA 3W37A 1WAWA 2XWEA 3BLOA 1EGZA 1VP5A 2J47A 4BQ3A 3MBDA 4YXGA 3MSYA 5EY5A 4Z1CA 5JIWA 4JZ5A 1PDYA 4V1YA 4LEFA 3ZR4A 1VCVA 1V4YA 1W5PA 5FSDC 2PDYA 3TUUA 1Y5WA 4LSBA 3CQJA 1HVXA 1A5CA 4IG2B 4KWVA 3BSMA 1A49A 5CZKA 4U31A 2PC4A 4PC8A 3RM9A 5F2IA 4JN8A 3LGEA 4Q3MA 2WVSA 5HMSA 1K1DA 2PURA 3XISA 1EOMA 2FZ8A 1W1ZA 1KGWA 3WF0A 4G56A 3GM8A 4GPNA 2Z7KA 4QG8A 3AISA 1V02A 2CC0A 1N2VA 7PTDA 3FHAA 2ZUUA 5D38A 2VFIA 1BXNA 3UCCA 3OEXA 3LV6A 3AOFA 5I09A 3CZLA 4ZSUA 1GUVA 1P4CA 4MDOA 3MHGA 3VMOA 4J40A 2HBVA 4M6PA 2R9RA 4BWLC 4RL3A 1R6WA 2PDJA 2Z24A 3TMQA 3W23A 5EMMA 3PZNA 3L7RA 2YW3A 3KTCA 5AC8A 1IXNA 2QUVA 5IBXA 1OCJA 3VIMA 3V4BA 1FDZA 1TRDA 2PP1A 4UQEA 3KWSA 4KPLA 1BEUA 1TVLA 3WQOA 3SFWA 3GK0A 1W91A 1JYXA 1JRBA 2GGHA 3R13A 1FFRA 1J11A 2H3BA 3QKEA 2NWRA 1HKMA 3OLDA 1B54A 1P43A 4XAGA 2PB1A 3IANA 4DO5A 3QN3A 3KAOA 2YB1A 3C8FA 3PUDA 4C60A 2WMJA 3ERPA 2I14A 5I24A 1EWEA 3M5ZA 1I1XA 4GO8A 4GZJA 4X9YA 3MQTA 1W31A 2G5WA 3H7VA 1XC6A 1HKVA 3PWIA 3WFZA 1Q6OA 5J8LA 4GUIA 4PBGA 3J7HA 2VKZG 2OELA 1B1YA 2GK1B 3VA8A 3CMJA 4KWOA 2NX1A 2WO5A 3PJTA 1TPEA 3VAVA 5A6KA 3JRKA 1E4NA 2VXNA 1PXGA 4K8EA 3K8LA 3NSNA 4C6QA 1JCTA 2AAAA 4FLOA 1F3XA 3N18A 3TN6A 1DWGM 4EF8A 1JDEA 5G1YA 4FA3A 3CL6A 3FDGA 3OBAA 1W1VA 1QU4A 3SRDA 1ITUA 4WGHA 3SN4A 5KSWA 3MCMA 2D1ZA 3C61A 1DJHA 2WHMA 4X2PA 3EDFA 3EMZA 5D2VA 2OGYA 3CYVA 1EC9A 3CAWA 3Q58A 4ECLA 4NI8A 1SFLA 2RFGA 4XD6A 3CMFA 3N2OA 2OPJA 1V3JA 2C91A 4LC6A 3EYPA 3B4UA 1XR2A 1RY8A 2GQ3A 1SU5A 1JPKA 1K77A 5FF4A 2CKRA 1EEPA 1XLLA 1QO2A 2GOKA 1PKNA 3W2MA 1E9IA 1FY6A 4V27A 2VD9A 1Q6QA 3RG6A 4ATDA 4W93A 4Z08A 2XM1A 4GUHA 1JZ4A 4UNLA 1EPXA 3TYDA 1UR0A 2BY3A 3NVDA 3QGVA 1OEPA 4H8VA 8RUCA 1MXSA 2E5CA 4JQAA 2O0TA 2Q71A 4LAOA 1SJAA 4IUGA 4HNUA 4HOXA 5A6BD 4LJ3A 4I7UA 4AB4A 3BLPX 3VNJA 3PVFA 4RXFA 2PFHA 3USZA 3D6NA 3AICA 3G0SA 1UKSA 3BL3A 1FDJA 3GR4A 3WBYA 1UR8A 4LUSA 4RPPA 5AYXA 1KV5A 2HK0A 5C71A 4CNUA 5E0KA 3RAOA 4PRWA 1IWBA 3UYCA 2O56A 3QV6A 2ZRZA 4ZVJA 2VGIA 4RUBA 1OJXA 3MDUA 1U1UA 1FQ0A 1EC8A 4EPKA 3K46A 3C0QA 1DWJM 4GG9A 3QR0A 1CLKA 3TCEA 4LGXA 1D3CA 4XAFA 3SSJA 3URAA 3GBDA 1W9BM 4AVNA 1LZOA 3L4UA 4HQVA 4CCZA 4IMDA 3WK3A 4E2BA 1LROA 1Q7ZA 4GXMA 3GNNA 5ABFB 4ADSA 3RR1A 4S3DA 4AZCB 4RR4A 3WQCA 1PX3A 1B4EA 4M29A 5U7SA 2FZ9A 4QJ4B 1MEWA 9XIAA 5EFFA 1UWRA 3NPXA 1BWKA 2DORA 2IKJA 3EKZA 2Z00A 2ZE3A 1MVYA 3T2QA 1XQLA 2GDUA 3G77A 2ZZ2A 1CX9A 4BQ4A 4MZ1A 2ZZ4A 3EWWA 5AVHA 2OZ0A 3GTXA 3VOCA 1JUBA 3WJWA 2Z1VA 3UZJA 1AD1A 1YNQA 4MB5A 3NQCA 4JD4A 4O1FA 3VNIA 4LEQA 2YX0A 4G9PA 3BCDA 4M8UA 4AWSA 2ZBTA 4AEOA 4OOUA 2Y4SA 1B3WA 4WKHA 2J8TA 1JCJA 7TAAA 2ZRXA 4NNCA 4GZEA 1BAGA 3M4HA 3IAPA 1H1YA 3E0WA 4GYFA 3ZYZA 2QUUA 3QZ6A 3NXLA 3S1XA 5FAGA 1J9YA 2GUYA 1A0DA 3W7QA 3GDKA 4YYCA 3ZT5A 5HNUA 3HTWA 4NZJA 3CB8A 2VDHA 1PDZA 2I16A 4AYSA 4TVCA 2IS7A 2GUUA 3GR8A 2VGFA 4Y9OA 1HXJA 4D6JA 4ZMGA 4CN1A 3IVUA 3I7SA 4JTLA 3VIFA 3V5CA 4M6VA 2VWSA 2F8QA 1RD5A 4W88A 4ZB5A 3P6LA 1E4LA 3NGJA 3GTNA 4AEEA 1XX1A 4LVFA 3LHZA 1REQA 1QOQA 1XW8A 2W66A 1TMQA 4F0RA 3G5EA 3TYEA 1SFSA 3HJEA 3TOYA 3OQ8A 2JIWA 4LS1A 3AWNA 4KRUA 4O8RA 1J5SA 4DJFD 1W3KA 1F6YA 4H6RA 1ECQA 1C8XA 3ITYA 3WLPA 2DSUA 4LU0A 4XK2A 3NA8A 3A13A 4DLMA 4DJDC 1H63A 5EMLA 1QATA 1XH0A 3JZEA 4Y8FA 2DZSA 5FJRA 5C5YA 1OG0A 2P0IA 2YKKA 3CQKA 2OYKA 1DE5A 3CEUA 1X1NA 1K7XA 4JIIX 3DZ1A 1YPFA 3WBWA 1FKWA 2BXVA 4NXKA 4AIUA 4E8GA 5C9ZA 3AMGA 1L8NA 1FX6A 2HZGA 4LF1A 3N14A 2IXVA 3VNMA 4B92A 1HIZA 4H7VA 4J3XA 4UFJA 3WF4A 2Y5SA 3KOFA 3VNZA 4IGSA 4IIDA 1OIFA 4PUUA 4HCLA 3FNDA 1EQCA 1E51A 5EKYA 4IMEA 4KBXA 1KNWA 1JDCA 2E6AA 3BLIA 3WUEA 3E49A 4D72A 5I6SA 1G0CA 4W4QA 1HN1A 4FNUA 4QJ3B 1UWTA 2HRWA 3U5YA 4HVXA 1LRQA 3VZYA 3RMEA 1JULA 1CCWB 4M80A 4E4FA 3B03A 3QLLA 2IKGA 1JGIA 2ZUTA 2B4GA 1YBQB 4F48A 4PMZA 4YJ5A 1X97A 2PGFA 4ZE5A 4F0MA 3QY7A 3VDAA 4CU6A 4MTVA 1QK2A 3NEVA 1I60A 1BQGA 5E09A 4JL2A 3N2CA 4P7OA 4B5VA 1IWPA 1IT8A 5AHNA 4IP5A 2F84A 4CD8A 3IV3A 2DH3A 3Q45A 3VC6A 1X1ZA 1QNVA 1P0NA 4ML9A 3KBNA 4FLRA 3U2OA 4RNJA 3LQGA 2G97A 3W7KA 1CYGA 4KGJA 3T0CA 4A3QA 2VC6A 3NQBA 1LTDA 4MWAC 4J3UA 1ZSXA 1E6PA 3UP8A 3UXAA 2DW7A 3FYYA 1MQQA 3D46A 4DY1A 1SR9A 1DIDA 1AD4A 4UBPC 4M24A 3L5MA 2X1UA 2NLYA 2Z7GA 3U7BA 2CLPA 4UTTA 4Y7EA 1EJTC 3P80A 2QYGA 4F2UA 2JIEA 1KKRA 2VGBA 3MSGA 3B9EA 2P5NA 3KL5A 3W7LA 1X1OA 1UJQA 3R1ZA 4WSKA 5G2HA 3C0SA 4RXGA 4G7FA 3CV7A 2R14A 4QE4A 3VD5A 3MMTA 2W5FA 1PL9A 3MYOA 2ZA3A 3H4WA 3OP2A 3UG3A 1GOWA 3MI3A 5HMFA 3B8UA 1FWHC 3WMBA 1UOKA 3LENA 3SCOA 3MZNA 2EPNA 3VNDA 1OF8A 3OZOA 1V3LA 1FXPA 4ADUA 2Q3RA 2OLAA 4QQUA 2OG9A 4IIFA 4RE2A 1N8IA 3U4FA 3TEVA 2NXHA 5HINA 1E6NA 4DRSA 5G2IA 1HJSA 1V6UA 4IUOA 3E12A 4WK9A 1O6IA 3BLEA 1OFAA 1ZENA 5D32A 4MPKA 3KL0A 2B31A 6TIMA 2ZKMX 2EHHA 4Q7IA 3T2PA 1AH3A 2WB5A 2ONEA 3FYOA 1NU5A 2D24A 1LT8A 2FKPA 3L12A 3R79A 3MJYA 4KWUA 3CUJA 3SJNA 3C2EA 1EC7A 2GYIA 4NJHA 2GFTA 2QV5A 1UIOA 1JRCA 3OBEA 5IDZA 3PZVA 6ENLA 3L4ZA 1R0MA 1J2BA 3H22A 1GW9A 1R30A 5AHLA 1OHLA 5DFAA 5FEPA 3PC0A 4HZ7A 4QBXA 4YTRA 1KFWA 2CNCA 1P0DA 3N12A 3ES8A 4JTCA 1H5VA 2B7PA 1AVAA 3W1AA 4E2DA 3W38A 1J79A 4KGLA 3AHTA 4AEFA 3CMGA 4WDUA 3DGBA 2P53A 2IMRA 2OEKA 1QHPA 1W9VA 4HMCA 4RZ6A 5HBFA 3N29A 4KH2A 1QVBA 4LVDA 4S23A 3S1GA 1C8YA 3GXTA 3PAOA 4Z2JA 2PRMA 4US6A 1NOWA 5G1TA 3R2GA 2ZXQA 5G1MA 2OO6A 4V28A 2XG9A 1GQLA 2V5DA 3EOOA 3K4AA 3UG8A 1UR3M 5TQLA 4O17A 4HMDA 4QDWA 3D3AA 1H0IA 3LZ3A 4HNCA 1GGOA 3KRUA 4HTBA 1NELA 3AXXA 4UFMA 2NV9A 5JMUA 3S6DA 4Q4SA 2A3EA 1MMFA 2OJPA 4Z0JA 3NYDA 1V6VA 2ZWYA 1TELA 1GKRA 2OYLA 4PN2A 3ZLHA 1ZY9A 1TV5A 2BDQA 3UNDA 4C65A 2ZRVA 1QHOA 2UBPC 3DIPA 5BOOA 2ZYFA 4MYXA 3D5HA 4DXKA 2WK2A 1XFCA 4FIRA 1XYAA 3B3DA 3BAKA 3Q2DA 3V1HA 1HKJA 2AGKA 4PRTA 1E1CA 2OCZA 5L9FA 4EWJA 3NO1A 3R8RA 3GG8A 4KEVA 4LYKA 1WDPA 2J8FA 1K8ZA 3T8QA 3S5ZA 1VJZA 3CUIA 5HPOA 4Y9MA 4R7OA 1W17A 5EMYA 4L4LA 2G3FA 2VC9A 5I06A 1E43A 3IJ8A 2WLZA 2V30A 3UVIA 1Q7MA 3TTYA 3NPVA 1IR1A 1N7KA 1C92A 2Y7DA 4E38A 2HK1A 1GORA 4M6QA 3DBPA 3TC7A 4YPJA 1L6FA 3MCNA 2XU2A 1A3WA 4IJRA 1XWYA 4LW7A 4PTXA 3ZVHB 4YTSA 1EHNA 3GHUA 4RDVA 3M7SA 3R6IA 4D6EA 3PZUA 1Z42A 2D0GA 1H2JA 2TODA 3VOJA 4PRRA 4K1GA 2A7RA 4CD7A 4I5RA 4XTIA 1UMLA 2POZA 3HPXA 2PRHA 1GYMA 3AXKA 4HNLA 4OV9A 3IJDA 4ERGA 5KETA 2V63A 3VTRA 1RJQA 1WDWA 4ZR8A 2H9AB 1PYMA 4PUKA 4FHAA 1HT6A 1DP0A 4GZIA 3ARZA 1KLYA 4MWAB 4NZ5A 4HYWA 4MLJA 4R27A 2QNEA 2DP3A 2YZRA 4HNOA 3KXQA 1ONRA 2J79A 3GYCA 4N2YA 1E0XA 4MKVA 1ITCA 5CBBA 1SMAA 4C1NA 2CHRA 3CJPA 4LCQA 3MUIA 2ICSA 1Q4NX 5CSRA 1NQ6A 2O92A 1B2YA 1D9EA 2QJMA 3GO2A 1PKYA 3GXDA 4HPNA 1JZ7A 1ZCCA 3OLIA 4NUWA 4Y96A 2WAGA 4I8DA 3HQ1A 4WRHA 3W24A 5C9UA 2RJHA 3TYCA 3WF2A 2D20A 3DHDA 1ICQA 4I90A 3WY1A 3WLRA 3W1PA 3VIHA 4AD3A 3TA6A 2REQA 3OLGA 5A6MA 1DWFM 4IMAA 2R1PA 3BLFA 1WDSA 3MVIA 4D9PA 5A2CA 4ZTYA 3GNRA 1Y5VA 1YDOA 3UZXA 4MLRA 2ALDA 3MB9A 4JTRA 2X16A 1A5OC 1V7AA 1QBBA 3B8IA 2WBGA 3LHTA 3IIOA 3EB3A 2HJPA 3KL3A 4RV3A 4YTTA 3KS6A 3OJGA 3WSUA 3FGCA 5D04C 3ZMRA 2BBFA 3DGRA 2ZUMA 2PGRA 4FNTA 2W79A 3LERA 5KINA 3W73A 2ZUSA 1TQXA 1MFVA 2WJFA 1QPRA 3F03K 2EJAA 2E5DA 3IK4A 1TX2A 1CB2A 3PP7A 2JF7A 1HO1A 4DPQA 4MY8A 3W87A 3DCPA 4GWEA 4JTSA 3THDA 4B3KA 1EDQA 3ITLA 1M6JA 4J27A 5CPTA 2WW5A 3RRXA 5TIMA 3ATZA 1OABA 5DQPA 2WLYA 2FMNA 3WK2A 4XZNX 3E2QA 5A8MA 5EMJA 3GC2A 4I6VA 4DWSA 3SZ8A 1LJYA 1EH9A 3KBWA 1ZZMA 3UEQA 1TWDA 4DBWA 5AB3A 3TIMA 3C8NA 4OECA 2UY5A 3BWWA 1UUMA 1KXVA 4UQBA 3TYBA 1RQBA 3WO8A 4BS0A 3IGUA 1IEXA 3PBYA 4ONVA 3WLKX 4GK8A 3V16A 3LZ5A 2NUXA 4YTUA 1TWZA 3QZAA 1UZ1A 1OD8A 3ITTA 5AN7A 3CHVA 3UWEA 3OGRA 1WE5A 1SW7A 3D3FA 5EA9A 2YL5A 1D3GA 3SECA 2PDXA 3B8VA 5FIPA 2E40A 3GH7A 2A6NA 5M2FX 4GX9A 3ABSA 3N6QA 2GDQA 4A2RA 2G0WA 3WQ4A 2E09A 2ZQ0A 3VX1A 2BFGA 4DNMA 3NM1A 2C71A 1GYNA 2Q02A 3TYZA 4LCSA 2VD8A 5IHSA 1I4NA 2YCKX 3BAYA 4HSOA 2V5CA 3TLQA 1H4PA 1VFOA 4S1FA 3EPOA 3LMZA 1T0OA 3UGRA 1Q7QA 4E2VA 4PMDA 2GJNA 4K68A 4QNEA 4PZVA 1KFKA 2YFNA 2V5JA 3LCWA 1IEVA 1UWIA 2NXIA 3Q65A 4EX4A 1OM0A 2QCEA 2VTFA 5K4ZA 4GC4A 3H2AA 3QHOA 1RD6A 4UCFA 4MGGA 1N82A 2BLEA 3GKFA 3UZZA 1N8FA 1YLVA 3M0VA 4LAMA 3TQ0A 3E9AA 2Z4GA 4QG6A 4KCVA 1CGVA 1AA1B 2Z25A 1FWBC 3DI1A 3REQA 2SFPA 3BC9A 2FB3A 1S2UA 4I3GA 1W9DM 1GVOA 1UD5A 4UOJA 2TYSA 3WMCA 4GVGA 1NFGA 2WHKA 4ACZA 4ZXLA 4IFKA 3VIIA 2A4AA 2RDTA 3GYEA 4YLWA 2EPOA 2Z1KA 1E0TA 4B4FA 2V82A 4A3HA 3NZRA 2XZ9A 1XDLA 1TPH1 4BEQA 2CBIA 3A21A 2PE4A 3WLSA 2PWHA 3GNPA 2XGBA 3L65A 3ME3A 4GFSA 3L0GA 3SY8A 3DYPA 3BSGA 1TSIA 4ZENA 4JQ4A 1GQKA 3RX2A 3ZT7A 3GC4A 3AZTA 1LUCA 1E5JA 3WNLA 3M16A 1ZGDA 2W63A 4S3KA 1EJRC 1TV3A 4J3TA 2OB3A 5TD4A 4MADA 3TVAA 1A5AA 4NJIA 4JEJA 3IGHX 5CJ5A 2C0HA 4JKKA 1A3XA 2C3ZA 2AMXA 4MOZA 1MO0A 3DC0A 2PTDA 5LIXX 3DN5A 4JTAA 3SGZA 2PLMA 4JY8A 1W3TA 3UPWA 2YJQA 1Q8JA 1QJWA 1QPNA 1S5NA 2ZDSA 1BYCA 3OHMB 1RBOB 1OWQA 2ZC8A 3SUWA 5D33A 1E71M 4ICNA 1AMKA 1R3SA 4Y8EA 2OODA 4KQNA 5A6TC 2OVLA 3UXLA 3HFYA 3WLNA 3VYLA 1FWGC 4JIHA 4PH6A 5ABGA 3LPFA 3L4WA 1NM9A 4FNPA 5TNVA 3KZPA 4ENLA 4OZOA 2VO5A 3MMUA 4FP1A 5GPRA 4KFPA 3TTSA 4LAKA 1ONEA 3TSDA 1A5KC 1HKKA 1ZTVA 5DBTA 1S2AA 3L2IA 1HF6A 3W25A 1BTMA 1QNQA 4Z42C 2NV1A 1CGTA 1XLAA 4PUDA 4LYRA 3G22A 1C7SA 1CGWA 4V2XA 1CT5A 2DZAA 1V51A 1NDVA 3UXKA 3ANYA 1AJ2A 1QOXA 2OWCA 2RJGA 2Z2BA 3ARUA 1Q85A 1K4GA 3RU8X 1H09A 5EL1A 3P62A 3RIKA 2RDXA 1H7RA 2YXOA 4G7EA 4HA1A 1AFSA 3RK8A 4AWUA 3HG4A 9CGTA 5L6UA 1YXYA 2ZZ6A 3SRKA 2UZ9A 3BSHA 3TTOA 1UC4A 4NZ4A 2G8ZA 4HZMA 1B31A 1VLIA 1G7UA 5AHMA 1TTPA 4LXFA 2G3JA 4GE8A 1SGJA 3EKGA 1EJSC 1P1MA 1W1A1 3S2LA 2OSWA 1IZKA 2VEKA 4YHGA 3PTKA 1XLGA 2PDFA 3PJXA 3CASA 1UD6A 2GVJA 4IQDA 4F0KA 2QDHA 5DMNA 2CETA 4M19A 3VE7A 3C6CA 2BY1A 1W1TA 3LEPA 4P8WA 1W56A 4W84A 4F2BA 4LUJA 1CXEA 1HJQA 4OOZA 1P1XA 4JIRA 4MKNA 1EZ2A 1GTHA 3ORWA 4W7VA 2PF8A 2A3CA 4L64A 3P5YA 4FXJA 2WVVA 3F7JA 3DX5A 4MAVA 2H3DA 3WQDA 3W27A 4JX6A 2DVXA 2ZX9A 4GYJA 3WMSA 4F4RA 2D2OA 1LQ2A 4UTHA 4NSBA 1JDFA 2V5KA 4HYVA 5BWFA 4R9OA 5LKYA 1SJCA 3PBWA 3BPWA 3GFXA 4Y9AA 2OKOA 2A3BA 2JKAA 3P60A 3DFHA 3QC0A 1US3A 3OA5A 2OQLA 1CLXA 2QCGA 3VIPA 4FXFA 2YL6A 3HGSA 3QC3A 1TVNA 1FWDC 3H21A 5A94A 1FKXA 4DJDD 1FDYA 4L4MA 3ZLFA 3H12A 3WH8A 5DELA 2DIKA 3F4WA 1EOKA 2UV8G 3HF3A 4UIOA 4Q6XA 1A80A 7ODCA 1OYAA 1SZNA 3QV9A 1WZLA 4XG1A 5D9NA 1XLHA 2WHLA 2WM1A 2NSXA 1HJVA 2BGSA 1FHLA 3LD5A 2WWCA 5DT5A 2C15A 1RHCA 1OVDA 3W2UA 1RLDA 3HPFA 4J2MA 1YXDA 4PUEA 4UQDA 3WEOA 2G3NA 1OSEA 1VPQA 1XBZA 4F0HA 3ECQA 1UZ4A 3AS0A 3QFEA 3EWDA 3B0PA 1TIMA 4HN8A 4H7ZA 1UUQA 3MUXA 3SCVA 4UTFA 4IGNA 3G1XA 1RVKA 4IPPA 5D2WA 2VR5A 4DJEC 3APYA 2ATSA 1GJWA 4GNJA 3T40A 1O94A 3W28A 2FDSA 4WGXA 3B8TA 3VDGA 1G4EA 4OVXA 3QM3A 1E6QM 2ISVA 4C1LA 2NVAA 4DF2A 3WLMA 2HXTA 3KE0A 3IUHA 1QPKA 4O16A 4QDPA 1V0KA 1E3XA 4P7QA 3VNYA 1BF6A 2D73A 5CXPA 1LQAA 5FJIA 1FHVA 1RV8A 4H19A 1UQZA 3QQ0A 4CNOA 4JNZA 3S8HA 4C6BA 1PTAA 2QT3A 2BXYA 1X6UA 1VB9A 3L4YA 3U8GA 3G8RA 2WMIA 2XN1A 1JPMA 2NWSA 3EWUA 2WNNA 2I5QA 2YA2A 3DOPA 3WMLA 3WENA 2V68A 2BG5A 3RXZA 3POCA 5GJMA 3QY8A 3UD6A 2XDFA 3ALGA 2ANUA 4DI8A 1LP6A 3LXBA 4PFHA 4ERIA 4NQ1A 4H8UA 2GJLA 1VJSA 5BZAA 4NG3A 1W3NA 2FDMA 1TJ2A 3L4TA 1NSJA 1KTBA 3BJFA 4CD6A 2PGWA 1SZGA 3VABA 3E38A 2PWVA 2D22A 1PCKA 3LGDA 5BRQA 3B05A 5C7VA 1PX4A 2PLJA 3AUJA 3RCYA 1VENA 4KRZA 2V0TA 3C0JA 2PCEA 3BMWA 4NI3A 3CLWA 3C3NA 2V69A 1A5SA 1R85A 3T09A 4WJ8A 2YZ5A 3AMLA 1JZ2A 3G1YA 2DW6A 2IQDA 4Z0SA 1ZBCA 1RALA 3ARYA 3U0HA 2INFA 2BS9A 5I7GA 5CAKA 4YVXA 3F4VA 2D23A 1E15A 4Y9NA 2VVNA 3QBUA 3WQVA 2OYMA 3CWOX 5LNRA 3WNMA 1SYTA 4AW7A 2Z1XA 2DZVA 5G4HC 4DB7A 4QS5A 1EA9C 3CZ8A 3G1FA 3S3GA 1TCMA 4XKMA 4GQQA 3BLKA 3CPRA 1YNPA 3DFNA 1POJA 3SDOA 4IIGA 4DZAA 4LBSA 4V1XA 5REQA 3L21A 2CZDA 5F4XA 1AG1O 4UZUA 2VURA 2DDXA 5D8ZA 1TZZA 4JEQA 3AI0A 5EBUA 1M53A 2EAWA 5A69A 5D09A 2WNWA 4CQDA 3N17A 1W2PA 3RM8A 2P50A 4DXVA 4KEUA 1XCWA 5E9AA 1O5RA 1UMYA 4L80A 2ZVIA 2WC7A 4IGMA 4CCDA 3G1SA 7A3HA 4DLFA 1ADDA 5D8WA 1KQZA 3NZPA 1PV8A 5AC6A 1FA2A 1M9HA 3VO0A 5FF7A 4GQBA 3LCGA 3P93A 3G6LA 3MO4A 4ZQOA 3C0LA 3OVQA 3SUUA 2JQXA 2PMQA 2A6LA 4JHOA 3BQ6A 2PD5A 3EDKA 1TPVA 4UOQA 2R82A 5LIUX 4QXIA 2ZOXA 4HA0A 4N02A 4GGBA 2BVDA 1JCXA 4CVUA 4MJ4A 3A4AA 5GNXA 2V3GA 2AKMA 3H4XA 4J3VA 1DORA 2VI0A 3E1F1 4JQ2A 5JQ9A 3TW9A 1GVRA 4JYEA 1FWWA 3M64A 4WEVX 4JTIA 4FNQA 4ZGYA 4WDXA 3WL1A 5JXQA 3TN4A 2OZTA 1NH6A 4O50A 2G4JA 4YVVA 2PLKA 3ONBA 2WZEA 3PANA 4B3ZA 3UWQA 3B0XA 3RJXA 1OIMA 3BVJA 1MXGA 1KRAC 3P0XA 2WZHA 2NQLA 3FVDA 3OZMA 2DIJA 2V2CA 5AC5A 3IRDA 4KEMA 3KDOA 2ZUVA 4UB9A 2XSXA 1EX1A 3GW0A 3W2JA 4AF0A 1BG9A 3TTEA 1UKQA 1QW7A 1QOPA 2CZEA 4GH3A 3N6HA 3SCPA 1TV2A 1PIIA 3NQVA 2EEXA 2VZSA 1L0PA 1KC7A 3IV8A 1VFLA 1O60A 2CPUA 1KBBA 2P3EA 5KZDA 5JH1A 3FW6A 3EOEA 3ABRA 1KFLA 2V3DA 1VR6A 2DU2A 2WKLA 2VFFA 3FV9A 4IL0A 5HR7A 1NP0A 3P61A 3QVQA 1JDDA 3TR2A 2Z26A 5FJUA 1KR1A 1S2TA 1G4SA 4AIEA 3S42A 3OHIA 5B7YA 2HNEA 1GVSA 1R3RA 2FH8A 1W37A 1JUKA 4O1CA 1WZMA 3DESA 3Q37A 3MJMA 1TUXA 4YWIA 1XHGA 4P7LA 3TMLA 1JZ8A 4GBDA 3ITVA 2X7WA 3CAQA 5JUVA 3CL8A 4S38A 3NL5A 4MB4A 3I6TA 2X0YA 4WKAA 3SCRA 4U2ZA 2J6XA 2FGLA 1WKYA 4H9VA 1VYPX 2D0HA 1KWKA 3GDMA 2QDEA 2CBJA 2A3LA 4HT3A 3E0VA 4WVXA 1MFUA 5FD0A 4KF1A 2I9UA 4GVHA 4POCA 1DTUA 1V8EA 4PB4A 4L6HA 3PZ9A 1UROA 2J4GA 1UUOA 4XZLX 3HG3A 4TV6A 4GX8A 4UQAA 4PUNA 1Z48A 3EX1A 3V7PA 1ME8A 2NT1A 3ITXA 1BVNP 2POTA 3SFKA 3ABZA 1ELSA 3V18A 3S9ZA 2BNJA 2PBGA 5I3KA 4MYAA 3TXVA 4AY1A 1BQCA 3CYJA 4UFKA 1Q6CA 5C0QA 4C6CA 3PY2A 2NQ9A 3FCPA 4GI6A 1LF1A 2WM0A 4F3HA 4XD4A 4ZXOA 5DF0A 3RO6A 4XVDA 1Z89A 4D6CA 1G69A 1O95A 4JTHA 3NQ6A 4FI4A 3HM7A 3V5OA 4YS1A 2J7FA 1VHNA 1KM1A 2VQUA 1QI3A 3SADA 2VCCA 4ORMA 2I5IA 1W0MA 4K38A 1XRSA 5T8GA 1OX6A 2GSJA 5DEZA 2YPIA 1SO4A 4QG9A 3VM7A 1T96A 4S3JA 3H55A 3T81A 3EWXA 3FA4A 1R8LA 2YL9A 4H6EA 3AZSA 3GIPA 4C6JA 3GVGA 1YYAA 1CXKA 2Y61A 2XGIA 2C19A 3H6OA 3OG2A 4ES4A 5DCDA 3AYSA 4IZGA 3L0NA 4O1BA 4KMQA 2XVPA 1J8VA 2P0OA 1DHPA 2OQHA 1KCKA 1WBJA 2PDCA 3WNKA 4A8RA 4B5TA 3TC3A 3N04A 4D6DA 1C91A 3I7QA 1YNYA 2GDVA 4NAEA 4NT0A 4C7GA 4UTUA 4N42A 3WH9A 3L5AA 2YB4A 4NIRA 4JFSA 3ITOA 1Q6DA 4E2OA 3A4XA 1LWHA 3ZOAA 3OYZA 4UTLA 4HTYA 1E3ZA 4H6QA 4M0XA 3CK5A 3O9NA 1OCQA 4KS0A 5A8GA 4O0ZA 4AY8A 4JTJA 1R7OA 4O14A 3A3WA 4DPPA 3KOXA 2DVTA 1EO5A 2QAFA 5HK4A 2C14A 3BOFA 1UD2A 3BW3A 4U33A 3ARTA 4CEXC 4C7FA 2WQPA 3N15A 4O1AA 5CBJA 1LYXA 8CGTA 1XGZA 3B97A 3N25A 2VFHA 4OV4A 3BV4A 1OFOA 3NIYA 1GJUA 2VRJA 4S2BA 4WDWA 1PEZA 1E40A 5CLWA 1B3OA 1R2SA 1XXXA 4W5UA 1OGBA 1KD0A 1P6BA 1EXBA 1HX0A 4US5A 4AIBA 1MQRA 3B40A 4IF2A 3Q67A 4MJ2A 4CKQA 1T40A 1EP3A 1MSSA 2OZ8A 1LG1A 1BVZA 2VELA 4UR7A 4F40A 3UCDA 3RHGA 3AMDA 2J7DA 3DU0A 5D02A 2R6OA 4ZO7A 1GJPA 3GWQA 2ACRA 2QGHA 2QVHA 4IFOA 2I57A 4RE4A 1M65A 1XICA 3N34A 5DX7A 1H62A 2GPTA 2ZX6A 3PNUA 1DBTA 1NIUA 2VDIA 1KBIA 5DLCA 4PE8A 5LA2A 4JFUA 1EBGA 2WSKA 1F7BA 2FMOA 1E1CB 5DXXA 4I9AA 1MQPA 3QOKA 1PB0A 5TAOA 1V6WA 2QCLA 3FVMA 2ON3A 1K9FA 1PBGA 5D2XA 1LRTA 4KIRA 3TZNA 4OBRA 1ME9A 4LUTA 3EWCA 4YIWA 3SIMA 4MMWA 1GNXA 4BF5A 1VBUA 1DVJA 2XVLA 4IT1A 3E0FA 1TJ0A 2QR6A 1Q65A 3PM6A 1R9YA 4W8AA 2C13A 1CDGA 4QAIA 4KETA 2ESCA 2ZX8A 3V75A 1JFHA 4O4VA 2XFYA 4UMBA 1OY0A 2E68A 4JQ1A 3II1A 1KM3A 3G1HA 5I02A 2QLYA 3POHA 4F9DA 2J7BA 2QCFA 5LSMA 5K9DA 1XYZA 1ZAHA 5PTDA 3WF3A 3SRHA 3KS5A 2GQAA 3F1QA 2RUSA 2Y88A 3KOWA 1OC7A 4ZTXA 3W81A 1JD9A 4FB7A 1CWYA 3TSBA 1H3GA 3LSBA 3A9IA 3AS1A 3WJYA 1F73A 4DJFA 5D2YA 4ALDA 1VEOA 3QH2A 2YA0A 5RUBA 1CEOA 4RZ4A 2QV4A 1MWOA 4INFA 2PTWA 3GVWA 1H51A 3L2MA 3CHEA 2NVDA 2HVOA 3CHCA 2A21A 4NVTA 1WKDA 1QR7A 7ENLA 4UTMA 4TO8A 2DSVA 2ZDRA 4HK5A 3A9BA 3L9CA 3E2RA 1EKOA 4WSHA 1G4PA 1ISYA 3WDHA 3A47A 2BHYA 2OX1A 3MC5A 4L7ZA 4FALA 1XRFA 1ZU8A 4E3TA 2Z6IA 1UOZA 2REQB 3AIWA 5FA5A 4FOJA 3T2OA 3URQA 1VRXA 3CS2A 4RLIA 1UW9A 5CZJA 3FIGA 1BYDA 4Z2IA 2Z0IA 2CHOA 4Y9PA 3M9YA 1RAKA 4TOQA 2NV2A 2Q6ZA 3BJSA 4S3AA 3FHQA 2VZUA 3GKAA 1US0A 3M43A 3TQKA 3AXMA 3VMNA 2ZUWA 1RQHA 4E5TA 3AQUA 1DJIA 5CC7A 3FGCB 4XQ6A 1TE1A 2AQVA 2YA1A 2EJ1A 4B5SA 4Q8WA 1EX5A 3VD4A 1E0WA 1O66A 3SGGA 2QJGA 3H23A 4HK7A 4S2CA 2E6YA 1XG3A 3IEBA 3U7VA 2QXWA 3SRFA 1IIGA 2WSYA 4O19A 3OLEA 1AMYA 4AFYA 1XQKA 3TCSA 5LZLA 1K9DA 2CBVA 2YCLA 3GR7A 5EFDA 3M44A 3VI2A 2WPGA 5TBOA 3AHVA 3U9IA 1VBJA 2R1KA 2EG8A 3ANUA 3W1TA 3GTIA 1UWUA 4DWSB 4Z1BA 1GW1A 4R9XA 1V0NA 4GFIA 4AISA 3KVMA 3DYMA 5D4YA 2PWGA 3FJ4A 7REQB 3H8AA 4U10A 4DF1A 4LTSA 1FP8A 2YR1A 3MP4A 2KZHA 1WOBA 4AU0A 3BJTA 5AKQA 2DFAA 3MUCA 1LLZA 5HQLA 1TPUA 1RCXB 4IFRA 3GSMA 3SW6A 3UA4A 2CCRA 4GJJA 1XCFA 1LWIA 4MWAE 3GU2A 2XH4A 1PSCA 3TQVA 3TV8A 2A0NA 4DX3A 1JVNA 2E1WA 2HNHA 3TJIA 2YCIX 3W7NA 2W9MA 3CAKA 5BXSA 1HUVA 4RNFA 1VFTA 3W88A 3VVGA 4XKYA 3W85A 2GJPA 1L6SA 3IVSA 4WY0A 5I3FA 4IJBA 2VMFA 5BOEA 1X6LA 1P6WA 2I17A 3WJXA 3VILA 3ZSSA 5K4XA 1QI2A 1K9EA 5T91A 2J77A 5AHFA 3EB4A 2IKIA 5I3JA 3LGGA 3R0DA 3RDKA 4JTTA 1AW5A 1TE6A 1JXJA 3CU2A 3AJXA 4IL2A 2CLFA 3ITCA 2PDKA 4A4AA 4LRTA 5I03A 3H2OA 2YLAA 1JZ6A 1VBGA 2XIBA 1RBLA 1Z44A 1T7LA 3N4AA 4XD5A 1ML1A 1SQ7A 3UPBA 3WN6A 3HB9A 5EMKA 3VK5A 4HPXA 5I79A 1H61A 2BX7A 4GUFA 5MKGA 4IG2A 4MVAA 4I5XA 4AQLA 4RZBA 1NFPA 3S47A 1X98A 3PN8A 4Y90A 1LG2A 4GISA 4L9ZA 3KZSA 4JTDA 3REQB 4J28A 4NJGA 4DIAA 2GJRA 2ZADA 4XUYA 1SO6A 2CU0A 1QI5A 4OIFA 4C6EA 1HJXA 1HL2A 4HU0A 4Q7NA 4LV9A 4PMJA 3P8IA 4ACZB 2VEIA 4DJED 4IFKB 3GC5A 2HMCA 4AD5A 3S0CA 4WJXA 1QFEA 4HK6A 4YCPA 2FLIA 1TJRA 3CLMA 3UJEA 1QPOA 1QW8A 4KIEA 4BZYA 2YCEA 1DEDA 1Z69A 3ZJ6A 4Q4OA 2W4XA 5U4NA 3W72A 2D3NA 1YTKA 5HR6A 2FTWA 2ABBA 3GDBA 1XIHA 1BLIA 2YDSA 3GLCA 1GKPA 1VLWA 4LB3A 4QIUA 3S46A 3W0KA 4M3PA 2VC7A 3ZQ9A 1F2JA 3FJNA 3O06A 1RH9A 2QQ6A 1D7KA 4E0CA 1MRAA 3EAUA 3P81A 2NW0A 1M7JA 3UR2A 4OTKA 2J7GA 4EKJA 3UT0A 1W9UA 2HVMA 3M1ZA 4FZIA 4AIOA 4C6NA 3OIXA 3AZRA 4ZEPA 2F6UA 1X96A 3RF9A 4GXPA 3TQPA 4Q8NA 1MNSA 3P8JA 3E96A 1GHRA 4XSMA 1JDAA 2GK1A 1BSIA 5CAHA 6A3HA 2CLLA 2DT0A 1NVMA 3W7IA 4NXSA 1PTGA 2VFEA 4KKXA 3K4DA 3TXZA 1E6ZA 2G95A 3IWPA 3C2YA 3GAKA 3O63A 2FGBA 4I7WA 3VE9A 5IXEA 4UTJA 2Q8ZA 2E0PA 3URNA 2FH6A 1XIEA 3ZFHA 3XINA 1JYNA 4DNHA 4CD4A 3MKCA 3FLUA 1MI3A 3QMTA 2OMAA 4U3AA 1U2YA 3NQ8A 4KFNA 3LLFA 4QTGA 5DY2A 4AHQA 1FWTA 1QI4A 4DYKA 5H1WA 3WK1A 2F9RA 3OODA 2AGTA 4GCAA 3I7RA 2VHLA 4H9ZA 3UR8A 1E4MM 1IXQA 4P61A 4UUIA 3N11A 4AZHA 5LGXA 4M7TA 1XLCA 1TPFA 4K36A 2QGYA 2G3MA 4ZQPA 1C93A 1EGVA 4O1EA 2MANA 3PSWA 4QE5A 3O05A 3CBWA 3TJ4A 3SEPA 3NDZA 4GMEA 3Q4DA 1I6NA 1RXOB 1SZFA 3VKAA 3VU2A 5LNWA 8XIAA 4WSJA 5LA0A 2CFFA 5FSEC 3B8SA 3LPPA 1U5VA 3N2BA 3ZR6A 3ARRA 1DV7A 4L9XA 1KFCA 2QAPA 3LHUA 3WD1A 3S2CA 3MDWA 5E6ZA 3QYQA 2P10A 4G5DA 4EPBC 3SJ3A 2NQJA 1NP2A 1OFRA 3B9DA 1KWGA 2J27A 2YYTA 2ZRWA 4MY9A 2EBNA 2V3EA 4XAZA 2ZRYA 1PZ2A 3O2LA 5A6AA 3BARA 2JF6A 1EIBA 1NFBA 3JW7A 4CNSA 3DFOA 3E2VA 2XUCA 3NPUA 2KX9A 3PUGA 5CCZA 3MP5A 3EWZA 5HJYA 1GVYA 1W3JA 1W5NA 2YLLA 1IGSA 2Y1HA 1LDCA 3LUTA 4GI9A 5AYZA 4LV4A 2P1FA 1ZBVA 2RGLA 3P7YA 5BU6A 2EF9A 3D47A 2XH0A 4QEHA 2XINA 4L5ZA 1G1YA 1LL6A 4Z1AA 3VKDA 1GG1A 4UWMA 1XBVA 4LYQA 1MRQA 4AD0A 1TO3A 1F4AA 4IWWA 4N6FA 3FJ6A 1M04A 2V3FA 2HTMA 3PTMA 2FJUB 3M0JA 3TTQA 3LU2A 3NEHA 5ABFA 3T8LA 2VWTA 2W67A 3HV8A 4DUOA 4AZCA 2E1DA 3CIXA 2HSAA 4ZOEA 3IIZA 1MZRA 3NQ7A 4AZIA 1BVWA 3BTNA 7TIMA 2R1MA 1Z41A 4XZWA 3ENLA 3URBA 3EDEA 2V5LA 1JG9A 4JGDA 1C9WA 1P0BA 4RPQA 8A3HA 5BCAA 2J62A 2VC5A 4FO4A 2GVGA 1VFUA 1YKWA 5M1TA 2HE5A 3B9OA 1V0MA 3R94A 1SO5A 5GNZA 1JNDA 1C9DA 4F2TA 3BAWA 2Q3OA 1NY1A 1TCDA 2Y89A 5CC5A 2O55A 3WCZA 1TTQA 4QE1A 1E6RA 3HGRA 2PDMA 2BMBA 2ZZ5A 4J3WA 1TZ9A 3M0LA 2YCJA 2W62A 3PNZA 3PUEA 1Z8AA 1DWAM 3GX9A 2AL2B 4H8HA 4AX6A 1V02E 3WL0A 4BWLA 1TV8A 1DIEA 3NGFA 1A0EA 4K7YA 2OWXA 2A5HA 3NJ3A 3GXPA 3L23A 1DXIA 3NO5A 3G1DA 4DZIA 1C8VA 4HNNA 4CCEA 4CN6A 3K8MA 3CEPA 4ZFCA 3G2GA 3VDCA 4JN7A 1DJXA 3S9IA 4RKAA 2P8BA 2A7NA 4GQ0A 1WAUA 2WMKA 1GOOA 3VIKA 2WMIB 2J74A 3VIOA 1RK5A 1IXPA 1R47A 1RZMA 1XC4A 2FPVA 2Y7FA 4XX6A 1JFXA 2VR4A 1YDNA 1BRLA 3BGGA 4WXYA 3SCSA 3AIRA 1UPPA 1TMLA 1K4HA 1FUYA 1OT2A 4PCNA 5TF0A 3VNKA 4XZBA 1F9CA 4FMVA 1MZHA 1E70M 3WJSA 1T5AA 1PCWA 1BKHA 4O54A 4HSNA 2ZFAA 1AL7A 2Y7GA 1H49A 3VOFA 3A4JA 2E7FA 3IAQA 3S2MA 3GHRA 1SZRA 2JKEA 2FVLA 4OU1A 5KZEA 1BKSA 4YWSA 4GHRA 2DPEA 2JALA 3QRHA 3STEA 1UH2A 4X0VA 2AMGA 3QW4B 3TX9A 3FAWA 5I78A 4HJWA 2GLKA 1KQYA 4TVDA 3SQMA 2TRSA 3DH7A 1POKA 3PBUA 1OK4A 3OGSA 3CZEA 3CV2A 3UNTA 4RK8A 3MUY1 3R0UA 4O15A 1TYGA 4UR9A 1F6KA 1EYWA 1J5TA 5E93A 1CXLA 2ODOA 1M5WA 2CBUA 5CGQA 1G9HA 3DKLA 3L66A 4NILA 1ADSA 3CH9A 3L67A 1WPCA 2QJJA 3PZTA 1GEQA 5C9WA 4MG4A 3MV11 4OFCA 4RW5A 1GOXA 3G3MA 4UMCA 4PB3A 1EGMA 3R7MA 5I5RA 1DHKA 5D37A 2VRQA 5CGMA 3MUAA 2ZC1A 3WQPA 4ZB0A 5LHEA 2VRKA 4C6IA 3CXOA 1HKWA 3R0KA 1KLZA 3VXGA 3NG3A 4IMFA 4LS2A 3ZM8A 3B4YA 4CUCA 4KW2A 5CSSA 2O7SA 4ZBCA 3FX4A 4E4UA 3HMJG 3HJZA 2ZA1A 4B5NA 3D0CA 4US5D 1HJWA 1OX5A 1HJUA 5LGZA 3N6JA 3W2LA 3R8HA 5A8OA 4UNIA 4K7VA 2GVEA 4MIMA 4A8IA 2E9LA 1XP3A 1WXYA 2DJXA 3DG6A 1VHCA 1CLVA 4UTKA 5C9RA 2ZA2A 1XPGA 3A12A 4LVGA 3UZ5A 1JGMA 3GFZA 4XZMX 3LDVA 3UG4A 1ISVA 5G5IA 3H2CA 3E6EA 3W1XA 1ZS2A 5A3HA 2PDWA 3THCA 2VX5A 5E5CA 3HPZA 3B0YA 3ZJ8A 4Y6GA 3AHXA 2WCSA 4TXEA 3YPIA 4TIMA 3HURA 1S5MA 3IJ9A 3I3BA 5JVLA 5HMDA 2PGEA 1TJPA 4GZ7A 4Q6JA 4PUMA 5IOBA 1QWKA 5F4WA 2W0UA 1PHQA 4FOKA 1YXCA 3CT7A 2HV5A 3SQLA 4REQA 5JBFA 1RCOB 5C2XA 4FSAA 1C3FA 4XV0A 3NO3A 3EWYA 1Q13A 1OFBA 2QPUA 4MM1A 4PR4A 3ABOA 3V36A 3LCHA 1R2TA 2DZTA 1CB7B 1UBSA 1GOQA 5ABHA 4Q8UA 2ZXAA 2UY4A 4HN4A 1Q63A 4QRNA 2B7OA 2PZNA 2DSWA 4GD0A 2RDWA 4DO4A 5CKSA 2P8CA 2YXGA 1B0IA 1OX4B 3SUTA 4Q8PA 3EBVA 3TC6A 1U22A 1M7PA 3CQHA 3N13A 4H9UA 1E0VA 1W1IE 2F6KA 3BOLA 5DY3A 2NUYA 3RLUA 1MEIA 1QHZA 1BSLA 2X05A 2OT1A 3TZFA 1VBRA 2GL5A 3GXMA 5A95A 4ZQNA 1TRIA 1I8JA