4OVXA

Crystal structure of xylose isomerase domain protein from planctomyces limnophilus dsm 3776
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
270
structure length
270
Chain Sequence
SPFEISLAQWSLHKAFFDKKADPMDFAKIAKEEFGINAIEYVNQFYKGKAEDQAFLADLKKRADDHGVKSLLIMCDGEGALGDADEAKRKKAVENHYKWVAAAKYLGCHSIRVNAQSGGSYDEQLARAADGLRRLTEFAATHDINVIVENHGGLSSNGAWLAAVMKKVDHPRCGTLPDFGNFRVSKDEMYDRYKGVEELMPFAKAVSAKSHDFDAAGNEIHTDYRKMMKIVASFGYKGYVGIEYEGSKISEADGIKATKKLLETVRSEMA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Xylose isomerase domain protein from Planctomyces limnophilus DSM 3776
rcsb
source organism Planctomyces limnophilus
molecule tags Isomerase
molecule keywords Xylose isomerase domain protein TIM barrel
total genus 101
structure length 270
sequence length 270
ec nomenclature
pdb deposition date 2014-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01261 AP_endonuc_2 Xylose isomerase-like TIM barrel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 4ovxA00
1TZ9A 3AAMA 5I7GA 4XSLA 4E3VA 2G4JA 2I56A 3VNLA 3DBNA 4K3ZA 4QE4A 4Q7IA 4ZB0A 1DXIA 3BZGA 5B80A 2XIMA 1A0DA 9XIAA 3P14A 3KBWA 4ZB5A 1XLAA 3VNKA 4YTSA 4YTUA 4GQBA 1S5MA 3UXIA 5B7YA 2GVEA 5FA5A 1XLMA 3OBEA 1XLCA 3XIMA 2NQHA 1MUWA 1XP3A 3LMZA 4HHMA 4HNOA 1XLHA 2ZVRA 3VNMA 1YX1A 2OU4A 4A8NA 1QTWA 4HHLA 4A8IA 5TNVA 3VYLA 1XLIA 3WQOA 5XIAA 1BXBA 8XIMA 1MNZA 2GLKA 5J8LA 1O1HA 4YTRA 5H1WA 3KBSA 4YTQA 1A0CA 4W4QA 4EACA 3KBJA 4OVXA 6XIMA 3M0HA 5EMKA 4EAYA 3FVMA 4ZB2A 5H6HA 1QT1A 5AVHA 1CLKA 4PFHA 1D8WA 3IUDA 5XIMA 3C0QA 3KCLA 4K1GA 3M0LA 3UU0A 1XISA 3CQIA 1XLDA 4XIMA 1XLBA 1GW9A 5C9ZA 2GYIA 1XLEA 3CQKA 1XIJA 1XYCA 3CWHA 3M0XA 3BANA 3CQJA 1DIDA 3M0MA 4QE5A 1XINA 3M0VA 2I57A 1I6NA 1XICA 2HK1A 1XYBA 3KBMA 4DUOA 3N4AA 3VNIA 1QUMA 3UA3A 3U0HA 1XIBA 9XIMA 2QUNA 3QC0A 3AYTA 4QEEA 1XIHA 3P6LA 3UA4A 2J6VA 1BXCA 1DE5A 3CNYA 3UVAA 4GJIA 3BDKA 3M0YA 8XIAA 3U3HA 4GLEA 1S5NA 3ITVA 4XISA 4X63A 5EMMA 3QYSA 4US6A 1XIIA 2XISA 3GNXA 1XIDA 4XIAA 1I60A 3KCOA 3TVAA 1XIFA 1XYAA 1XLFA 3ITTA 1XIEA 3L23A 3VNJA 3XINA 1XIMA 3ITOA 1DE6A 4QE1A 5B7ZA 3ITLA 3XISA 1K77A 3C0SA 6XIAA 1XLJA 3BZJA 4XSMA 4G56A 2QW5A 3NGFA 2X7WA 2Q02A 2G0WA 3AYVA 4A8LA 3KBNA 1XIGA 3KCJA 3IUIA 3KTCA 4PGLA 1XYMA 3ITXA 5EMJA 2HCVA 4LNCA 1XYLA 4GJJA 2GUBA 4ZBCA 3ITYA 4HGXA 4QDWA 1A0EA 1OADA 4A8RA 4QEHA 4KW2A 3DX5A 1DIEA 3QZAA 2ZDSA 2QULA 4YTTA 2QUMA 4QDPA 1XLKA 1XLLA 3C0LA 4X60A 3QXBA 5AVNA 7XIMA 3AALA 2X7VA 3CQHA 5EMLA 2NQ9A 1XLGA 3JU2A 5XINA 2HK0A 3IUHA 3KBVA 4X61A 4J4KA 2XINA 4XKMA 3BWWA 4DVOA 3TC3A 3KWSA 2NQJA
chains in the Genus database with same CATH superfamily
4MGGA 1ONXA 1FQ0A 1IE7C 2Y5JA 3DFQA 4JKLA 5F2IA 3W22A 3KL5A 3MPGA 2VX5A 2C18A 4HMNA 3SQLA 3BLPX 4CQDA 5L9FA 4TX8A 1OY0A 8XIMA 2PC8A 1O1HA 5CPQA 2QVNA 1V3LA 4QLKA 2GK1A 3VE7A 1POKA 3UGVA 4DNMA 1ZCCA 3RX2A 3LCWA 3EX4A 4UCGA 2WNQA 3S9IA 1NOWA 1GCYA 3CHDA 3OZYA 3WZ0E 1U30A 1MVYA 2FKPA 1N2VA 2GSHA 4DEFA 3AROA 3WJSA 1CGWA 3PTKA 4PUJA 4LBUA 3RR1A 1H3GA 5H8PA 1VRDA 5GPRA 4JQ1A 3O15A 4LB4A 1KBLA 3BZJA 4AHQA 4EIVA 3C8FA 1OD0A 2DVXA 3TJXA 2PGEA 1JVNA 2ZA1A 3K1GA 2FZDA 3LBOA 1GOQA 4AVFA 1B3XA 3ZVHB 4J28A 3UR2A 1MFUA 2X40A 4Q32A 3ZT5A 1T8XA 1TVLA 4D6DA 1Q7MA 3C2EA 4WKFA 4PTXA 4B3ZA 5EA9A 4MWAC 3WH6A 5DY2A 5A6BD 6REQA 3WNOA 3R0DA 2B4GA 4ZQMA 4RZ6A 6REQB 2OGYA 5G1MA 4JPGA 1E1FA 4LH8A 3RCNA 4LV4A 3KRZA 1XLAA 5F7UA 3UF9A 5CC3A 3UXIA 5B7YA 1OC5A 3UERA 3G0UA 3NZRA 3K5XA 3W6MA 1DIKA 1TSIA 4M7TA 3TSMA 3T1GA 1LM1A 4PBEA 1M68A 1A0CA 1K4GA 4MWAE 3W1QA 3GUWA 4DBEA 2ZCGA 4KCTA 3RHGA 1YTKA 3URAA 2WSKA 3W26A 5HK4A 3PULA 3M0MA 2GZXA 4OGZA 4FNRA 4LANA 2ACUA 1U22A 1PTDA 3BV4A 3ORWA 3VOGA 1UASA 1RBOB 3W2KA 1RSCA 2WMIA 2XWDA 1TA3B 1TUFA 1RVGA 3MYOA 1HJXA 1KM5A 3V35A 1XIEA 1H7NA 1IWPA 2A6LA 1S5VA 3WJYA 4E0CA 2WCAA 1JCNA 4X3ZA 2CLHA 2VVNA 3ID7A 3W7QA 4W93A 5A6SA 3MHUA 1QMLA 1U83A 3GH5A 1XD0A 4F0MA 3G8RA 3W02A 4JHOA 3NEVA 3VGFA 1UOKA 2PRLA 1FFRA 3HF3A 1PL9A 3BAXA 4N9BA 4QLJA 3PZTA 1KM4A 4OQVA 2VR2A 3EKGA 1EF2A 4JTLA 4LUTA 5K9CA 4IMAA 2PRMA 4UMCA 1DKWA 5IOBA 1PO9A 3P3BA 1G4PA 2QGHA 3E3HA 4XK2A 1CB2A 1M7OA 4YPJA 3W88A 3ENLA 1MUWA 4GVHA 5REQA 2A3EA 2X16A 5C5YA 3TQVA 3MB9A 4H00A 2WQPA 4PMRA 6XIMA 3NSNA 3VIIA 1XPYA 2PCQA 1UPPA 2Z7GA 4NAFB 4C5ZA 1A80A 4DLFA 4FX6M 2RAGA 3SCTA 4Z2IA 3WSUA 5A69A 5BU6A 4ZTYA 2V38A 2PWGA 2CW6A 4LRSA 1S5NA 1H09A 1NARA 3UNDA 3MU7A 1CWYA 1V7AA 2FJUB 4XD5A 1UBSA 4QSHA 4D8AA 3ONCA 3XINA 3O05A 2Z1XA 1KTNA 1R9ZA 5K4XA 1ZJHA 2ONEA 4H9YA 3PWIA 4AWTA 5J04A 2QXWA 1YADA 5JXQA 2P1FA 1RLDA 4OE7A 1XG4A 4DJFA 2XIBA 4YTTA 2PBGA 1CIUA 4GI9A 4MLRA 1XLKA 1FWRA 3PS7A 2PDPA 3M7WA 2VR4A 1CBGA 3N2TA 2VGIA 2XFFA 1FRBA 5KZDA 1TCMA 1VENA 4F4RA 3BW3A 1U2YA 2G41A 1UWAA 2HQAA 1ICPA 3QV7A 1UWTA 5CJNA 4IFOA 5D9PA 3G6MA 3LCXA 3QTGA 4ATDA 1ZRQA 2WYSA 3DESA 1PHWA 5CXPA 4B15A 5D09A 1ISZA 2EAWA 2Z00A 2EJAA 2IKJA 1FTXA 1VBRA 1MNZA 1PDYA 5IM51 3LLDA 4G5DA 3FVMA 3W1TA 2CU0A 2QJHA 2JBMA 4XKYA 3MBDA 1C91A 1VYSX 1J0ZA 4Y9MA 3IJDA 4DWSA 3LXAA 2HVMA 4LEFA 4GYFA 3T6CA 1TQXA 1K9FA 1KFWA 5JQ9A 1K02A 4L9ZA 3G18A 4LALA 4UTUA 4MVAA 1OSEA 2NX3A 3WO8A 3GR4A 5I3JA 4YVVA 1TPFA 4WDUA 3WENA 3VOJA 1KM0A 4FZIA 4JICA 4XO6A 4TVCA 2YBVA 1N55A 1OGSA 3UWQA 1BHGA 1O4UA 4RZ5A 3IJLA 2WMIB 3B8TA 3W72A 3WK3A 4LCQA 1FWBC 2OZTA 7REQA 3GWQA 1UW9A 4ZOAA 1GOOA 2VUYA 1J01A 4RCXA 2XDFA 3ONBA 4EOUA 4DO4A 4AY1A 2C0HA 1V6XA 3WK2A 3O1NA 2WZMA 1R8LA 2XH7A 3KLLA 4EWND 3KBWA 2FPYA 4OWGA 1H7OA 4JTUA 1DVJA 1L0PA 1QNOA 1MO0A 3O3RA 4OTKA 4H3DA 1UJQA 6PTDA 1DWJM 1VBHA 3KBJA 1XBVA 5C7HA 3N18A 1WZLA 3AHTA 4Y8EA 3M0LA 1TUXA 3VU2A 1M3UA 2Z7KA 2VEIA 3PSWA 2YXOA 3FJ4A 4M6UA 2GL5A 3PZQA 1YE6A 2W91A 3OG3A 2G96A 3WLSA 3RM4A 4EE9A 2J8GA 1YPIA 1Z41A 1NF7A 4IF2A 3ZXWA 4F66A 1KRBC 1LZOA 3QQWA 4ZGYA 2BODX 1SW0A 1Y5WA 1TQJA 3GAKA 3B3DA 3RPTA 2J9YA 3DFNA 3NPXA 5CBJA 2D2GA 2ZIDA 3L5LA 4JKMA 1RQBA 3U57A 4IG2A 3U4AA 3AIBA 3BICA 4OFCA 3PBGA 1X39A 4IQLA 2J47A 1XRTA 3V1PA 1YYAA 4F0HA 4OT7A 1EJRC 1WOAA 1J0YA 4B2DA 4H8HA 3H6OA 3HPFA 1M41A 4D2JA 2V5JA 3ERPA 4JTRA 3VNLA 1EYWA 5AHNA 1CEOA 4WEVX 2OLSA 4Q6JA 3GNPA 1CPUA 3MJYA 2J25A 4U2ZA 3HG4A 3IGHX 1EA9C 2ZWZA 3WLHA 2FQIA 2O9OA 4UTJA 3W0KA 3UD6A 1PX8A 1VIZA 2CZDA 4O14A 3VMOA 1J6OA 4EX4A 5T9CE 3WLOA 3RK8A 3GR7A 1S2UA 4BJHA 2QCGA 2YYUA 3ZYZA 1P0NA 3PBVA 5FEXA 5EU9A 3B9DA 4UMAA 3BLKA 4FLOA 1GVSA 2DFAA 1FWWA 5I3DA 1EXBA 2EPLX 3R12A 1DEDA 5BCAA 3E5BA 3EXSA 3BK0A 1UH4A 3I10A 5D9MA 2VT0A 4UTFA 2DZWA 1MW2A 1Q4WA 1KGWA 3W7KA 1XH0A 2E09A 2Q8XA 5I77A 4NZJA 2CLIA 4EPKA 3GU9A 3DFOA 2I16A 4ZENA 1JL8A 4RNJA 4FOKA 5LIKX 2IPFA 4WIWA 3B9NA 3D5HA 3C0JA 3WBWA 3T09A 4TR9A 5MHBA 4M81A 3VOIA 2Y4SA 3EKZA 4KH2A 3C6CA 4QITA 1JQXA 2DW6A 2HTMA 1ITCA 2BB0A 4O10A 1EJ7L 2QVHA 4HPGA 1BVNP 4CQCA 4XWUA 1OVDA 4CD5A 2VURA 4S1FA 2ISDA 3W07A 2CC0A 1THFD 5A8OA 1TJ0A 4RXFA 1DWGM 2I7GA 3IIOA 5KITA 1EUAA 5I79A 3P80A 4AZCB 4KBXA 1GOKA 2E6DA 3TROA 3QQ1A 3O8AA 3Q2DA 4MYAA 2XIIA 3S2CA 3ZT6A 4RX0A 2ZZ3A 4C5YA 3V4BA 4EF8A 1V3KA 2H6RA 4LQ1A 3LLFA 1R7OA 3AHVA 3LZ3A 4IMCA 1HZYA 3MMWA 2WXDM 4UNIA 5G1YA 2HSAA 1KM3A 1T40A 4UTKA 1UP0A 5M2FX 1LOSA 3FV9A 4AG0A 4XZBA 4AX6A 1XYAA 1XRVA 2R94A 4OOZA 1P43A 3UXDA 1H7WA 1KD0A 4WRHA 3WQDA 4O0ZA 5FAGA 2VEFA 1QASA 3QLDA 4ORIA 3PUOA 1NY1A 4W8LA 3UVIA 3WLQA 1O95A 3PBMA 1X7FA 2G3FA 1MYRA 3SGGA 4O15A 3EZ4A 3QOKA 4GHRA 4UC5A 3GDMA 2J7GA 4KEZA 4FXRA 3W7PA 3DYPA 1W2VA 3FA4A 1E0UA 1EBHA 4AMCA 2ZUUA 2ZUVA 1JPHA 3ANVA 5HQEA 1VD6A 3KWSA 2NQJA 4RDZA 1BRLA 3PPFA 2CESA 1JUBA 3LV6A 1EHAA 1EC7A 4XBJA 3R1ZA 1RA0A 4UQCA 1YXDA 3QW3A 1QJWA 1PXGA 1T99A 2P88A 4RE0A 3S8HA 1UROA 2YFNA 2KZHA 3GKFA 3UBPC 3NPUA 1AG1O 3CQIA 2FVLA 4C7FA 5AZ1A 4E5TA 3GDLA 1FWIC 4B5TA 4Q8OA 4U3CA 3U3HA 3NQEA 4D71A 4BI7A 4JIIX 5EMMA 3GZ3A 3L0GA 3NQVA 2PE4A 2BOEX 1CGTA 1W5NA 1W56A 4TV6A 1ZBCA 1TWZA 1IEQA 4AY7A 4RR4A 5KSWA 1AMKA 3HG2A 3EEZA 3P5YA 1B3WA 1I45A 3MP4A 3CUGA 4ZCWA 1JCJA 2YCLB 3W37A 2AKZA 1FWCC 4HYWA 4AIOA 4AC1X 1BAGA 5I3KA 1EGZA 4JR5A 4FEZA 4X61A 3PANA 1ICQA 2BS9A 2FHFA 2VC5A 5BU9A 3AAMA 2WMGA 1RK5A 5I3IA 1E4LA 4KRUA 1A50A 1TTPA 2RUSA 3II1A 4XKYB 3K46A 5BXTA 4BFAA 2XPKA 4B5UA 2P0OA 5AYBA 4PBGA 1ODUA 3FW6A 3N1AA 4JNZA 1SJCA 4LVGA 4EACA 3MVIA 4MNMA 5EMKA 1NFBA 3L4TA 1RAKA 3COTA 2OZ0A 2YLAA 4D9PA 1FDZA 3EWCA 1GUVA 2ZE0A 5ABFA 1QOQA 2AMXA 2WMHA 3UWUA 4C6BA 4UQBA 4CN6A 4NRSA 4X22A 1EX5A 2ATMA 2DZAA 3FA5A 2E4TA 1VCFA 1VKFA 4JFSA 3F2CA 3BAWA 3KL3A 2VUNA 1OCQA 2Y85A 2ZUSA 1WQ5A 1OFBA 1OX4B 1R2SA 2AL2B 3RXZA 3ZJKA 3WF3A 1X6NA 1P0KA 3VOCA 1GG0A 2GPTA 1F3XA 3S2LA 5I23A 3HGSA 3CV6A 5LXEA 4LUJA 3SSJA 1V8EA 3R2GA 1JCLA 1E3XA 5A8GA 5FJOA 1QCWA 3DFHA 1TG7A 3P8JA 3UJEA 1A0EA 4ONVA 2WCGA 3WY1A 1TV8A 3AWOA 4JEJA 4J3WA 1D8CA 1AH0A 1XLGA 5LIYX 1HJWA 3UQNA 2WKJA 2VC9A 1A5UA 1TREA 5CSSA 1OT2A 1US3A 3RO6A 3WL0A 2A7PA 2NX9A 3GQYA 2J4GA 4Q4QA 3TYEA 4HPNA 5DQPA 3RCYA 3TOPA 4DO5A 2YW3A 6ENLA 3ANYA 1TTQA 2VEKA 2JKAA 1W17A 3L21A 4BY3A 3WK0A 4BCEA 4LUTB 2BFGA 1OFPA 2BVYA 1IV8A 3MA8A 2GJPA 3MBFA 4JL1A 4QG9A 4FR1A 1XH2A 1F8IA 1O5QA 3PZUA 4CN1A 3SJNA 1R3SA 2HE5A 3H2NA 2D1ZA 5LA1A 1Q6CA 2FFIA 3A9BA 2CPUA 4XAFA 4A2SA 3EWYA 3GYCA 3U0HA 3TFXA 4BS0A 3ARUA 1JZ8A 3V5FA 4C7GA 4JL2A 3A13A 4OIFA 4QCEA 4GO9A 2ADAA 3GNRA 2YGYA 3LCGA 4MDPA 1QNRA 1C8VA 4TX6A 1PPIA 4IICA 4AD1A 3T05A 4WQ6A 3DOPA 1DL3A 3SUTA 4C6JA 3AUOA 3UCQA 4WDXA 2NT0A 5EPDA 1AJZA 1DJIA 3QPEA 3GAYA 3ITYA 4OV9A 3AXKA 1FCVA 4YYFA 3DX5A 4I9TA 3OGRA 2EGZA 7XIMA 2POTA 3W74A 3MUIA 4FXJA 1V0NA 4ZFMA 1QNVA 4DJED 1B90A 4YXGA 3M0ZA 1OYCA 1OFQA 5I7GA 4E3VA 2DIEA 3E6EA 3O0KA 5GVJA 1GPWA 3LHUA 1O7AA 4E8DA 3W00A 3FFSA 3EKLA 4S3GA 2WHJA 3QFEA 2YYTA 4Y2WA 3UJFA 3SI9A 1P1XA 3D0CA 1W6TA 2CLLA 3VC6A 4PUKA 1G6CA 5A2AA 3QY6A 3LENA 4QFUA 1KO0A 3AZSA 3S2NA 3S46A 4CQAA 4GQQA 3OGSA 5KMYA 1XIHA 3H23A 4GJIA 3C2OA 3DFYA 3GVVA 4NG3A 2VGBA 2A3LA 4M24A 1G67A 4X63A 4L5ZA 4J35A 2QAFA 2YZ5A 1D3GA 3CPUA 1CGXA 4N0RA 1GQKA 1LORA 3UWYA 2NWSA 3UFYA 3S3GA 2Z6JA 3AS3A 3TP4A 4GMEA 3K2GA 4G6CA 3M16A 4E4UA 2IPGA 1V5XA 3W25A 2G4FA 1UD8A 1KB3A 1TCDA 2W27A 1KXHA 5HWNA 2PU0A 2EJ1A 1OX6A 5H8UA 2X41A 3L2MA 1K7XA 4HK7A 3AQUA 4IIFA 1J2BA 4OBSA 3STPA 4GA8A 4DZAA 2V5KA 1JYXA 2X0SA 3VXGA 1AQFA 1PKLA 1GZ1A 5DMYA 3NQ7A 2NUXA 2QJJA 2Y62A 3QY7A 2V5CA 4O4VA 3RFAA 2EBNA 3GTNA 1LRTA 3C3UA 1LDCA 5CPMA 3L4WA 5CKSA 2ZX6A 3NZPA 1PAMA 2BHYA 1L6WA 3M0XA 4ERGA 1W5PA 4GGHA 3SRDA 2XSAA 3GLCA 1GVIA 3B4UA 1BVZA 1EP3A 4I3GA 3E96A 4D8LA 4BEUA 1IHIA 1CCWB 3GYEA 4WSHA 5FL1A 3ABRA 2Y1HA 3GG0A 1OB0A 1Q8AA 5KZMA 2FJKA 1MDRA 3L65A 3OP2A 5LNWA 4JQ3A 3V1HA 4G7EB 3VIFA 3P62A 3ITXA 3N6QA 1KCLA 1FWJC 2OR2A 1FHUA 4XB3A 3V36A 4ZE4A 4YMZA 3HN3A 5M03A 1OFOA 1F6YA 1NQ6A 1HQTA 4DB7A 4Z1AA 1EQPA 4AC7C 1W0MA 1A49A 1CLXA 4IFKB 3QV8A 1HTIA 3DG3A 4UUIA 3U7VA 4IL0A 3S6OA 4HKPA 3K8KA 1M7JA 1EHNA 2I56A 1ZP3A 3A4WA 4Q8WA 2Z1WA 5D9OA 2P8CA 2DUAA 4U31A 2EO7A 1ME8A 4IPPA 5F4XA 3CIVA 3OA3A 3DFSA 4PMUA 2JEPA 2ZC1A 3B0XA 3BJTA 3OZMA 4PUDA 4QISA 3CB8A 3MSGA 2VCBA 3KBSA 3SO7A 4BF9A 2ZDRA 4KCWA 1BKSA 4GY1A 3SURA 2BP1A 5D32A 4HTYA 5DBUA 3QMTA 4JIEA 3Q67A 2QJIA 3APYA 3BTNA 3T8QA 4FIRA 1S1PA 1KRMA 2CEQA 1G4TA 4DJDA 3LSCA 3KVKA 3W76A 1WPCA 2CXGA 1GK8A 3WF0A 4B3KA 1RJRA 4HNTA 4OJYA 2D0FA 4IX2A 3FNDA 3MUAA 1PX3A 5L6UA 1IIHA 1ZP4A 2Z4GA 2QCDA 3NTYA 3GUGA 3FCPA 2VEMA 3HGRA 4PB5A 1I8JA 1HGYA 2YBUA 5CZJA 2PTWA 4UBPC 3NIYA 3DH7A 4LFYA 4B9ZA 1WDDA 1MDLA 1KCKA 2V30A 1DJGA 3MZNA 2W5FA 1DTUA 4MKVA 1XBZA 1QVBA 2DJXA 1CTNA 4JD4A 4H9MA 1RPXA 2OZ8A 2XVLA 1LP6A 4E2BA 4EXQA 1Q4NX 2GSEA 4N2YA 4JYEA 1V93A 2BVTA 4GABA 2EHHA 3FSUA 3WN6A 5M17A 3VFLA 3PZOA 1US0A 2J7EA 3VTRA 3MMDA 4G1NA 1BYAA 4W7UA 3GU1A 2VCAA 1NSJA 1G94A 3SEPA 2B81A 1TWDA 2ZKMX 3HV8A 4JTAA 3VIGA 1PB0A 4EAMA 3DG6A 1W3KA 4XD6A 4P2VA 4LC6A 4Q8PA 3CAQA 3GM8A 5FOOA 1P7TA 5E0CA 3C3NA 3PAOA 1E9IA 3DBPA 2QCFA 2WZHA 2DW7A 3I7RA 3TN5A 2F2HA 2WVUA 2ISVA 3AFBA 3CT7A 4XO7A 3EYPA 2ISFA 2OWXA 2VRQA 5HUOA 2OO6A 5AFDA 1P6BA 3OZPA 2QJMA 2DEPA 3TV8A 4TQTA 3BVJA 2DP3A 3CO8A 4UMBA 3WFLA 4FI4A 3V7PA 2E8YA 4DNHA 1H11A 2CZEA 4HU3A 2OX1A 2UY4A 1GJPA 4ECLA 1DV7A 4CD4A 5CGMA 4YLWA 1MQQA 2J8FA 2XZ7A 1F9CA 4JFVA 3SCWA 2ZZ2A 4O13A 1YPFA 4LS2A 2C19A 4C1NA 1RY8A 4WSJA 2HE8A 4GC4A 3PNZA 1JDFA 1KR1A 3ZS4A 2BOFX 3LCHA 2BXZA 2J6XA 3WQ6A 1N8FA 1PZ2A 1WXJA 3GZAA 3IVSA 4MY9A 1S5MA 2JALA 3QH2A 4HA0A 5AHFA 5CSRA 1SFTA 1GVQA 3SQSA 2R1KA 1W5MA 3EDEA 3JVAA 2WC3A 4IQDA 4FS9A 1BXBA 2YL5A 3MW7A 4JTFA 4MY1A 4AUBA 5U4NA 3VGGA 3CLMA 4FXSA 1GORA 1XISA 3DHUA 2J7HA 3NCOA 3OODA 4WXYA 3LM7A 3AHZA 3TLLA 1PBGA 3VGEA 4J40A 3WDRA 1XIBA 2E3ZA 4DYJA 3LTPA 1E0TA 3RR4A 5LGXA 1M7PA 1GVEA 3SUWA 3I7QA 3ARRA 3MCNA 3E02A 3MSDA 3R94A 4XZLX 1PCKA 1XIDA 4DWSD 2WVVB 2PP0A 2EG6A 5ECVA 1TRIA 5CZSA 3W28A 2UY2A 5CJ5A 1XLJA 1ELSA 3F4VA 1BSIA 3LERA 4UFMA 2ZUWA 3VMPA 1QHZA 4XAZA 3NO1A 3L12A 1H7PA 1BG4A 4A22A 1IEWA 4JDBA 1E51A 4PE8A 4AAJA 1GPFA 1KTCA 2RHGA 1VPQA 1EDGA 1FDYA 3JZEA 4R3UA 3G1SA 3L4XA 4CLMA 1E9YB 2P8BA 2JIWA 5EMLA 4KCUA 2WWDA 3KBVA 1WB0A 2EPOA 1PSCA 2PWDA 3MQTA 1LL6A 4PRTA 2WNZA 1B9ZA 1AJ2A 1LT8A 3DXIA 3O9NA 3T08A 2NLYA 3HV9A 4ZE5A 4S38A 2OTDA 1GVOA 3U48A 4A3RA 5DCBA 2QF7A 5HQLA 1WX0A 3RRAA 5CJMA 1I4NA 3FDKA 2G3NA 5HDRA 1GNXA 3VKAA 1QTWA 3S5SA 3NO5A 1HKJA 3MO4A 3L4ZA 5C0QA 1A3HA 1Q85A 4IQEA 3LNMA 5D4YA 5FSDC 2PDQA 3KFTA 3W7RA 4C6FA 3N2OA 1NWSA 4A05A 2YIHA 4C1NB 2FZBA 4DUVA 1EPXA 3Q94A 4S3JA 1I6NA 1UA3A 1D3CA 2F84A 2QUNA 2WM1A 1Y8BA 1PHQA 1W2PA 4ZQRA 5AOUA 2XGIA 3ZWSA 5HUPA 1Q65A 5TQLA 1CW2A 4MAVA 4JHZA 2C3ZA 1OWQA 1RCXB 4TTUA 3L23A 3ZMRA 1K7EA 2BY2A 4EPDC 2DZBA 4PCFA 3G0XA 4A8LA 3CHEA 3NQ8A 3V18A 3IACA 1G1YA 2QDDA 4KIEA 3TZFA 3W6LA 2VVSA 4OKDA 5BMXA 2KX9A 2W4XA 1VH7A 2PTDA 5C9UA 1P6CA 2HNEA 1LBFA 1G69A 5I24A 4NX5A 3P61A 2ZXDA 4XZHA 4P7OA 3F4DA 4QP0A 3WQ8A 2GWGA 2ZRWA 1JULA 1UB3A 4E2DA 4U2YA 3STGA 1EX1A 1BQGA 1UH3A 4AZ6A 1Q63A 3OIHA 3B0PA 3AHXA 1DJYA 2VC7A 4B16A 1BYCA 4GFIA 2H9AB 2F61A 4LF1A 3L5AA 1P0DA 4UZSA 4J7RA 4B5VA 4H04A 5ABEA 4O0KA 2JEQA 4D6FA 2ZWYA 2V3FA 4FX7A 3ZWTA 1FWSA 2O92A 1WZMA 3TN4A 2WKLA 4C6KA 4H41A 3H2FA 1BD0A 1OM0A 2C15A 2PWUA 1JCMP 2BV9A 4LS0A 1DYSA 3BAYA 4AWUA 5CGTA 1NEYA 3S1VA 1GOIA 3KCOA 4NYYA 3CPGA 3KP0A 4I5UA 3GE7A 4I6VA 1ZJIA 4JTDA 3WF4A 4IP7A 3F2DA 4LW7A 2OYKA 1G4EA 1T41A 4HK6A 1M5WA 1KBJA 3TA9A 4CNPA 3H2EA 3URBA 5BROA 3FXGA 3IEBA 1V51A 3UG4A 3TXZA 1NQKA 1JAEA 3QGKC 3N25A 1OGGA 1NFGA 1UKQA 3AU6A 2JK2A 2I14A 1PTGA 3FS2A 4MHBA 6A3HA 1Z7AA 4O17A 2VM8A 4FHAA 1D9EA 1BXNA 3CASA 5FF0A 3ELFA 3M41A 3QM3A 4JN6A 2PDKA 3TYAA 4XZIA 1FUYA 5DFAA 3SADA 4HHLA 5TNVA 4EXBA 1WDWA 5SWUA 2VI0A 3ATZA 1DQUA 2GGJA 4AY8A 2OSXA 3WYZA 3D3FA 1XIJA 4J3UA 1DJQA 1TB3A 4M29A 1QK2A 3CUJA 4GY7A 3O07A 2O0TA 1XYBA 2XHYA 4G7FA 4IGMA 1S46A 1ISVA 5A94A 3SQMA 4Z2GA 1DE5A 1BVWA 4MNJA 4N9EA 3LLXA 4K68A 3W7DA 1VEPA 2W3ZA 3WX7A 1RLCL 3B04A 1PCWA 3BPWA 4HZ8A 2CCRA 3IV3A 4GYPA 4LBRA 2YXGA 3VKJA 3GW3A 2WJZA 2QAPA 4Q8NA 1JGMA 1WUFA 1V6VA 2XM2A 1EJUC 1I2NA 1B54A 2X1RA 1GQLA 2X1SA 2OT1A 3G6LA 4FPSA 4G9PA 2HBXA 3PY2A 1KC7A 1A5CA 2ZRUA 3NQDA 1DJNA 4HCLA 1H60A 4IP5A 5IDIA 2H8XA 5HPOA 3WMCA 1LWHA 5MKGB 5D05A 2QV4A 4F0KA 4ZQPA 2O9RA 5JH2A 3N04A 2FTYA 2VXNA 3OLEA 2PLKA 1MXGA 3BLOA 1MFVA 3L66A 5F2LA 4QQ3A 6ALDA 3G3MA 1S38A 3AXIA 4HYVA 1ZAIA 4GIYA 3TNOA 4EAYA 3R8HA 3CHFA 2J7FA 2XVGA 4XZWA 3W1XA 2Z0IA 3EA2A 5G4WA 4HN4A 2NQLA 3ZSTA 3CQKA 3CH0A 1MQRA 3E5PA 5LYRA 2GGEA 4QNWA 3UCCA 3AISA 1GHRA 3ITVA 4WGXA 3TNBA 2OJPA 3GTHA 4M7SA 4JYDA 3RDKA 5I07A 3RPDA 3VNYA 1TO3A 4N6FA 1LTDA 3D46A 1JI1A 3UYCA 4EF9A 1DE6A 5D8ZA 4Q4PA 2CWXA 1IR1A 3MWCA 3A5VA 4B2DD 4AEOA 3VDHA 3HURA 4PUWA 3U5UA 4J3TA 3NGFA 4AIEA 4DJDD 2Q02A 2W61A 5LHEA 3N9KA 2WMJA 2A5HA 3LPOA 4S3AA 1WZAA 3WLMA 3EWDA 3LNPA 3MCMA 4N6EA 1QI5A 2WSPA 2E9MA 3NQAA 4QTGA 4JTEA 4RDVA 2OYMA 4ACZA 2HISA 2P5NA 2Y5EA 4WXZA 1EC8A 5DCDA 1QO2A 2XFRA 4M1BA 3S47A 4DI8A 1J8VA 3IVUA 2Z1BA 2AGKA 4ZA0A 3VGHA 1XCWA 1LUCA 3AHYA 1A47A 5EBAA 5T8GA 4LVDA 3M64A 2A6NA 1EP1A 3QYQA 4L56A 3H2OA 3F5LA 3P60A 1W1ZA 3BAIA 4PTVA 3A64A 1UPMB 3P5ZA 3MS8A 4O52A 4WX2A 4Z42C 4G7EA 4ZO7A 2I9EA 4V33A 2QR6A 1E0XA 4JOMA 3EPMA 1JCTA 4DJFD 3C2YA 4RW3A 3KXQA 4UR9A 4GI8A 4D8ZA 3KCLA 1QO5A 3VZZA 1GW9A 2B7NA 1Y7VA 5G2WA 3M5YA 2JFEX 3GW0A 1K7FA 1ZZMA 1OABA 1JZ2A 3W1RA 1WDRA 1XCXA 2AKMA 3V0SA 4AZBA 4BA0A 3PTDA 2NZLA 2ZICA 1QPOA 1WZKA 2QMJA 4E2VA 4DZ5A 4R33A 1EP2A 4HBKA 2XUCA 3K13A 3I3BA 4GXWA 5A6TC 2ISWA 1TELA 1H0IA 2YKKA 2C71A 2OQLA 3AS1A 1CDGA 1OF6A 2BOGX 3QJAA 1W3TA 3GG7A 4D1JA 3KTXA 3PZMA 1R5YA 3ZLFA 1EOKA 4NAFA 3W75A 1TWWA 2OWWA 2OXNA 3AWNA 2G5WA 4X9SA 3TONA 4NNBA 1YNYA 1JCYA 1G7VA 3CIWA 1F3TA 1XSKA 5IFTA 4K7VA 2WJFA 3T0CA 3WLPA 5I03A 1XHGA 1GONA 3ZQ9A 3TIMA 3IGUA 3CGTA 3EBVA 2VFIA 2HS8A 4BF7A 1EQCA 1K9TA 2XJ7A 5E70A 1QFEA 4TO8A 3TFCA 3UT0A 4KKXA 1K4HA 2NQZA 1JYVA 1XLHA 3EX1A 3FYOA 3SRFA 2DY3A 1UR9A 4C6IA 2PAJA 1Y0EA 2H3BA 2GJXA 3V5CA 1PZ1A 5CAKA 2FZ9A 1GOXA 3WEZA 2FHBA 3LHYA 3BUVA 2CITA 3LOTA 3A23A 4NP7A 4KFOA 5BOFA 2X05A 2PDJA 1SYTA 2HEJA 4RL3A 4WK9A 4K36A 3E0VA 4F9JA 2ACRA 1X97A 2ZC8A 4H6EA 4E2OA 2V3DA 2XVPA 2YW4A 3QYSA 3L0KA 5DT7A 1UG6A 3MDUA 3S1XA 1AQHA 3O2LA 3STEA 3GHUA 3AIQA 1XIMA 5CH9A 1OQFA 1RVKA 3DERA 3MWAA 4N42A 1KWGA 1X98A 1E9LA 4AWEA 5LIWX 2RGLA 1J10A 2Q6ZA 4I7WA 4PCSA 3EA1A 5CLWA 1N7KA 1W9PA 5CPSA 3TK7A 2Y0FA 1YEYA 2X1TA 3BLFA 3MDWA 2FVMA 3G3DA 1BYBA 4FOUA 1EFZA 2WVTA 3W87A 3R0KA 3HIJA 2F38A 1U1UA 1IT8A 3U2OA 1RCOB 3A6OA 3N2XA 3Q65A 1K9EA 3E0WA 3JR2A 1XLMA 4PTNA 1K6AA 2NQHA 4CCDA 3WQCA 1CGVA 3SFKA 1ZS2A 1EJXC 3PAJA 4HOWA 2VCCA 3P67A 1XH1A 1NAL1 4Z1YA 2GLKA 3LM3A 2V5DA 4MUZA 2FYMA 1JD9A 2GK1B 4OUEA 1H62A 4PFHA 1IQ8A 2VZOA 2FMNA 2JGYA 2HMCA 1JYNA 3QKEA 5H91A 1VHNA 3QMRA 4C6MA 3THUA 2CBIA 4LX4A 3S5OA 3LPFA 1UZ4A 4WHBA 4L6OA 3WQEA 1R38A 3WD3A 1RA5A 1XFCA 3EEGA 3G1YA 4JXCA 1JG9A 4MG4A 4AMAA 4TMBA 2CHOA 4NHVA 5AC8A 2GOKA 1E0WA 3N9SA 1TKKA 3CPRA 3POHA 2R1PA 4IJCA 2BBFA 1KKOA 1O5RA 4LCSA 4M0XA 2ABBA 5C70A 3LSBA 4JFWA 1JRCA 4RKAA 4QRNA 4F0SA 4IJRA 5AKQA 4YIWA 1UKTA 3H70A 4U3AA 2VELA 3LMYA 3BO9A 1CXKA 1R86A 1UIOA 3VABA 5TIMA 5AVNA 2GDVA 3AIWA 5DBTA 1A3WA 1GQNA 1UD4A 5M5DA 4KCVA 4A21A 3GVRA 2PTZA 1ZALA 1V6WA 3EMCA 3PB0A 2DT3A 3BW2A 3RMJA 4HNCA 4ORMA 4D72A 3QHOA 4I5XA 3MVTA 3RO8A 4GZEA 1WO2A 1FH8A 3MI6A 1I2QA 2FZ8A 1YNPA 3LYEA 1F3EA 2ZRXA 4JFTA 1MZHA 3GXFA 3QTPA 1VF8A 2MANA 1R3QA 3EX2A 3M4HA 4JX5A 1XD1A 3MY9A 4PEEA 4QE5A 5KZ6A 1YQ2A 3VO0A 2OELA 3HGJA 1NU5A 3CAKA 3JW7A 3STFA 5I3GA 2J6VA 3KRBA 4ZODA 4Q33A 4YHEA 1S2CA 2QHAA 2PWVA 5HJLA 4CNUA 2VQTA 3FA3A 1S5TA 5FEZA 3WEMA 1JPIA 3GBEA 2GJXB 1LQAA 1ITUA 1TE6A 3ISIX 1CB7B 4KGLA 3GDTA 3REQA 2D2OA 4S3KA 4IIBA 1GZGA 3DGRA 3RNDA 4AWSA 3VIJA 4UFKA 1CYGA 5IRPA 1QOPA 2V0TA 2PA6A 3WBEA 2FZMA 2GQAA 4Z1CA 4K7YA 1UA7A 2GJRA 5I02A 4PMNA 3S42A 3A3XA 2FTPA 4PUNA 3S9YA 4DJFC 3WK1A 2D69A 1JUEA 5I3FA 1DHKA 4U4MA 2GOUA 4J4KA 1EDQA 2OLHA 3S0CA 3TTEA 2EG8A 3DDMA 4DIAA 3S5ZA 4FLQA 1AK5A 4DBDA 2Y2WA 2PDGA 1HO4A 4PB3A 1DJWA 4R7OA 3M6YA 4DI9A 3I68A 1TMQA 3GHTA 3W23A 5DCEA 4AD0A 4PMJA 4HMEA 3QEZA 4W4QA 3T40A 3NL2A 1N8IA 1OZMA 5BXPA 1J0HA 1SR9A 4K1WA 4YNGA 3AMDA 3JUGA 3PFRA 4O1AA 1X38A 5AHEA 3UZWA 2PTYA 1XICA 4IGNA 1XDJA 4O53A 3OBAA 4QEEA 3EB4A 1QBAA 2RJHA 4RPPA 4ES4A 3ZJ7A 4C91A 4H9UA 2A3BA 5F4WA 3OQEA 3CV7A 1ONWA 2VWTA 4LOCA 4BQ2A 3ITOA 4NI8A 1FCBA 4O1DA 3SGZA 3CJPA 6XIAA 3BLDA 3LGGA 2P76A 1VZWA 3QHMA 2GVJA 2PS2A 1A5LC 1KLYA 2WPGA 1YW1A 2WC4A 3GVQA 4IIDA 5DMMA 4EKJA 2Y7FA 1Q7QA 1SVDA 1FWTA 1M04A 1HT6A 1XC6A 3G22A 3F03K 3ARQA 4QJ1A 4DPPA 4FNQA 2GDUA 3KOFA 4PRRA 2DIJA 1FHDA 1OYAA 3JRKA 3RMEA 2WOQA 3E0IA 3R8RA 3IK4A 3PZVA 4HK5A 4TTGA 3N15A 3GVWA 4ZB0A 3GTFA 1DOSA 3M44A 5IXEA 3KL0A 4XBKA 3OYXA 1E4MM 4J3ZA 2FPTA 3I3DA 4JIHA 1P48A 2OOFA 2FIQA 3PG9A 3SECA 3BMVA 4I9MA 4IIEA 2REQA 2PUZA 3OJGA 5AVHA 3GDKA 1H63A 4QS6A 1LCOA 1X1NA 5IDZA 4GBDA 2X42A 3BGGA 3CTTA 1SM9A 2ZZ6A 4Q8TA 2VX7A 3OLGA 5BOOA 3UETA 3ES8A 2RKXA 3M5XA 3G8EA 2CLKA 3OPSA 1TRDA 4UR8A 3RJYA 3LDVA 4GIRA 5CBBA 2CIPA 4US5A 4NNAA 3TKFA 1HKVA 3LI0A 3W2JA 3GXIA 3PJXA 3H26A 4P8UA 2QW5A 2VQUA 4FO4A 2O4QA 4JIRA 1Q6LA 4S3FA 3LB0A 1NELA 4HVXA 3L2IA 4DWDA 4GIEA 5C71A 5HATA 1SJDA 4CU7A 3HGOA 1TVNA 2QCEA 4L4PA 1VFFA 3OOQA 3ZJ8A 3L5MA 1IF2A 4WKAA 3NYDA 2HROA 3UJSA 3BZGA 4UTTC 3LK6A 4UTIA 4IUOA 1XUZA 2OEMA 3TXVA 1WAWA 4ILSA 1FOBA 5AYYA 1IWBA 1CXFA 4F0LA 4IIGA 1YXYA 3F5KA 3N73A 1WAUA 1VEOA 3T55A 2YDQA 3B40A 3IUDA 3VM5A 1UC5A 1TV4A 2V8ZA 4L4MA 1VP5A 1PZ0A 3CWHA 5IFPA 2FB2A 2R6OA 2PSNA 2FH6A 4ZVJA 3N4AA 3ABQA 1QUMA 1HJUA 3W3OA 1NH6A 1G7UA 4FOJA 1I2OA 1BXCA 2P0IA 3N2BA 2WANA 1FWFC 2AQOA 3W71A 1UP3A 3BG5A 1NM9A 3SFWA 2Z24A 3LBCA 1DWHM 4PN2A 1R0MA 1GTEA 2V9DA 1FY6A 5CBIA 1TR9A 2VOMA 1KR0A 3NUKA 4W5ZA 1M65A 3KTCA 2WLYA 4OECA 1HX0A 2CZVA 5CG0A 3IS4A 3P7YA 1TX2A 4RE4A 2GGIA 4AD4A 1NWTA 3GNDA 4B91A 3TR2A 1E6ZA 4XUGA 1CT5A 5AYIA 1AW5A 5FESA 3LRMA 3JZUA 1GVYA 5IHSA 4UTWC 4JZ5A 4NJHA 3WDPP 1XF0A 1E1EA 1Z9AA 3QW4B 1GEQA 3ZLGA 4DYEA 1QU4A 3DIPA 4J3XA 2BHUA 5H1WA 1IGSA 5GJMA 3BSHA 3H7RA 8A3HA 5AHLA 1TV2A 1CLKA 3CEPA 4C7DA 1MW0A 1KXVA 4R27A 3KW3A 3OVGA 5JBFA 2MNRA 1KRAC 4LAZA 1RCQA 4BQ3A 4K8GA 2XN1A 2YCLA 3TUUA 3FY1A 5K9XA 1EO5A 1XRFA 4PTMA 3CWOX 4JNMA 1OEPA 1UMLA 2HVNA 1WDPA 4MZ1A 4IIHA 2VDGA 4MJZA 4GGBA 1B31A 4WF7A 4RNFA 2PGWA 2WBKA 2VHLA 3ABOA 4HHHA 1VHCA 2Z2UA 3QC3A 3W7EA 5FEWA 5K2ZA 3OB8A 4S3CA 4J1OA 1U5JA 4UTWA 3ES7A 3L7RA 1E9ZB 2D2HA 3K4AA 2X09A 4CUCA 1P0BA 4HCDA 2V5LA 3DG7A 3FLUA 4Q7BA 4WY0B 4ZXLA 3AXHA 3THCA 1KFEA 4S3BA 4YYCA 1SZNA 2P3EA 4JQ2A 3BJFA 4O8AA 2GQ9A 1RV8A 1HP4A 1LG2A 2J66A 1JRBA 3AIRA 1R2RA 3PN8A 3TW7A 3QOMA 3W2LA 4LY4A 3N19B 3CUHA 3I3EA 3RJXA 5EL1A 3MC5A 4B5SA 1K1DA 3UXKA 2PB1A 4HHPA 4LU0A 4PSPA 4HSNA 4LCRA 3UCDA 3K30A 4RJEA 4KGJA 4QJ5B 4KETA 3BE7A 1H7RA 3NWRA 4K38A 7CGTA 3E74A 2Y7DA 5LIUX 2H9AA 1H41A 1PIFA 4QROA 4L61A 2ZX7A 1W1PA 1GTHA 2DT1A 3AIEA 1JXKA 3G1RA 3W29A 2C6QA 1VFTA 2CXEA 2OODA 5BWFA 1FWHC 2IW0A 1IXPA 3KRUA 2OZ3A 2VC6A 4WDTA 4KRZA 3SJ3A 1IZCA 1SZRA 2DZTA 3NL6A 1FWNA 4FALA 1FWDC 4GYKA 1X1ZA 4PB4A 5CPLA 1E4IA 3NR0A 1ISWA 2ZX5A 4DO7A 4L1XA 1B3OA 1VJSA 3C2RA 1AH4A 4J5NA 4HSOA 2H3DA 1OYBA 3L4UA 4XD3A 4MJ2A 2GJNA 3W2MA 1Q66A 1FWAC 2A2IA 1X96A 4WJXA 4HOZA 4GUJA 2FB3A 5HWJA 3LXBA 3VX1A 1NF0A 4EVZA 4R88A 5CG7A 4GC3A 2FHCA 2QPSA 2PEVA 4S2BA 4WSKA 3KHDA 1MXSA 5CPTA 4ZXOA 4IJBA 2NSXA 3MKKA 1Q6QA 1XLIA 1RQHA 5LSMA 1OFRA 1TZ7A 1ZENA 4YTQA 2ZZ1A 3MO7A 3ITGA 4W87A 3WDHA 3C0QA 1E55A 1XLEA 2HVOA 2I1OA 3M0VA 1K8CA 2TODA 1JPDX 3N13A 3DUGA 4YL2A 4F8XA 4B3LA 3WLNA 4S23A 5H2ZA 2V2DA 1ME7A 1OC6A 1OFEA 4DWSC 5JVLA 1XLFA 3TTSA 3LPPA 4FK9A 1FX6A 4N9DA 3RG6A 3MKCA 2X7WA 3IGSA 2O4MA 2O7SA 4Y9OA 3CUXA 3RU6A 4JTSA 3H54A 4GJJA 3NG3A 7PTDA 2WSRA 1LUCB 1LJYA 1F74A 4W88A 4C6DA 3LGEA 2HK0A 4GCXA 4A2RA 4HZMA 1VBUA 4H6QA 1FXPA 3M9YA 1M1BA 3RN6A 1J0IA 3A4AA 2V3GA 4JN8A 2J27A 2QKFA 4YWIA 3FX4A 4K39A 5HMFA 3C56A 2E6YA 3K4DA 7ODCA 4AVNA 3PSVA 1KFLA 4BEQA 2VDHA 3QR3A 1VFHA 2VP8A 2FZNA 4AEEA 1AZ1A 4KWWA 1RR2A 2PRHA 1EZWA 2A7RA 1AL7A 2V5BA 3L0NA 4AXKA 5ABFB 2YPIA 2FGLA 3W1MA 5LZLA 5A6BA 3EX6A 3VILA 3GIYA 2OOGA 1LQ0A 4HSHA 4WOQA 3W1UA 3N3TA 7REQB 5FEPA 5JU6A 3GC2A 3CM4A 1OCBA 1A5KC 4O57A 5D2YA 1XWYA 5I3HA 2UBPC 3PPCA 4NASA 1M6JA 3QV9A 1DWAM 5H8MA 2H8ZA 4JGDA 3WNNA 1JFXA 1ZNNA 1W37A 1H7XA 3CMGA 2PWFA 3M7SA 4GX9A 2Z2AA 4WLCA 1Q5MA 1GKQA 4MOZA 4LSBA 2OEJA 4HZ6A 5A2CA 1UR1A 3SCOA 3TJ4A 2PDHA 2OKTA 4C6NA 1HNYA 3E12A 1RUSA 1R46A 3VGDA 3OEXA 4MUPA 3VK5A 1EOMA 3QHNA 5CC5A 3JU2A 3GDBA 4B90A 3PVFA 4GFSA 4XKMA 3LCLA 1VLWA 1PWLA 3DFPA 4F2UA 3OZOA 3G1HA 4XBSA 5FJJA 4QE4A 1F8MA 1VLIA 1FP9A 2V69A 3TAKA 2VFDA 4NT0A 3PWGA 1O66A 3I6TA 3UWZA 5A2BA 2AMGA 3CXOA 4GVGA 1WDSA 4XTDA 1PV8A 4U5KA 4MY8A 4MF4A 1HW6A 4WDWA 3WFAA 4C60A 1FWGC 3A3HA 3A3WA 3NGJA 3AXXA 3G2GA 2PCEA 2PDWA 1R87A 3KAOA 4IFRA 2WHKA 5J5DA 5LHFA 3UZYA 4L7ZA 4AU0A 1SO4A 3OBKA 3WUBA 3P81A 3R5EA 4IG2B 3WUFA 3WD1A 3CH9A 4LVFA 5KINA 3I4EA 3NSXA 3BL3A 2O56A 5FF3A 4XISA 1R3YA 3F1QA 3WCZA 4US6A 1TV3A 3ITCA 4GVFA 1P0EA 4JAWA 2ALRA 3HTWA 5K9DA 3OGVA 3R8GA 1O68A 3EMZA 2REQB 3T7VA 4NJJA 2AL2A 4QX4A 5DY3A 2G0WA 3M0KA 4NSBA 5D2XA 1SSGA 3WJWA 2XN2A 1TWSA 1S1RA 1SJAA 1NDYA 2D73A 4PTDA 4IMFA 3IPWA 4UZUA 4NX0A 3NVTA 4HA3A 2QCCA 1C29A 4K2SA 4IH3A 4DVOA 5A6KA 3UPWA 4LVAA 4ZZ9A 2Y61A 4GI4A 3SCNA 4M1RA 3MZ2A 2HPMA 2OMAA 4DBWA 1EDTA 3CL7A 3WNLA 4O19A 1Q13A 4FNUA 1KXTA 1B2YA 1KA9F 3CL6A 1NWUA 4TU1A 3PZNA 2CWNA 3GBDA 1XP3A 4HHMA 1E70M 1TIMA 2WC7A 3CL8A 1A5SA 2PU1A 4Q8UA 2IQTA 3N6HA 1TVPA 4L4OA 3VA8A 2XSBA 2Q3RA 1J4EA 2WZIA 1O94A 2PD9A 3AZTA 4OHQA 1MI3A 1W8GA 2ZXAA 4QG8A 3MSYA 3UVAA 2EPNA 1VYRA 1OG6A 3CUZA 3G5EA 4W7WA 4A3HA 3CB3A 1UZHA 3UESA 2NXGA 3EMQA 3H53A 1TZZA 4I9JA 1BTCA 1E15A 2Q8ZA 1MWOA 4GUHA 3TOYA 4PUUA 2YOCA 1YE4A 1DORA 1Z89A 3HPAA 1BSLA 5CSYA 3D47A 3EDJA 3B8VA 2CLFA 1X7IA 1XQLA 2WMFA 1RQEA 3NQ6A 3LCIA 3VPLA 1EGMA 1R47A 1GYMA 1XBYA 4KMQA 2OQYA 3VI2A 1NIUA 4XUYA 3BURA 2Y88A 3ABZA 2EPMX 2YJQA 1SZFA 4YJ5A 3WMSA 3T07A 4CNOA 1TJRA 2WO5A 3BAKA 2DT2A 3UZZA 2DZVA 4IPNB 1R3TA 1AODA 4FXFA 3RM9A 3P14A 4YTSA 3VMNA 1V7YA 5D38A 1FA2A 5D37A 1UBPC 1OC7A 1AW2A 3AC0A 3QR0A 3WKZA 1DQXA 3C5QA 3B97A 5FIPA 2A3CA 2BWGA 2A79A 2J9ZA 5TAOA 4E4PA 1J0KA 2FFCA 1JZ7A 3GSMA 3DGBA 2P53A 3GB6A 2PMQA 3AYRA 1UR4A 3DU0A 1R7AA 3IIZA 4B5WA 2AL1A 3N6JA 4LV9A 2VENA 5EBUA 1XSJA 3IARA 1EPVA 2OB3A 3H2CA 3CV2A 3O6CA 3O6DA 1D2KA 4UOQA 5FCZA 2I5GA 1XIFA 1BRLB 3W7NA 1PUDA 1QNPA 3ZVHA 3THAA 5PTDA 4BI5A 2E67A 5EFDA 4ZSTA 3T44A 2ICSA 2J7BA 2V2HA 1WKEA 3U4FA 2OQHA 3NSMA 2ZTKA 5KEZA 4NKCA 4W85A 5BXRA 1QATA 2O9TA 4H9TA 3W82A 3KVLA 1LLZA 4P5UA 4HJFA 2WMKA 4FNSA 4XSLA 3Q45A 3HOJA 2QPUA 1JGIA 1F3WA 3GK0A 3SCQA 1NP2A 4DUXA 2WAGA 4L6DA 1M9HA 4WKHA 2BXVA 1C9DA 1RBAA 5D2TA 2YB4A 3R6IA 1E5JA 2PD5A 1L2QA 3PZIA 1JEZA 1GGOA 4JTIA 1ZSXA 1Z32X 1W3NA 3GVGA 1TFVA 4V1XA 2BGSA 4MTVA 4GY0A 3KE0A 3M0HA 3N17A 3SCRA 4QR6A 3CZ8A 4UFIA 2QYGA 3LUTA 3UY8A 4QJ3B 1XPGA 2IXUA 2DIKA 4TIMA 5KETA 2PZ0A 3BANA 3TYDA 4A3YA 1SJBA 4US5D 1D7KA 2CKSA 2TRSA 4JBRA 3B05A 1UC4A 1W9DM 3TSBA 2YL6A 3VNIA 1J18A 2G37A 3P6LA 3W2UA 4UQ9A 5DXYA 1Z42A 1J0JA 4GLEA 4CQ8A 1KW1A 5HBFA 2WHMA 4ADTA 3CS2A 1W5OA 3QF0A 3A4JA 3O6YX 4IT1A 2PDXA 4HU8A 5LXXA 5HMDA 4V1YA 1MXDA 3AMCA 1NFPA 1L6FA 3ECQA 3WDJA 2QMKA 1PS9A 4KEUA 1NDZA 4HPJA 4HMCA 4H01A 5EMJA 5DANA 3CBWA 4MJ4A 1HF6A 3CHVA 3T4CA 4DPQA 3VVGA 2BGQA 1XUUA 3TCEA 2BY3A 3CLWA 1LLWA 1C93A 3R25A 2E68A 2ASHA 5FAJA 5AZ0A 3VIPA 1V79A 1P1MA 4LXFA 3BSMA 3E9AA 2CZ5A 1YHTA 4FF5A 2PF0A 4GK8A 3E2SA 1ONRA 1JYWA 3TW9A 2D2JA 3KRSA 3IANA 2ZA2A 3DCPA 4LYQA 2C79A 5CCZA 1EIBA 1W3LA 2DVTA 1S5WA 5G1TA 3DECA 3GC5A 3O06A 3EAUA 1YPXA 1EB3A 4DY1A 4JTTA 2YLLA 4W86A 4Z1DA 3DFTA 4NZ1A 5IBXA 1IR2A 2A4AA 1H1ZA 2VFHA 1E4NA 3ATYA 3WLIA 1X8FA 3CYVA 3LU2A 3FGCB 1K9DA 2R1LA 4M6QA 2XIQA 4I7UA 5E1QA 2G3MA 5JIWA 4YS1A 1HXJA 3V0UA 4MYXA 5G4HC 3QGVA 2DU2A 2RDUA 3KOWA 2WB5A 3G1VA 2EG7A 2G8ZA 1BPLB 4WGHA 5D33A 2E40A 3KZPA 4Z2LA 2ZX9A 1WV2A 4H8UA 1EH9A 2V6AA 1ZHAA 3RX3A 1AFSA 3OG2A 1I1XA 1TTJA 4MWAD 3KM8A 4ZOEA 5JIPA 1XYZA 2NV2A 3QPZA 4Q7IA 1UR2A 2ZVIA 2TSYA 4DAIA 4IM4A 5DRCA 4HCHA 2D0HA 2QNEA 4S39A 3W1AA 4RXGA 5BW6A 5HINA 1UKPA 2NVCA 3T78A 3H21A 3W27A 5IHRA 1CGYA 1CLVA 3KVJA 1V0MA 1XLDA 1PEZA 3HQ1A 3DC0A 5ECUA 3APTA 3UA3A 4KWOA 4LWWA 3WJZA 5HR6A 1ENUA 4UOJA 3BV7A 3CZEA 4OV4A 4MB3A 4XVDA 1YLVA 5LNSA 2B7PA 3VNJA 4LY8A 3WLTA 5LIXX 3ITLA 1S39A 4R5EA 4ML4A 1F73A 2BY0A 1E6SM 2D20A 5FF4A 1CI1A 1WP6A 4XV0A 2EKCA 3I6EA 4H2HA 5A8MA 4DM2A 3NQ2A 2CETA 3FKKA 1J9YA 2FPVA 3EOSA 3WELA 1KGXA 3HPSA 4YVPA 3AALA 5AY7A 2NQ9A 4QJ4B 1MRAA 1T8QA 1TPUA 3QSTA 3W1LA 1TZ9A 2ALDA 8CGTA 1A5OC 2YDAA 3CIXA 1OF8A 4LS1A 2Y24A 4ERIA 1JF6A 2FLIA 4PMYA 2GVEA 3OBEA 3EWUA 2ZXBA 3U6WA 2CBUA 1EEPA 2Y89A 1OK6A 4AXNA 3NO3A 2HZGA 2BX7A 5D30A 2GQ8A 1S3HA 5BXSA 5FSEC 2VWSA 2W6RA 1W9XA 1FKXA 4Q4SA 1MEHA 1HL9A 2ACSA 4PUMA 1OHLA 4FA3A 1J5SA 3VDCA 1MRQA 2Z1KA 1IT7A 4IPJA 3IWPA 3LS9A 4NXKA 1JZ4A 3MJMA 2E7FA 3V5OA 1Q6GA 5T9BG 4Q3MA 4UTMA 4H8VA 4CCZA 2PI6A 2PDLA 4M6VA 3S1UA 5BWAA 3SY1A 1O12A 3BG3A 4G56A 1NWRA 1RP8A 1XYMA 5ABGA 3OVRA 3VKKA 2ZBTA 3QR1A 3KLKA 2DGAA 2HS6A 4MJMA 3U7BA 3LHZA 3T0AA 2ZRZA 2ZA3A 1KM2A 2INFA 1CXIA 2E25A 2NSOA 1SMDA 3W4RA 3VNKA 4KERA 4PMOA 3VIHA 2DQWA 2EF9A 2HV5A 2NLIA 3WBAA 4B5NA 4O1BA 4EWJA 2ZOXA 4O4WA 1I1WA 1KWKA 1X1OA 3AZRA 5I09A 4I7VA 1YDNA 2Z2BA 3S5YA 4J9JA 3VDAA 2TMDA 1BTMA 4ZQNA 1UOZA 1NOFA 1DP0A 2L5HA 3WBYA 4P7QA 5AC4A 4JQ4A 1HGWA 3AJ7A 3AYTA 3IK2A 3AIVA 3B0VC 1XSIA 3BDKA 2CNCA 4DF2A 3DENA 1E73M 3BXWA 3AU2A 5IBXC 3R0UA 3PPGA 3O7UA 1XFBA 3FDGA 1W3JA 4DLMA 3T0TA 1O5XA 2E28A 2YCKX 5A6LA 3N34A 1WDQA 2W92A 1E56A 2E77A 2GUBA 1QW8A 3FK4A 1DJZA 4XD4A 4Q4RA 3FJ6A 3C61A 5HNTA 1L6GA 2YXXA 3BWWA 4HA1A 3OVPA 3WQWA 5CAHA 3GX9A 3M43A 1J11A 4CU8A 3SSZA 1FCQA 2YCJA 4B9YA 3E0FA 1QW7A 2NW0A 2E9BA 4PMXA 5D03A 2VDIA 4H7VA 3C8NA 4FMVA 1UR3M 2EXOA 4MLJA 2CBVA 1XKYA 4LC8A 1A5NC 4D6GA 3B4YA 4N4QA 1RJQA 5DEZA 2VKZG 3R11A 3PBWA 2NX1A 4JIPA 3BAJA 1S2TA 3WQGA 1K6WA 2Z27A 3WNPA 2RJGA 1K3UA 1OG0A 2OEKA 2DH2A 3U5YA 5BMWA 1KV5A 1V02E 3AS2A 1ZBWA 2C8NA 3BLLA 4W5UA 4HTBA 3E0LA 3TSDA 4HNNA 4KEVA 3QSRA 1RXOB 5EMYA 2PURA 3TMQA 1C8YA 4C6QA 4QIUA 1SMAA 4FIQA 4E38A 5FKYA 4Q4OA 1M03A 4GQGA 4U28A 1CX9A 3NXLA 3WUEA 4H8NA 1P4CA 4JHMA 4GO8A 3CAWA 4MDOA 5GJNA 5CC7A 3FIGA 3NM3A 5A6AA 4GD0A 3AYSA 1OADA 4G1KA 5CSUA 1W1YA 3QZAA 3W7CA 4ICNA 2DSVA 3TCSA 4W89A 2C13A 2RDWA 4XVEA 3S1GA 2IKIA 2A1YA 5KZEA 3TLQA 4MB4A 4QM1A 2BGNE 3K1DA 1DXIA 5JBDA 4CEXC 4ZB5A 2TYSA 5CC6A 1F61A 1VQTA 3GRIA 4JN7A 4MFDA 1B0IA 2XZ9A 3MHGA 4O50A 2W66A 3N3MA 1KBKA 3TX9A 1F5ZA 1UWSA 1AH3A 2QDGA 1NDWA 1SFJA 3W1PA 2LLEA 4YVXA 2W62A 1NJJA 3UXAA 4FLSA 1V3IA 4GUIA 1VGAA 1C92A 4DN1A 3QPYA 1VJZA 1NP0A 1PZ3A 1C8QA 2QDEA 1KFKA 2X1UA 3DKJA 2Y8VA 3ARYA 3V75A 1H4PA 4QQUA 1YDOA 2V68A 3W38A 1LRNA 1Z69A 2A0NA 4ERAA 3VKBA 1PVNA 1T5AA 1DQWA 2PTXA 3PP7A 3QZ6A 1GVRA 1RJPA 4LEQA 4OOUA 2VMFA 2ZE3A 2BTMA 5C2GA 1HL8A 1G01A 5EGRA 4N4PA 2V63A 1VCGA 3I6RA 1NVMA 2E1WA 1UWQA 4IUGA 4NI3A 3MP3A 1H61A 3EPOA 3GXMA 4MPKA 1KRCC 1XJBA 3VAVA 5CPNA 4NQ1A 1JDAA 3EWBX 1EO7A 4TVUA 2VFGA 4Z2KA 4BK9A 3ZJ6A 4LYRA 3T8LA 3LQLA 1XRSA 3PF3A 5M1TA 4YCOA 3CZKA 1DJHA 3OO2A 2PBOA 2UY5A 4R9OA 3VDGA 2A85A 3OYZA 1TPEA 2JF6A 5F2MA 4RDWA 4UCFA 1E43A 1A4MA 3UR8A 2GUUA 3EPNA 1SSDA 4AHPA 4JY9A 3B9EA 4LB3A 3LN3A 2C91A 5FJIA 2WWCA 5DMLA 1F6KA 1F4HA 3ICJA 1SW7A 5AN7A 3GDRA 3VDBA 4XQ6A 3VNZA 3RLUA 2C7FA 2PP3A 4RDYA 3HPZA 1GYNA 4NL1A 3TA6A 4ROQA 3KDNA 4IXXA 2CKRA 4HD5A 1E1CA 3MI2A 2VD8A 2O7QA 3BMXA 1KXQA 4M8UA 3BW4A 3PK7A 4PA8A 1V08A 3G77A 4IISA 1R3RA 3R89A 3O6AA 4WOZA 2DZXA 4QAIA 3FAWA 4TOQA 3MUZ1 1JNEA 4HPXA 3BGJA 4AISA 5LNUA 1KCZA 2R1NA 5DX7A 3U8GA 3IJQA 1BWKA 3HQOA 4Y9PA 4HGXA 5K7JA 3NURA 2DSWA 3KX6A 4NZ4A 1XL9A 3CUFA 1VFUA 4JCMA 1QWGA 3VNDA 4A29A 3F5JA 3B8SA 5JMUA 3QFWA 4OUIA 4ALDA 4HOXA 3RYSA 4MZYA 1G9HA 1XGEA 5F1UA 4DBSA 2FDSA 3W85A 3DHDA 2EPHA 4IQJA 4CQ9A 4L4LA 3GNNA 4HZ7A 1OFAA 3A4XA 3HQPA 5XIAA 1SPQA 3TQPA 4AIUA 4DXVA 2WCSA 3LI1A 3GXPA 2XM1A 4LAKA 3VCNA 3P82A 4QBXA 4F40A 3K8LA 2G3JA 1UR8A 2HXUA 2WVSA 4WY0A 3FYPA 5C7VA 4YCPA 5HPCA 4ZFCA 2QCHA 4JTHA 1RBLA 4XIAA 4K8HA 1QR7A 2BSLA 1VFLA 2FTWA 1SZEA 2B7QA 1B4EA 3FAXA 3B8WA 3W2NA 1W5QA 3J7HA 2XVKA 3PUGA 4RW5A 1WNOA 1UCWA 1XIGA 3ALGA 3GU2A 4YU1A 4B4HA 1OD8A 4ICCX 1MMFA 4S3EA 3NDYA 2C1HA 4UWMA 3EA3A 4UFJA 2VFEA 4PMDA 4DXKA 3SUUA 4JQAA 2QJGA 4KT2A 2POZA 4TX9A 3VCRA 3W7LA 4L6HA 1YTEA 1S3TC 4UB9A 1B5TA 3THQA 1KCXA 1VCVA 1ZJBA 1QPKA 3UPBA 1TX0A 3HU7A 3VKDA 3W70A 1JCXA 3UWEA 3W1NA 1HL2A 1EZ2A 5A8PA 5C2XA 5E0FA 4D6HA 1C8XA 1EJTC 3PZ9A 3VYLA 1REQB 3NQMA 4M56A 1XCFA 3M1ZA 4V2XA 1XGZA 1AMYA 5ABTA 3H24A 4BI6A 4IMEA 3HA1A 3CQ0A 1ITXA 4IZGA 3M0IA 1ZPTA 5K3VA 3A12A 4UQEA 4R7JA 1E6NA 2OYLA 1FDJA 3WD4A 1JDEA 2V82A 4AF0A 2RDTA 3GNXA 3NM1A 2G3IA 3SRHA 1ZGDA 3TVAA 4ACYA 1K70A 1LBLA 3C2FA 2WSQA 3GFZA 1KNWA 1TTIA 3TC7A 1XM3A 1XXXA 2IKHA 1ZLPA 2UY3A 3W53A 4PL2A 1JPMA 4E8CA 2JE8A 1M01A 1EF3A 3KBNA 2DORA 3RLGA 2YBTA 1ZFJA 1W9VA 4H6KA 3VGBA 1XYLA 1Z3NA 2FVKA 2XVNA 4QDWA 3T81A 2DZSA 5HAOA 4P8VA 3EXTA 2ZDSA 1UZ1A 4O54A 4PBFA 2WJEA 1NOUA 1OT1A 5EKYA 3TQKA 4RNHA 4XZ9A 1U33A 3TH6A 3T0DA 4IX0A 4LJ3A 3MMUA 1OIMA 3S83A 3H4WA 2ON3A 4NYUA 2XIMA 1KKRA 3WD0A 4X0NA 7TAAA 3QQ0A 2ISSA 1AJ0A 2IQ0A 4O1EA 5C54A 1Q6RA 3B03A 1BKHA 1JXJA 1EWEA 2R82A 3WG6A 3ARTA 2F8QA 3IJ9A 1TPB1 3LRKA 3NPVA 4ENLA 4UIOA 1MEIA 2J13A 3HB9A 4TMCA 4DJEA 1XLBA 1IEIA 2V2CA 2PODA 2OSWA 4NVTA 1DIDA 3WLJA 3SRKA 3FEMA 3NZGA 1Z48A 9XIMA 2Z25A 4ML9A 4PULA 2PDBA 4HP5A 4HNVA 2XFYA 3W7JA 3L9CA 3E49A 4QLLA 4FP1A 1H2JA 2Y6ZA 1KFCA 4PCTA 1MEWA 2I5QA 1JDCA 5CZTA 2PDCA 1TIWA 1BF6A 2FGZA 4MNLA 2PDFA 4AD3A 5DF0A 3EOUA 7TIMA 4L9YA 4REQB 1QPRA 2A7NA 3E38A 3IJ8A 1A5AA 1P7TB 3NVDA 1HKWA 2XTKA 1UHVA 2P3ZA 4NXSA 3OLDA 9CGTA 3CMFA 1UYQA 3WMLA 3WF1A 1FXQA 2W9MA 3EOLA 3UG5A 4DO6A 4I9AA 3YPIA 2YCEA 3NPWA 4I8DA 1RALA 2VRJA 2D22A 3KOXA 3FOKA 2AAMA 3D6NA 3IRSA 3MT1A 4OBRA 1P6WA 3PHAA 2XIJA 4PH6A 2WJDA 3BARA 3GS6A 4ZL1A 3NNTA 3VZXA 5CGQA 1W32A 5H6HA 3PR2A 3RIKA 2QGYA 4W84A 4S3DA 4AZCA 1J93A 2BXYA 2WNNA 1O5KA 3TYUA 1QI2A 4Y6GA 1MNSA 1QXLA 4LVBA 1UKSA 2QCLA 3IAQA 4HQVA 3PBYA 5D9NA 4O1CA 1Q2RA 1EGVA 3H22A 3ANUA 3NQFA 4BHYA 1TPC1 3BQ6A 1X8CA 3OIXA 3UW6A 4Y8FA 3N2MA 1AD1A 1U1JA 3OU8A 1QI3A 4JKKA 3SGUA 2TPSA 1VAHA 3H4GA 3CV1A 1C7SA 1HN1A 4CNSA 1R3WA 4FNPA 2WHLA 1U5VA 2DZPA 3E2QA 4PMVA 4E8GA 2VL4A 3WQVA 6CGTA 3DHFA 2CLMA 4CCEA 1AW1A 1XLLA 2XH2A 3G24A 2PGFA 2VGFA 5FJRA 4N02A 2IS7A 2WV8A 3SDOA 4AEFA 3RGTA 2ANUA 3WEOA 3PNUA 2EPKX 3URQA 3R7MA 1GWJA 3TDFA 3W84A 5LNVA 3PG8A 3UR5A 5LKYA 1SU5A 3TN6A 1ADDA 1GKRA 4W7VA 1LT7A 3TN3A 4FF7A 1OCNA 3TEVA 3EOEA 1WKDA 4E3TA 4G2DA 2QT3A 2R9RA 4GINA 2VR5A 4ZB2A 1FBAA 1TPDA 3STCA 1C9WA 3ARPA 5CEWA 2YX0A 2W67A 5HNNA 4BWLA 3H2AA 5CZ0A 1MSSA 4HN8A 4KFNA 3LY0A 3TYZA 1Q45A 3PJWA 1UP2A 5JBEA 1XV8A 4OZOA 1OBAA 5E6ZA 1BWVA 2BDQA 4LAMA 1FVPA 1B1YA 3TZNA 1I0BA 3MTWA 1B30A 4ZSUA 2NV1A 2R91A 3F4WA 1RH9A 2WBGA 4MIMA 2XIOA 2INZA 1JAKA 3W7IA 3DN5A 2YL9A 3RPMA 2PDIA 4KRTA 4GXPA 1L6YA 3NA8A 1MUMA 5D2VA 3PWAA 3BOFA 5CZKA 5G5IA 1FH9A 1TPH1 1OJXA 1DXEA 4IL2A 3KOZA 3CU2A 3N11A 4JEQA 1CGUA 3GHRA 4K3ZA 4DZHA 4RE2A 3OHIA 3CHCA 2ZFAA 4C6CA 1R9YA 5I2UA 2BG5A 1W31A 1XX1A 4MB5A 4H9ZA 3VNMA 4J3VA 3BH4A 2XYLA 3C4UA 2JKPA 1ECQA 5C55A 4YTRA 5BRQA 4GXMA 2F2KA 1E3ZA 2QUVA 3TTQA 1RY0A 2GVLA 1UWRA 1EA0A 1YNQA 4XIMA 4RZBA 3BJSA 3CAVA 3CQJA 4QXIA 5HJXA 2VO5A 1UD3A 3C2VA 2I9UA 2XGBA 1Z8AA 4ZOBA 3TWBA 3DI1A 3WQ5A 3RCMA 1IXOA 3QZEA 2DSUA 4CNTA 5D2WA 4NZ5A 4AB4A 2VEPA 8TIMA 2VTFA 4HNUA 4Z1BA 5E09A 3WNMA 4M19A 5LNRA 2PLJA 2BVDA 3B9OA 3HBLA 2PC4A 1Y5XA 2Z1VA 3KCJA 1F4AA 4AZ5A 4LUSA 5MF5A 4LNCA 1EEXA 4LYPA 5E93A 2OWCA 2YDSA 3HQNA 4O18A 1UH2A 1K03A 3G1AA 2A21A 2ZZ7A 2ZRVA 2OSYA 1SW3A 1VBGA 3UWVA 4A3UA 3PPHA 3V0TA 4DZIA 1ML1A 1XDLA 3GH4A 1I75A 5AC6A 4H9XA 1L6SA 3SR7A 1E6RA 2ATSA 2ACQA 1L9WA 1Z44A 3ME3A 3MKVA 1HVQA 2OG9A 2QIWA 5DLCA 2YDRA 3EWWA 4FR6A 4UFHA 4HNOA 2X2GA 1QW9A 4O0QA 1ZU8A 3C86A 5A8QA 4ADSA 1UMYA 2IPWA 3SB0A 3F7JA 3DC8A 3INPA 1GKPA 4K37A 1AZ2A 1R85A 3WQFA 1YIXA 4MB1A 2HK1A 2AQWA 4I5RA 1GZJA 1ZCOA 4BF5A 2QUTA 2WZTA 2P50A 1S2VA 2Q8LA 1GT8A 3CZLA 4ZQOA 2DDXA 2I17A 3SCUA 4J2PA 1H5YA 3ZIZA 4QE1A 2E5BA 1B9BA 4X2RA 2PWEA 3T9PA 4UQAA 3LHWA 4GRSA 4D1IA 4PMZA 4GISA 2ZZ5A 1PKNA 2HJPA 3QGAC 4A8RA 4QEHA 4KW2A 3PC0A 4H9VA 2Y63A 4QDPA 3RAOA 3TTYA 3ZO9A 5A6JA 3GH7A 1H1NA 2FMOA 2QF8A 2ODOA 2XSXA 3BMWA 4PYSA 4L64A 2NXHA 1OFDA 3ZR6A 4IWWA 3UZJA 1A0DA 1KBBA 1HJQA 1JD7A 3VD9A 4JNYA 4L1WA 5DN1A 1R2TA 1A4LA 4UOZA 1CENA 2UWFA 1W1A1 4LT9A 3UY7A 1SFLA 4NRRA 1W8SA 5J8LA 4AZ7A 1V6UA 3FXYA 1W1TA 1K8XA 4D6IA 4DQWA 5XIMA 5G2HA 3S5NA 3ZZ1A 3PJTA 3MUXA 4ZMGA 1SFSA 4HU0A 5KTLA 1CXHA 3A24A 2PP1A 4E6MA 1UUOA 4DAFA 1W3IA 3SN0A 3VKCA 2EQDA 1Q6DA 5BRPA 3ZLHA 2D3NA 3REQB 4FLRA 2IUZA 3JS3A 4NZFA 4FNTA 2XISA 4NJGA 4U10A 4QG6A 4HA4A 1R3VA 1K77A 3S6TA 1HJVA 3GFYA 1XDMA 4IMDA 5G2IA 3ZM8A 2Y8UA 3IUIA 4PGLA 2R8WA 3MI3A 2HNHA 4R34A 1AVAA 1WA3A 2BASA 3IJIA 2ZUTA 5C8BB 1DIOA 4PCNA 4C6OA 2DV0A 3LCFA 2F6UA 3IRDA 2BMBA 3ZR4A 3UZ5A 2YL8A 3TC3A 4GH3A 3UJ2A 2GGHA 3GR8A 4GKLA 5AYZA 1W1IE 3GG8A 4H83A 4GQRA 3QY8A 3HO8A 4EK7A 2XWEA 3FHAA 4BZYA 2AGTA 1VIWA 4F2TA 1FP8A 3WIJA 4DELA 3BLEA 2IQDA 4RK8A 4XTIA 2XU2A 3M6DA 1RK6A 1D8WA 4RV8A 4CVWA 1EJSC 3N4EA 4J3SA 4B92A 3V3WA 2E5DA 2XG9A 2QZRA 4Y9NA 1J96A 2CZFA 1HKKA 1QHOA 3OTRA 4TUFA 5A5WA 3T2QA 4Q6XA 3WQPA 2Y70A 4UTHA 3KS5A 2JKEA 4KEMA 3SCPA 3OHMB 3VUSA 4EXAA 5HXMA 1V0KA 3W9ZA 2J8TA 3GC4A 3K4WA 3S6DA 2DUZA 2R14A 3VINA 3GG1A 2HCVA 3BOLA 4EPBC 1VS1A 2W63A 3KTSA 4P61A 1QK0A 1N82A 4GACA 4X60A 3QXBA 3CUIA 1SO3A 3MCOA 5XINA 4AHOA 3R13A 5BNKA 1M53A 3IAPA 4W8BA 2GQ3A 1Q3NA 1QPNA 1JZ6A 1XI3A 4LRTA 1E0VA 1ZB5A 2RH9A 3RITA 3GO2A 4XAGA 2E8ZA 4ZTXA 1T6MA 1T7LA 3PZGA 4CGTA 1M7XA 5J5RA 2ZADA 4Q4KA 7ENLA 1UWUA 4U33A 3DYMA 3DHPA 3O63A 1IT0A 4UNLA 3CT2A 3P74A 1Z6KA 1KLZA 2WQDA 3UP8A 3CK5A 4WY0F 4O12A 4EPEC 2E1DA 3N4FA 1HO1A 1GW1A 1XINA 1MW1A 4O16A 2NUYA 2E6AA 2WSYA 4DUOA 3R79A 2YCIX 5FJUA 1SUXA 2BY1A 4HNLA 3TYBA 2PDNA 5HJYA 3NJ3A 3TJLA 3HMCA 3HJZA 4LF2A 4ACZB 3POCA 2W79A 1V02A 3BSGA 3PJUA 3N9RA 4XSMA 2P10A 2VRKA 1R30A 4YN5A 3ZR5A 3EOOA 2Q71A 4NAEA 2PF8A 1IEXA 3O16A 4LTSA 5AC7A 3SN1A 4D6JA 2VX6A 1VC4A 3IJ7A 2CERA 2IMRA 4WD0A 4OU1A 4GH1A 3WDQA 3C0LA 4NJIA 4Z17A 5DXXA 4FB7A 3TMLA 2XN0A 4WJEA 5GNZA 3CEUA 3U2EA 3ABSA 4I90A 3DBNA 1IZJA 1V6YA 4AZIA 1U5HA 2GSJA 4UTLA 1Y65A 1I0DA 2OU4A 3MUY1 3OVQA 5K4ZA 3MHFA 1KGUA 3P0WA 2Z6IA 2RGMA 5HNUA 4JIQA 3BC9A 1CECA 4MM1A 3UJRA 3LHVA 3WLLA 1QNQA 1ZL1A 1Q6OA 3EWZA 3SN4A 1AUSL 4N7QA 1I60A 3T0BA 1XG3A 3CYJA 5LA2A 2E9LA 3W01A 3LGDA 2IXVA 1D7FA 3HPXA 3UNTA 1V3HA 5AYXA 3GTXA 4HYRA 3IIPA 1HUVA 4UQDA 3W7MA 4MZ8A 4DXXA 2BHZA 3HG3A 2WK2A 2PFHA 4RPQA 3B8IA 2OT0A 4DBUA 4RE3A 2OLAA 1LL4A 5A1AA 5C9WA 3BCDA 2ZXQA 3ARZA 3NFUA 2QUUA 4F2BA 3DEQA 4JYFA 3N12A 5AC5A 5GQBA 4IXHA 2VFFA 3GKAA 2E6FA 4Q22A 1VFOA 1WKYA 3UYIA 1QI4A 9XIAA 1UIPA 2JGQA 5LA0A 1MQPA 4DRSA 1JF5A 1GJUA 3ARXA 3S9ZA 4EP8C 3DI0A 1XLCA 3LD5A 5EY5A 4GKTA 3SY8A 4INFA 4H2CA 3LQGA 2CLPA 2GVYA 1BFNA 1RPKA 1W1VA 1TWIA 5FF2A 5BOEA 3PTMA 1EJWC 3L68A 3ZFHA 1W3HA 1NTHA 1XYCA 3WLRA 4RZ4A 5HANA 3OW1A 1KQZA 4GOAA 3E1F1 4P8XA 2J74A 2J7CA 2NUWA 1C7TA 2X0HA 1EJVC 4V15A 6TIMA 1PKMA 1KFBA 4QAWA 3WFZA 1XIIA 2PDUA 4UTTA 1ALDA 4JX4A 2HXTA 4ZO8A 3LA4A 2VX4A 2FGBA 3MSRA 3NL5A 4FAMA 5I00A 2NT1A 5EMUA 3NZQA 5AHIA 1RD5A 4CVUA 2EEXA 1TMHA 1LRQA 1ZBVA 1HP5A 2Z29A 1AL8A 3NAVA 3TTOA 2B7OA 1JJKA 1UD2A 3ZVIA 3I65A 1IYXA 3ZSSA 4PEKA 4XX6A 3VD7A 3N29A 4HT3A 2PDMA 1ISXA 1Q2SA 1N8WA 3EXRA 6TAAA 5BZAA 1V0LA 5E9XA 4U5IA 2CHRA 4WUIA 1KFJA 4N9CA 4Y90A 1SO5A 3P8IA 3PTQA 4Y9AA 3PBUA 3S1WA 2F6KA 4V28A 1X6LA 1ZBKA 2BLEA 4DHGA 3MV01 3KDOA 4GNVA 4M3PA 2QCDB 1YDYA 2O55A 3GIPA 4HPHA 1R6WA 4WCJA 2QQ6A 1DTNA 3NQBA 4AFYA 2CYGA 2J24A 3ALFA 2YSWA 2QCNA 3MUCA 5C9XA 4GWEA 4KWVA 1QT1A 2FH8A 3FJNA 3A5FA 3VD3A 2QDHA 2MUCA 3SUVA 1DWIM 2DH3A 1POJA 3NOYA 4AQLA 1P5BA 3QC0A 3CNYA 1ITQA 1Q6EA 3VUPA 3W24A 4O11A 1I2PA 3NDOA 1YBQB 3SCSA 3AJXA 4L65A 1FWEC 1S2AA 1JZ3A 4HMDA 1UWIA 2Y7EA 3VCCA 4AH7A 3ITTA 4UXDA 1UQYA 1XS2A 4ZQCA 1XBXA 3HG5A 2RDXA 3APGA 3NOEA 1BEUA 2Y8KA 3M5ZA 2CHNA 1SO6A 1G5AA 3WL1A 5F2GA 4GQ0A 1F07A 1BYDA 3VFCA 1BLIA 3LHTA 1JZ5A 2TAAA 2QPXA 2ZYFA 4JDYA 2V67A 1G0CA 3A47A 1E40A 4BR1A 3KP1A 3LXCA 1HIZA 2JIEA 2YFOA 4ADUA 4M80A 2G4JA 3CC1A 4KPLA 3VE9A 4DWSB 1AA1B 3OA5A 3M5VA 3UZXA 1GOWA 4W8AA 1BF2A 3EB3A 4PODA 2GUYA 2YA1A 2JF7A 1GJWA 3H7VA 3WNKA 2H90A 5JH1A 3QMSA 3AMKA 4C6PA 4NNCA 1QBBA 2XH4A 3TAOA 1JDDA 1EL3A 2EKGA 4WJ8A 1BQCA 4MWAB 4UFLA 4IGSA 5C9ZA 1MUCA 1WUEA 5CLTA 3SZ8A 1V3JA 4ASTA 4KESA 5C9RA 3HJEA 3BLIA 1H5VA 1XKJA 1IXQA 3P0XA 3R10A 2V3EA 4QGCA 5CPOA 2BNJA 3H4XA 2ZUNA 1B3YA 3RILA 1GHSA 5E9AA 3P2VA 2VZUA 3C0SA 1PX4A 1ZJAA 4PTWA 3SM0A 3E2VA 1ADOA 3B0YA 4JY8A 2WPBA 2NV9A 4Z08A 2I5IA 2QV5A 3BG9A 3URNA 1DIEA 4LAUA 2UV8G 2QUMA 4V27A 4WVXA 3ARWA 2INEA 4ZO9A 2ZQ0A 3MANA 1LWIA 2DQXA 2FDMA 1KM6A 4H4IA 5G4EA 2J62A 5BRBA 3FEQA 3MV11 1GQIA 3AUJA 4Y7EA 1VBJA 3DAQA 4RUBA 3NEHA 2IPJA 2HBVA 3M0JA 1O60A 4CQBA 1W9BM 4HIBA 4GUFA 2CBJA 4F0RA 3WD2A 4C6LA 4P7NA 3MYPA 4CEUC 3ARSA 5A3HA 1TYGA 5EFFA 4C1LA 4CD7A 5JUVA 4GJ1A 1EYEA 4D6CA 2PPGA 3CMJA 1DJXA 1IWAA 3TQ0A 5I5RA 4R9XA 1W91A 3UGRA 4CD8A 4M6PA 3HFYA 1RZMA 7A3HA 2DT0A 2ESCA 3E2RA 4DX3A 1HVXA 1Q6FA 1VPXA 2ZUMA 3RLHA 4GPNA 3QVQA 1KQYA 1LL7A 4JTJA 2QCMA 3ARVA 4E4FA 4TXEA 4WR3A 3F4NA 2G95A 3IVTA 3AYVA 4UR7A 3W73A 4UNKA 1ICSA 3RRXA 3L67A 2C14A 3FJLA 1FHVA 3GTIA 4MWAA 2CFFA 1EUNA 2C16A 2WNWA 2NXIA 4POCA 3SIMA 4GVIA 5DRIA 1HG3A 4H7CA 3NDZA 1PE1A 1TA3A 3FYYA 2VD9A 3KVMA 1REQA 1BGGA 3ZOAA 3HFTA 1EWDA 3WH5A 4LUIA 2Y7GA 3P93A 4CD6A 5B80A 5FF7A 3SIZA 3P84A 1E71M 4GQBA 4EANA 5EYWA 4ICMA 1PJ9A 1LWJA 3GIQA 3N14A 2A3HA 4XAYA 1UD5A 3MMTA 1YKWA 2R1MA 1TE1A 4LAOA 1A5BA 1VB9A 3GXTA 4QDMA 3AO0A 1IZKA 5TD4A 4NIRA 3NZ1A 2AQVA 5D8WA 3ZT7A 1UJPA 3FVDA 4H1ZA 1E5NA 4R85A 5HA7A 3PB2A 4DJDC 2GFTA 4NJKA 4Z2JA 2X1IA 4NF7A 4GI6A 2D24A 4ATWA 3T2PA 2QEZA 5A6MA 4KS0A 3DZ1A 3G1DA 1BWLA 5AB3A 1JUKA 4AD2A 1F7BA 3VD5A 4PC8A 4LUSB 4M5PA 3GXNA 3H2MA 1LROA 4F3HA 4B5XA 3U9IA 3A9IA 4M51A 4NILA 5DMNA 1AD4A 3TJIA 4YWSA 4F9DA 4M82A 1UUQA 3SUSA 4I6KA 1H51A 2J75A 2C0AA 5U7SA 5F4SA 1O1ZA 1EKOA 4Q7NA 1KBIA 5DT5A 1I2RA 4A35A 5DO8A 3CO4A 1VPYA 1WCGA 1E6QM 2V81A 4NY2A 2DVUA 5FA5A 5AECA 4W9TA 1KTBA 3OQ8A 4TV5A 4D6EA 3EDFA 3RU8X 4H6RA 3H8AA 1WE5A 4O8RA 1R9XA 3UPMA 3M47A 1E6XM 1F6PA 4URIA 5HMSA 3S4TA 4ATLA 1I9CB 1CXLA 3U2ZA 1JQVA 4LNYA 1XR2A 3USZA 1J79A 3W7OA 4BQ5A 3CZJA 1DXFA