4OW4A

Beta-trefoil designed by folding nucleus symmetric expansion ("phifoil")
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
123
structure length
123
Chain Sequence
HEVYIKSTETGQYLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLRILPDGTVDGTRDRSDQHIQLQLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-terfoil designed by folding nucleus symmetric expansion
publication title Evolution and design of protein structure by folding nucleus symmetric expansion.
pubmed doi rcsb
source organism Synthetic construct
molecule tags De novo protein
total genus 31
structure length 123
sequence length 123
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-01-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 4ow4A00
3PHZA 1G9DA 2F2FA 1TWEA 4D0ZA 5BVPI 2J3PA 4J2KA 3BX1C 3OJMA 3VEQA 4I37A 2GZBA 4I2SA 1W3AA 3MPPG 4J2YA 1QXMA 3Q7XA 1S0BA 3V0BA 3BA5A 5FZZA 4QBVA 4I96A 1WD4A 1HKNA 1IOBA 4LO3A 3AKHA 2D1ZA 2D7IA 3FJAA 3CRGA 4IYBA 41BIA 4OUJA 4OWKA 4ZLBB 2Q3NB 4G6JA 4L4IA 3FJDA 3N7JA 1WD3A 1JLYA 1PWAA 4IZXA 3UJ4A 1XYFA 2NP0A 2Y9GA 4I4SA 4OWJA 3KMVA 2RQ9A 3JRRA 4XFSA 4JP0A 3FJKA 4IY9A 4KEIA 2BEBA 1CE7B 5F90A 4H04A 1SR4A 4ZKTB 1HWMB 2DRYA 3OJVA 3BAQA 21BIA 1IT0A 4LO0A 4OEEA 4A7ZA 4TLPA 4QD2B 3P6JA 4OEFA 3N7LA 3CA1A 1EVTA 1V6VA 2HWAA 2BEAA 1IRPA 1G82A 1HWNB 3V0AB 2LIEA 1EPWA 3BAVA 3AZWA 2KH2A 1BFCA 4ENDA 5BXRA 2FFVA 4II0A 2Y9FA 4XFTA 3BRFA 1DJSB 1JT4A 4Q9PA 4GAIA 4EEEB 5BQUA 1V6XA 4I4UA 3A07A 4ISQA 4WBCA 4GOVA 1YTOA 3QYDA 2D43A 4ZA3B 3CA5A 4EFPA 4F83A 4X37A 2AFGA 4I4XA 2FO1A 4CJMA 3O5WB 3NBNA 3RTIB 5HPZA 2R9KB 3RMYA 1ISVA 1S0CA 4P0KA 1ISXA 4JAWA 4I4PA 1BLAA 3HBWA 5F8WA 4USOA 2X2TA 2VSEA 4I4QA 1TWMA 4X3AA 3VWCA 3PMEA 2HZ9A 3CQAA 3IM5A 4PC4A 4HJJA 4ZBVB 1TIEA 4EFRA 5BOWA 3WMVA 3K1XA 3CRIA 3VT0A 5DUYA 1DFQA 4IHZA 1FGAA 2AQZA 3POKA 2M49A 4P0JA 3FJIA 4DEPA 2HWMA 1G9BA 3CAHA 3NBEA 1EV2A 1FMZA 3CA0A 3WINA 1J0SA 1BFFA 1JT3A 1WBCA 3H6RA 4DENA 3O4CA 1JLXA 4X39A 7I1BA 3UD7A 1BA7A 4USPA 2MLLB 3HSMA 3ZXDA 2E4MA 3IAGC 2FFUA 3FUQA 2HW9A 3NJ5A 3TC2A 5BP5A 2K4AB 4I4OA 1OQLB 4Q9GA 1HWPB 4FVVA 1I1EA 6I1BA 1R8OA 4QALA 3WO4A 4YOLA 4F34A 2X2SA 2VUAA 2I1BA 2NVHA 3N0KA 4HA2A 2FDBM 3I29B 3F1RA 4G1RA 4QKRA 4KC3A 3O44A 4QC4A 1AFCA 4Z9WB 1M2TB 4AN6A 1FWUA 4Z8SB 3V79C 1AF9A 4EFQA 1V6WA 1M16A 4ZFYB 1FMMS 4OWLA 1PZZA 4ZFWB 1EYLA 4X38A 2D23A 5G00A 1ISWA 4I7IA 4LO7C 1KNMA 3CU1B 1FWVA 1Z0HA 1DIWA 2QYIB 3FJBA 3BA4A 3IM6A 3AH1A 1IHKA 4ISRA 1ILR1 3O3QA 1JT7A 4LO1C 1Z4SA 4QBCA 4ZGRB 3BAUA 3FJFA 1L2HA 4GAFA 4LO2C 4ZFUB 4GOYA 3Q7WA 2AXMA 1YF8B 3ZC9A 3CRHA 2D24A 2RSTA 1Z2VA 1ITBA 1FQ9A 3N7KA 2YUGA 1N4KA 3VT1A 4LO8B 3WO2A 2F8XC 3OJ2A 1A8DA 2WBCA 5DSSB 3VSFA 4AN7B 3AJ6A 3S8JA 3RSJA 2NM1A 3A22A 4XKIA 3PG0A 3BTAA 3I2AA 3FFZA 3N7MA 1W3GA 2AAIB 2KKIA 3MALA 3P6IA 1WBAA 1S0FA 5BQUC 3V0BB 3BRGC 4I3NA 1S0LA 1IRAX 1JY0A 2ZR1B 3EF2A 4JKXB 1XG6A 2VXRA 4GP3A 4JKQA 4EKXB 1HCDA 1K5VA 31BIA 3OBTA 4G9NA 1E0OA 4I4VA 2DS0A 4G6MA 1JQZA 1IILA 4KBBA 3LTQA 1AXMA 3ZX7A 5I1BA 1DQGA 3F62B 1G9CA 3FJ9A 4JPZA 1AVAC 1RG8A 3BAOA 3BAGA 5JLVA 3O4BA 2KI6B 5F8YA 3FGMA 5GAQA 5D62A 4LO7B 4H9WA 1DZCA 5FNXA 3O4OA 5FZUA 3UDAA 2BFHA 1PUMB 1K5UA 3WMUA 3O4DA 4XFUA 4QO3A 3OGFA 1FV2A 1VCLA 3A21A 3FJ8A 2NZ9A 5BXTA 4R6UB 1T9FA 2LIQA 4ZOTA 3ZXGA 4J23B 4I0YA 1FV3A 3WO3A 1BFGA 4G9MA 3VSZA 1V6UA 1HWOB 3WINC 3R4SA 2VLCA 4I1BA 5D63A 1W3FA 3HN1A 3H6SE 3I2XA 4JQ0A 1AVXB 4KEJA 3AJ5A 4J2XA 2F2FC 3E8LC 1FN0A 2ZQNA 5DZUA 5BP5C 3W9TA 1JTCA 1QQLA 2FGFA 3UD9A 3WA1A 2Z49A 1II4A 4IONA 3V0AA 1YXWA 1TTUA 5EHAA 1Q04A 1RMLA 4LO3C 1S0GA 1S0DA 5B2HA 4D8HA 2DREA 3BAHA 4J2SA 2KI4A 1BFBA 2NYYA 2VXTI 8I1BA 2MC2A 1ONKB 1AVWB 1ISZA 1S0EA 1DLLA 2ET2A 3P53A 3HMYA 1NUNA 3JUTA 3BADA 3BRDA 4A7KA 3AKIA 1MC9A 1YBIA 3CA6A 1SR4C 3O49A 3VUOA 1XHBA 4L4HA 2ERMA 5F8SA 3T8SA 4LO0C 1T4QA 3IIRA 1PC8B 3B9UA 4I8MA 2GO2A 1AVUA 3H6RB 3HALA 3AH2A 3UD8A 4IY8A 1SZ6B 2IWTB 4OW4A 3AKGA 2QN4A 2Y9XE 4A7YA 5FNWA 3CA4A 4FGFA 4DCKC 5JMCA 1IJTA 1ABRB 4LO1A 2K8RA 4Q91A 1XZZA 1YYNA 1TP0A 3Q7YA 1QQKA 4LO2A 5BXPA 3PUBA 2ESUA 1P63A 1HIBA 4I6IA 1PUUB 2D20A 2K43A 3NBCA 3ZC8A 3H6QA 1BLDA 1RY7A 2P23A 3FUOA 1UPSA 3LLPA 3D7WB 2P39A 3S8KA 3BA7A 2RG9B 2IHOA 4P6AA 1Q03A 4I4RA 1ISYA 4KEKA 5E24E 3FJCA 1CVSA 3AH4A 2KLLA 1GGPB 4OEGA 4D0TA 5EG6C 4IZEA 3RTJB 1DQOA 1I1BA 3FJJA 2MIBA 1HCEA 2D44A 2Z48A 2WRYA 1D0HA 3O4AA 1Q1UA 2D7RA 4QKSA 3QR5A 1BARA 2Y9WC 3A23A 4IQPA 2XOAA 1R8NA 2L5XA 3AKFA 3C9ZA 4P0LA 4I1EA 3R4UA 1MD6A 3SNVA 3AZVA 1NZKA 3OBRA 3VT2A 2VSAA 2UUSA 1JT5A 2DRZA 4I4YA 1DFCA 3NBDA 1G9AA 1RZOB 3CA3A 3IM7A 2NTDA 2ZQOA 4EB2B 3UJ0A 1TFMB 3BB2A 5DVHA 3RMXA 1F31A 4GP0A 4HR6C 5FZYA 3FJHA 4JRAA 2E4MC 5D61A 2Q9XA 2VU9A 4QD2C 1TOOA 1DZDA 5BXSA 3OGGA 2D22A 9ILBA 3HOMA 5EC5A 1BASA 3FJEA 3ILAA
chains in the Genus database with same CATH superfamily
3PHZA 1G9DA 2F2FA 1TWEA 4D0ZA 5BVPI 2J3PA 4J2KA 3BX1C 3OJMA 3VEQA 4I37A 2GZBA 4I2SA 1W3AA 3MPPG 4J2YA 1QXMA 3Q7XA 1S0BA 3V0BA 3BA5A 5FZZA 4QBVA 4I96A 4UY4A 1WD4A 1HKNA 1IOBA 4LO3A 3AKHA 2D1ZA 2D7IA 3FJAA 3CRGA 4IYBA 41BIA 4OUJA 4OWKA 4ZLBB 2Q3NB 4G6JA 4L4IA 3FJDA 3N7JA 1WD3A 1JLYA 1PWAA 4IZXA 3UJ4A 1XYFA 2NP0A 2Y9GA 4I4SA 4OWJA 3KMVA 2RQ9A 3JRRA 4MZGB 4XFSA 4JP0A 3FJKA 4IY9A 4KEIA 2BEBA 1CE7B 5F90A 4H04A 1SR4A 4ZKTB 1HWMB 2DRYA 3OJVA 3BAQA 21BIA 1IT0A 4LO0A 4OEEA 4A7ZA 4TLPA 4QD2B 3P6JA 4OEFA 3N7LA 3CA1A 1EVTA 1V6VA 2HWAA 2BEAA 1IRPA 1G82A 1HWNB 3V0AB 2LIEA 1EPWA 3BAVA 3AZWA 2KH2A 1BFCA 4ENDA 5BXRA 2FFVA 4II0A 2Y9FA 4XFTA 3BRFA 1DJSB 1JT4A 4Q9PA 4GAIA 4EEEB 5BQUA 1V6XA 4I4UA 3A07A 4ISQA 4WBCA 4GOVA 1YTOA 3QYDA 2D43A 4ZA3B 3CA5A 4EFPA 4F83A 4X37A 2AFGA 4I4XA 2FO1A 4CJMA 3O5WB 3NBNA 3RTIB 5HPZA 2R9KB 3RMYA 1ISVA 1S0CA 4P0KA 1ISXA 4JAWA 4I4PA 1BLAA 3HBWA 5F8WA 4USOA 2X2TA 2VSEA 4I4QA 1TWMA 4X3AA 3VWCA 3PMEA 2HZ9A 3CQAA 3IM5A 4PC4A 4HJJA 4ZBVB 1TIEA 4EFRA 5BOWA 3WMVA 3K1XA 3CRIA 3VT0A 4MZFB 5DUYA 1DFQA 4IHZA 1FGAA 2AQZA 3POKA 2M49A 4P0JA 3FJIA 4DEPA 2HWMA 1G9BA 3CAHA 3NBEA 1EV2A 1FMZA 3CA0A 3WINA 1J0SA 1BFFA 1JT3A 1WBCA 3H6RA 4DENA 3O4CA 1JLXA 4X39A 7I1BA 3UD7A 1BA7A 4USPA 2MLLB 3HSMA 3ZXDA 2E4MA 3IAGC 2FFUA 3FUQA 2HW9A 3NJ5A 3TC2A 5BP5A 2K4AB 4I4OA 1OQLB 4Q9GA 1HWPB 4FVVA 1I1EA 6I1BA 1R8OA 4QALA 3WO4A 4YOLA 4F34A 2X2SA 2VUAA 2I1BA 2NVHA 3N0KA 4HA2A 2FDBM 3I29B 3F1RA 4G1RA 4QKRA 4KC3A 3O44A 4QC4A 1AFCA 4Z9WB 1M2TB 4AN6A 1FWUA 4Z8SB 3V79C 1AF9A 4EFQA 1V6WA 1M16A 4ZFYB 1FMMS 4OWLA 1PZZA 4ZFWB 1EYLA 4X38A 2D23A 5G00A 1ISWA 4I7IA 4LO7C 1KNMA 3CU1B 1FWVA 1Z0HA 1DIWA 2QYIB 3FJBA 3BA4A 3IM6A 3AH1A 1IHKA 4ISRA 1ILR1 3O3QA 1JT7A 4LO1C 1Z4SA 4QBCA 4ZGRB 3BAUA 3FJFA 1L2HA 4GAFA 4LO2C 4ZFUB 4GOYA 3Q7WA 2AXMA 1YF8B 3ZC9A 3CRHA 2D24A 2RSTA 1Z2VA 1ITBA 1FQ9A 3N7KA 2YUGA 1N4KA 3VT1A 4LO8B 3WO2A 2F8XC 3OJ2A 1A8DA 2WBCA 5DSSB 3VSFA 4AN7B 3AJ6A 3S8JA 3RSJA 2NM1A 3A22A 4XKIA 3PG0A 3BTAA 3I2AA 3FFZA 3N7MA 1W3GA 2AAIB 2KKIA 3MALA 3P6IA 1WBAA 1S0FA 5BQUC 3V0BB 3BRGC 4I3NA 4MZHA 1S0LA 1IRAX 1JY0A 2ZR1B 3EF2A 4JKXB 1XG6A 2VXRA 4GP3A 4JKQA 4EKXB 1HCDA 1K5VA 31BIA 3OBTA 4G9NA 1E0OA 4I4VA 2DS0A 4G6MA 1JQZA 1IILA 4KBBA 3LTQA 1AXMA 3ZX7A 5I1BA 1DQGA 3F62B 1G9CA 3FJ9A 4JPZA 1AVAC 1RG8A 3BAOA 3BAGA 5JLVA 3O4BA 2KI6B 5F8YA 3FGMA 5GAQA 5D62A 4LO7B 4H9WA 1DZCA 5FNXA 3O4OA 5FZUA 3UDAA 2BFHA 1PUMB 1K5UA 3WMUA 3O4DA 4XFUA 4QO3A 3OGFA 1FV2A 1VCLA 3A21A 3FJ8A 2NS2A 2NZ9A 5BXTA 4R6UB 1T9FA 2LIQA 4ZOTA 3ZXGA 4J23B 4I0YA 1FV3A 3WO3A 1BFGA 4G9MA 3VSZA 1V6UA 1HWOB 3WINC 3R4SA 2VLCA 4I1BA 5D63A 1W3FA 3HN1A 3H6SE 3I2XA 4JQ0A 1AVXB 4KEJA 3AJ5A 4J2XA 2F2FC 3E8LC 1FN0A 2ZQNA 5DZUA 5BP5C 3W9TA 1JTCA 1QQLA 2FGFA 3UD9A 3WA1A 2Z49A 1II4A 4IONA 3V0AA 1YXWA 1TTUA 5EHAA 1Q04A 1RMLA 4LO3C 1S0GA 1S0DA 5B2HA 4D8HA 2DREA 3BAHA 4J2SA 2KI4A 1BFBA 2NYYA 2VXTI 8I1BA 2MC2A 1ONKB 1AVWB 1ISZA 1S0EA 1DLLA 2ET2A 3P53A 3HMYA 1NUNA 3JUTA 3BADA 3BRDA 4A7KA 3AKIA 1MC9A 1YBIA 3CA6A 1SR4C 3O49A 3VUOA 1XHBA 4L4HA 2ERMA 5F8SA 3T8SA 4LO0C 1T4QA 3IIRA 1PC8B 3B9UA 4I8MA 2GO2A 1AVUA 3H6RB 3HALA 3AH2A 3UD8A 4IY8A 1SZ6B 2IWTB 4OW4A 3AKGA 2QN4A 2Y9XE 4A7YA 5FNWA 3CA4A 4FGFA 4DCKC 5JMCA 1IJTA 1ABRB 4LO1A 2K8RA 4Q91A 1XZZA 1YYNA 1TP0A 3Q7YA 1QQKA 4LO2A 5BXPA 3PUBA 2ESUA 1P63A 1HIBA 4I6IA 1PUUB 2D20A 2K43A 3NBCA 3ZC8A 3H6QA 1BLDA 1RY7A 2P23A 3FUOA 1UPSA 3LLPA 3D7WB 2P39A 3S8KA 3BA7A 2RG9B 2IHOA 4P6AA 1Q03A 4I4RA 1ISYA 4KEKA 5E24E 3FJCA 1CVSA 3AH4A 2KLLA 1GGPB 4OEGA 4D0TA 5EG6C 4IZEA 3RTJB 1DQOA 1I1BA 3FJJA 2MIBA 1HCEA 2D44A 2Z48A 2WRYA 1D0HA 3O4AA 1Q1UA 2D7RA 4QKSA 3QR5A 1BARA 2Y9WC 3A23A 4IQPA 2XOAA 1R8NA 2L5XA 3AKFA 3C9ZA 4P0LA 4I1EA 3R4UA 1MD6A 3SNVA 3AZVA 1NZKA 3OBRA 3VT2A 2VSAA 2UUSA 1JT5A 2DRZA 4I4YA 1DFCA 3NBDA 1G9AA 1RZOB 3CA3A 3IM7A 2NTDA 2ZQOA 4EB2B 3UJ0A 1TFMB 3BB2A 5DVHA 3RMXA 1F31A 4GP0A 4HR6C 5FZYA 4H75A 3FJHA 4JRAA 2E4MC 5D61A 2Q9XA 2VU9A 4QD2C 1TOOA 1DZDA 5BXSA 3OGGA 2D22A 9ILBA 3HOMA 5EC5A 1BASA 3FJEA 3ILAA
chains in the Genus database with same CATH topology
3PHZA 1G9DA 2F2FA 1TWEA 4D0ZA 5BVPI 2J3PA 4J2KA 3BX1C 3OJMA 3VEQA 4I37A 2GZBA 4I2SA 1W3AA 3MPPG 4J2YA 1QXMA 3Q7XA 1S0BA 3V0BA 3BA5A 5FZZA 4QBVA 4I96A 4UY4A 1WD4A 1HKNA 1IOBA 4LO3A 3AKHA 2D1ZA 2D7IA 3FJAA 3CRGA 4IYBA 41BIA 4OUJA 4OWKA 4ZLBB 2Q3NB 4G6JA 4L4IA 3FJDA 3N7JA 1WD3A 1JLYA 1PWAA 4IZXA 3UJ4A 1XYFA 2NP0A 2Y9GA 4I4SA 4OWJA 3KMVA 2RQ9A 3JRRA 4MZGB 4XFSA 4JP0A 3FJKA 4IY9A 4KEIA 2BEBA 1CE7B 5F90A 4H04A 1SR4A 4ZKTB 1HWMB 2DRYA 3OJVA 3BAQA 21BIA 1IT0A 4LO0A 4OEEA 4A7ZA 4TLPA 4QD2B 3P6JA 4OEFA 3N7LA 3CA1A 1EVTA 1V6VA 2HWAA 2BEAA 1IRPA 1G82A 1HWNB 3V0AB 2LIEA 1EPWA 3BAVA 3AZWA 2KH2A 1BFCA 4ENDA 5BXRA 2FFVA 4II0A 2Y9FA 4XFTA 3BRFA 1DJSB 1JT4A 4Q9PA 4GAIA 4EEEB 5BQUA 1V6XA 4I4UA 3A07A 4ISQA 4WBCA 4GOVA 1YTOA 3QYDA 2D43A 4ZA3B 3CA5A 4EFPA 4F83A 4X37A 2AFGA 4I4XA 2FO1A 4CJMA 3O5WB 3NBNA 3RTIB 5HPZA 2R9KB 3RMYA 1ISVA 1S0CA 4P0KA 1ISXA 4JAWA 4I4PA 1BLAA 3HBWA 5F8WA 4USOA 2X2TA 2VSEA 4I4QA 1TWMA 4X3AA 3VWCA 3PMEA 2HZ9A 3CQAA 3IM5A 4PC4A 4HJJA 4ZBVB 1TIEA 4EFRA 5BOWA 3WMVA 3K1XA 3CRIA 3VT0A 4MZFB 5DUYA 1DFQA 4IHZA 1FGAA 2AQZA 3POKA 2M49A 4P0JA 3FJIA 4DEPA 2HWMA 1G9BA 3CAHA 3NBEA 1EV2A 1FMZA 3CA0A 3WINA 1J0SA 1BFFA 1JT3A 1WBCA 3H6RA 4DENA 3O4CA 1JLXA 4X39A 7I1BA 3UD7A 1BA7A 4USPA 2MLLB 3HSMA 3ZXDA 2E4MA 3IAGC 2FFUA 3FUQA 2HW9A 3NJ5A 3TC2A 5BP5A 2K4AB 4I4OA 1OQLB 4Q9GA 1HWPB 4FVVA 1I1EA 6I1BA 1R8OA 4QALA 3WO4A 4YOLA 4F34A 2X2SA 2VUAA 2I1BA 2NVHA 3N0KA 4HA2A 2FDBM 3I29B 3F1RA 4G1RA 4QKRA 4KC3A 3O44A 4QC4A 1AFCA 4Z9WB 1M2TB 4AN6A 1FWUA 4Z8SB 3V79C 1AF9A 4EFQA 1V6WA 1M16A 4ZFYB 1FMMS 4OWLA 1PZZA 4ZFWB 1EYLA 4X38A 2D23A 5G00A 1ISWA 4I7IA 4LO7C 1KNMA 3CU1B 1FWVA 1Z0HA 1DIWA 2QYIB 3FJBA 3BA4A 3IM6A 3AH1A 1IHKA 4ISRA 1ILR1 3O3QA 1JT7A 4LO1C 1Z4SA 4QBCA 4ZGRB 3BAUA 3FJFA 1L2HA 4GAFA 4LO2C 4ZFUB 4GOYA 3Q7WA 2AXMA 1YF8B 3ZC9A 3CRHA 2D24A 2RSTA 1Z2VA 1ITBA 1FQ9A 3N7KA 2YUGA 1N4KA 3VT1A 4LO8B 3WO2A 2F8XC 3OJ2A 1A8DA 2WBCA 5DSSB 3VSFA 4AN7B 3AJ6A 3S8JA 3RSJA 2NM1A 3A22A 4XKIA 3PG0A 3BTAA 3I2AA 3FFZA 3N7MA 1W3GA 2AAIB 2KKIA 3MALA 3P6IA 1WBAA 1S0FA 5BQUC 3V0BB 3BRGC 4I3NA 4MZHA 1S0LA 1IRAX 1JY0A 2ZR1B 3EF2A 4JKXB 1XG6A 2VXRA 4GP3A 4JKQA 4EKXB 1HCDA 1K5VA 31BIA 3OBTA 4G9NA 1E0OA 4I4VA 2DS0A 4G6MA 1JQZA 1IILA 4KBBA 3LTQA 1AXMA 3ZX7A 5I1BA 1DQGA 3F62B 1G9CA 3FJ9A 4JPZA 1AVAC 1RG8A 3BAOA 3BAGA 5JLVA 3O4BA 2KI6B 5F8YA 3FGMA 5GAQA 5D62A 4LO7B 4H9WA 1DZCA 5FNXA 3O4OA 5FZUA 3UDAA 2BFHA 1PUMB 1K5UA 3WMUA 3O4DA 4XFUA 4QO3A 3OGFA 1FV2A 1VCLA 3A21A 3FJ8A 2NS2A 2NZ9A 5BXTA 4R6UB 1T9FA 2LIQA 4ZOTA 3ZXGA 4J23B 4I0YA 1FV3A 3WO3A 1BFGA 4G9MA 3VSZA 1V6UA 1HWOB 3WINC 3R4SA 2VLCA 4I1BA 5D63A 1W3FA 3HN1A 3H6SE 3I2XA 4JQ0A 1AVXB 4KEJA 3AJ5A 4J2XA 2F2FC 3E8LC 1FN0A 2ZQNA 5DZUA 5BP5C 3W9TA 1JTCA 1QQLA 2FGFA 3UD9A 3WA1A 2Z49A 1II4A 4IONA 3V0AA 1YXWA 1TTUA 5EHAA 1Q04A 1RMLA 4LO3C 1S0GA 1S0DA 5B2HA 4D8HA 2DREA 3BAHA 4J2SA 2KI4A 1BFBA 2NYYA 2VXTI 8I1BA 2MC2A 1ONKB 1AVWB 1ISZA 1S0EA 1DLLA 2ET2A 3P53A 3HMYA 1NUNA 3JUTA 3BADA 3BRDA 4A7KA 3AKIA 1MC9A 1YBIA 3CA6A 1SR4C 3O49A 3VUOA 1XHBA 4L4HA 2ERMA 5F8SA 3T8SA 4LO0C 1T4QA 3IIRA 1PC8B 3B9UA 4I8MA 2GO2A 1AVUA 3H6RB 3HALA 3AH2A 3UD8A 4IY8A 1SZ6B 2IWTB 4OW4A 3AKGA 2QN4A 2Y9XE 4A7YA 5FNWA 3CA4A 4FGFA 4DCKC 5JMCA 1IJTA 1ABRB 4LO1A 2K8RA 4Q91A 1XZZA 1YYNA 1TP0A 3Q7YA 1QQKA 4LO2A 5BXPA 3PUBA 2ESUA 1P63A 1HIBA 4I6IA 1PUUB 2D20A 2K43A 3NBCA 3ZC8A 3H6QA 1BLDA 1RY7A 2P23A 3FUOA 1UPSA 3LLPA 3D7WB 2P39A 3S8KA 3BA7A 2RG9B 2IHOA 4P6AA 1Q03A 4I4RA 1ISYA 4KEKA 5E24E 3FJCA 1CVSA 3AH4A 2KLLA 1GGPB 4OEGA 4D0TA 5EG6C 4IZEA 3RTJB 1DQOA 1I1BA 3FJJA 2MIBA 1HCEA 2D44A 2Z48A 2WRYA 1D0HA 3O4AA 1Q1UA 2D7RA 4QKSA 3QR5A 1BARA 2Y9WC 3A23A 4IQPA 2XOAA 1R8NA 2L5XA 3AKFA 3C9ZA 4P0LA 4I1EA 3R4UA 1MD6A 3SNVA 3AZVA 1NZKA 3OBRA 3VT2A 2VSAA 2UUSA 1JT5A 2DRZA 4I4YA 1DFCA 3NBDA 1G9AA 1RZOB 3CA3A 3IM7A 2NTDA 2ZQOA 4EB2B 3UJ0A 1TFMB 3BB2A 5DVHA 3RMXA 1F31A 4GP0A 4HR6C 5FZYA 4H75A 3FJHA 4JRAA 2E4MC 5D61A 2Q9XA 2VU9A 4QD2C 1TOOA 1DZDA 5BXSA 3OGGA 2D22A 9ILBA 3HOMA 5EC5A 1BASA 3FJEA 3ILAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PHZ A;  1G9D A;  2F2F A;  1TWE A;  4D0Z A;  5BVP I;  2J3P A;  4J2K A;  3BX1 C;  3OJM A;  3VEQ A;  4I37 A;  2GZB A;  4I2S A;  1W3A A;  3MPP G;  4J2Y A;  1QXM A;  3Q7X A;  1S0B A;  3V0B A;  3BA5 A;  5FZZ A;  4QBV A;  4I96 A;  1WD4 A;  1HKN A;  1IOB A;  4LO3 A;  3AKH A;  2D1Z A;  2D7I A;  3FJA A;  3CRG A;  4IYB A;  41BI A;  4OUJ A;  4OWK A;  4ZLB B;  2Q3N B;  4G6J A;  4L4I A;  3FJD A;  3N7J A;  1WD3 A;  1JLY A;  1PWA A;  4IZX A;  3UJ4 A;  1XYF A;  2NP0 A;  2Y9G A;  4I4S A;  4OWJ A;  3KMV A;  2RQ9 A;  3JRR A;  4XFS A;  4JP0 A;  3FJK A;  4IY9 A;  4KEI A;  2BEB A;  1CE7 B;  5F90 A;  4H04 A;  1SR4 A;  4ZKT B;  1HWM B;  2DRY A;  3OJV A;  3BAQ A;  21BI A;  1IT0 A;  4LO0 A;  4OEE A;  4A7Z A;  4TLP A;  4QD2 B;  3P6J A;  4OEF A;  3N7L A;  3CA1 A;  1EVT A;  1V6V A;  2HWA A;  2BEA A;  1IRP A;  1G82 A;  1HWN B;  3V0A B;  2LIE A;  1EPW A;  3BAV A;  3AZW A;  2KH2 A;  1BFC A;  4END A;  5BXR A;  2FFV A;  4II0 A;  2Y9F A;  4XFT A;  3BRF A;  1DJS B;  1JT4 A;  4Q9P A;  4GAI A;  4EEE B;  5BQU A;  1V6X A;  4I4U A;  3A07 A;  4ISQ A;  4WBC A;  4GOV A;  1YTO A;  3QYD A;  2D43 A;  4ZA3 B;  3CA5 A;  4EFP A;  4F83 A;  4X37 A;  2AFG A;  4I4X A;  2FO1 A;  4CJM A;  3O5W B;  3NBN A;  3RTI B;  5HPZ A;  2R9K B;  3RMY A;  1ISV A;  1S0C A;  4P0K A;  1ISX A;  4JAW A;  4I4P A;  1BLA A;  3HBW A;  5F8W A;  4USO A;  2X2T A;  2VSE A;  4I4Q A;  1TWM A;  4X3A A;  3VWC A;  3PME A;  2HZ9 A;  3CQA A;  3IM5 A;  4PC4 A;  4HJJ A;  4ZBV B;  1TIE A;  4EFR A;  5BOW A;  3WMV A;  3K1X A;  3CRI A;  3VT0 A;  5DUY A;  1DFQ A;  4IHZ A;  1FGA A;  2AQZ A;  3POK A;  2M49 A;  4P0J A;  3FJI A;  4DEP A;  2HWM A;  1G9B A;  3CAH A;  3NBE A;  1EV2 A;  1FMZ A;  3CA0 A;  3WIN A;  1J0S A;  1BFF A;  1JT3 A;  1WBC A;  3H6R A;  4DEN A;  3O4C A;  1JLX A;  4X39 A;  7I1B A;  3UD7 A;  1BA7 A;  4USP A;  2MLL B;  3HSM A;  3ZXD A;  2E4M A;  3IAG C;  2FFU A;  3FUQ A;  2HW9 A;  3NJ5 A;  3TC2 A;  5BP5 A;  2K4A B;  4I4O A;  1OQL B;  4Q9G A;  1HWP B;  4FVV A;  1I1E A;  6I1B A;  1R8O A;  4QAL A;  3WO4 A;  4YOL A;  4F34 A;  2X2S A;  2VUA A;  2I1B A;  2NVH A;  3N0K A;  4HA2 A;  2FDB M;  3I29 B;  3F1R A;  4G1R A;  4QKR A;  4KC3 A;  3O44 A;  4QC4 A;  1AFC A;  4Z9W B;  1M2T B;  4AN6 A;  1FWU A;  4Z8S B;  3V79 C;  1AF9 A;  4EFQ A;  1V6W A;  1M16 A;  4ZFY B;  1FMM S;  4OWL A;  1PZZ A;  4ZFW B;  1EYL A;  4X38 A;  2D23 A;  5G00 A;  1ISW A;  4I7I A;  4LO7 C;  1KNM A;  3CU1 B;  1FWV A;  1Z0H A;  1DIW A;  2QYI B;  3FJB A;  3BA4 A;  3IM6 A;  3AH1 A;  1IHK A;  4ISR A;  1ILR 1;  3O3Q A;  1JT7 A;  4LO1 C;  1Z4S A;  4QBC A;  4ZGR B;  3BAU A;  3FJF A;  1L2H A;  4GAF A;  4LO2 C;  4ZFU B;  4GOY A;  3Q7W A;  2AXM A;  1YF8 B;  3ZC9 A;  3CRH A;  2D24 A;  2RST A;  1Z2V A;  1ITB A;  1FQ9 A;  3N7K A;  2YUG A;  1N4K A;  3VT1 A;  4LO8 B;  3WO2 A;  2F8X C;  3OJ2 A;  1A8D A;  2WBC A;  5DSS B;  3VSF A;  4AN7 B;  3AJ6 A;  3S8J A;  3RSJ A;  2NM1 A;  3A22 A;  4XKI A;  3PG0 A;  3BTA A;  3I2A A;  3FFZ A;  3N7M A;  1W3G A;  2AAI B;  2KKI A;  3MAL A;  3P6I A;  1WBA A;  1S0F A;  5BQU C;  3V0B B;  3BRG C;  4I3N A;  1S0L A;  1IRA X;  1JY0 A;  2ZR1 B;  3EF2 A;  4JKX B;  1XG6 A;  2VXR A;  4GP3 A;  4JKQ A;  4EKX B;  1HCD A;  1K5V A;  31BI A;  3OBT A;  4G9N A;  1E0O A;  4I4V A;  2DS0 A;  4G6M A;  1JQZ A;  1IIL A;  4KBB A;  3LTQ A;  1AXM A;  3ZX7 A;  5I1B A;  1DQG A;  3F62 B;  1G9C A;  3FJ9 A;  4JPZ A;  1AVA C;  1RG8 A;  3BAO A;  3BAG A;  5JLV A;  3O4B A;  2KI6 B;  5F8Y A;  3FGM A;  5GAQ A;  5D62 A;  4LO7 B;  4H9W A;  1DZC A;  5FNX A;  3O4O A;  5FZU A;  3UDA A;  2BFH A;  1PUM B;  1K5U A;  3WMU A;  3O4D A;  4XFU A;  4QO3 A;  3OGF A;  1FV2 A;  1VCL A;  3A21 A;  3FJ8 A;  2NZ9 A;  5BXT A;  4R6U B;  1T9F A;  2LIQ A;  4ZOT A;  3ZXG A;  4J23 B;  4I0Y A;  1FV3 A;  3WO3 A;  1BFG A;  4G9M A;  3VSZ A;  1V6U A;  1HWO B;  3WIN C;  3R4S A;  2VLC A;  4I1B A;  5D63 A;  1W3F A;  3HN1 A;  3H6S E;  3I2X A;  4JQ0 A;  1AVX B;  4KEJ A;  3AJ5 A;  4J2X A;  2F2F C;  3E8L C;  1FN0 A;  2ZQN A;  5DZU A;  5BP5 C;  3W9T A;  1JTC A;  1QQL A;  2FGF A;  3UD9 A;  3WA1 A;  2Z49 A;  1II4 A;  4ION A;  3V0A A;  1YXW A;  1TTU A;  5EHA A;  1Q04 A;  1RML A;  4LO3 C;  1S0G A;  1S0D A;  5B2H A;  4D8H A;  2DRE A;  3BAH A;  4J2S A;  2KI4 A;  1BFB A;  2NYY A;  2VXT I;  8I1B A;  2MC2 A;  1ONK B;  1AVW B;  1ISZ A;  1S0E A;  1DLL A;  2ET2 A;  3P53 A;  3HMY A;  1NUN A;  3JUT A;  3BAD A;  3BRD A;  4A7K A;  3AKI A;  1MC9 A;  1YBI A;  3CA6 A;  1SR4 C;  3O49 A;  3VUO A;  1XHB A;  4L4H A;  2ERM A;  5F8S A;  3T8S A;  4LO0 C;  1T4Q A;  3IIR A;  1PC8 B;  3B9U A;  4I8M A;  2GO2 A;  1AVU A;  3H6R B;  3HAL A;  3AH2 A;  3UD8 A;  4IY8 A;  1SZ6 B;  2IWT B;  4OW4 A;  3AKG A;  2QN4 A;  2Y9X E;  4A7Y A;  5FNW A;  3CA4 A;  4FGF A;  4DCK C;  5JMC A;  1IJT A;  1ABR B;  4LO1 A;  2K8R A;  4Q91 A;  1XZZ A;  1YYN A;  1TP0 A;  3Q7Y A;  1QQK A;  4LO2 A;  5BXP A;  3PUB A;  2ESU A;  1P63 A;  1HIB A;  4I6I A;  1PUU B;  2D20 A;  2K43 A;  3NBC A;  3ZC8 A;  3H6Q A;  1BLD A;  1RY7 A;  2P23 A;  3FUO A;  1UPS A;  3LLP A;  3D7W B;  2P39 A;  3S8K A;  3BA7 A;  2RG9 B;  2IHO A;  4P6A A;  1Q03 A;  4I4R A;  1ISY A;  4KEK A;  5E24 E;  3FJC A;  1CVS A;  3AH4 A;  2KLL A;  1GGP B;  4OEG A;  4D0T A;  5EG6 C;  4IZE A;  3RTJ B;  1DQO A;  1I1B A;  3FJJ A;  2MIB A;  1HCE A;  2D44 A;  2Z48 A;  2WRY A;  1D0H A;  3O4A A;  1Q1U A;  2D7R A;  4QKS A;  3QR5 A;  1BAR A;  2Y9W C;  3A23 A;  4IQP A;  2XOA A;  1R8N A;  2L5X A;  3AKF A;  3C9Z A;  4P0L A;  4I1E A;  3R4U A;  1MD6 A;  3SNV A;  3AZV A;  1NZK A;  3OBR A;  3VT2 A;  2VSA A;  2UUS A;  1JT5 A;  2DRZ A;  4I4Y A;  1DFC A;  3NBD A;  1G9A A;  1RZO B;  3CA3 A;  3IM7 A;  2NTD A;  2ZQO A;  4EB2 B;  3UJ0 A;  1TFM B;  3BB2 A;  5DVH A;  3RMX A;  1F31 A;  4GP0 A;  4HR6 C;  5FZY A;  3FJH A;  4JRA A;  2E4M C;  5D61 A;  2Q9X A;  2VU9 A;  4QD2 C;  1TOO A;  1DZD A;  5BXS A;  3OGG A;  2D22 A;  9ILB A;  3HOM A;  5EC5 A;  1BAS A;  3FJE A;  3ILA A; 
#chains in the Genus database with same CATH topology
 3PHZ A;  1G9D A;  2F2F A;  1TWE A;  4D0Z A;  5BVP I;  2J3P A;  4J2K A;  3BX1 C;  3OJM A;  3VEQ A;  4I37 A;  2GZB A;  4I2S A;  1W3A A;  3MPP G;  4J2Y A;  1QXM A;  3Q7X A;  1S0B A;  3V0B A;  3BA5 A;  5FZZ A;  4QBV A;  4I96 A;  4UY4 A;  1WD4 A;  1HKN A;  1IOB A;  4LO3 A;  3AKH A;  2D1Z A;  2D7I A;  3FJA A;  3CRG A;  4IYB A;  41BI A;  4OUJ A;  4OWK A;  4ZLB B;  2Q3N B;  4G6J A;  4L4I A;  3FJD A;  3N7J A;  1WD3 A;  1JLY A;  1PWA A;  4IZX A;  3UJ4 A;  1XYF A;  2NP0 A;  2Y9G A;  4I4S A;  4OWJ A;  3KMV A;  2RQ9 A;  3JRR A;  4MZG B;  4XFS A;  4JP0 A;  3FJK A;  4IY9 A;  4KEI A;  2BEB A;  1CE7 B;  5F90 A;  4H04 A;  1SR4 A;  4ZKT B;  1HWM B;  2DRY A;  3OJV A;  3BAQ A;  21BI A;  1IT0 A;  4LO0 A;  4OEE A;  4A7Z A;  4TLP A;  4QD2 B;  3P6J A;  4OEF A;  3N7L A;  3CA1 A;  1EVT A;  1V6V A;  2HWA A;  2BEA A;  1IRP A;  1G82 A;  1HWN B;  3V0A B;  2LIE A;  1EPW A;  3BAV A;  3AZW A;  2KH2 A;  1BFC A;  4END A;  5BXR A;  2FFV A;  4II0 A;  2Y9F A;  4XFT A;  3BRF A;  1DJS B;  1JT4 A;  4Q9P A;  4GAI A;  4EEE B;  5BQU A;  1V6X A;  4I4U A;  3A07 A;  4ISQ A;  4WBC A;  4GOV A;  1YTO A;  3QYD A;  2D43 A;  4ZA3 B;  3CA5 A;  4EFP A;  4F83 A;  4X37 A;  2AFG A;  4I4X A;  2FO1 A;  4CJM A;  3O5W B;  3NBN A;  3RTI B;  5HPZ A;  2R9K B;  3RMY A;  1ISV A;  1S0C A;  4P0K A;  1ISX A;  4JAW A;  4I4P A;  1BLA A;  3HBW A;  5F8W A;  4USO A;  2X2T A;  2VSE A;  4I4Q A;  1TWM A;  4X3A A;  3VWC A;  3PME A;  2HZ9 A;  3CQA A;  3IM5 A;  4PC4 A;  4HJJ A;  4ZBV B;  1TIE A;  4EFR A;  5BOW A;  3WMV A;  3K1X A;  3CRI A;  3VT0 A;  4MZF B;  5DUY A;  1DFQ A;  4IHZ A;  1FGA A;  2AQZ A;  3POK A;  2M49 A;  4P0J A;  3FJI A;  4DEP A;  2HWM A;  1G9B A;  3CAH A;  3NBE A;  1EV2 A;  1FMZ A;  3CA0 A;  3WIN A;  1J0S A;  1BFF A;  1JT3 A;  1WBC A;  3H6R A;  4DEN A;  3O4C A;  1JLX A;  4X39 A;  7I1B A;  3UD7 A;  1BA7 A;  4USP A;  2MLL B;  3HSM A;  3ZXD A;  2E4M A;  3IAG C;  2FFU A;  3FUQ A;  2HW9 A;  3NJ5 A;  3TC2 A;  5BP5 A;  2K4A B;  4I4O A;  1OQL B;  4Q9G A;  1HWP B;  4FVV A;  1I1E A;  6I1B A;  1R8O A;  4QAL A;  3WO4 A;  4YOL A;  4F34 A;  2X2S A;  2VUA A;  2I1B A;  2NVH A;  3N0K A;  4HA2 A;  2FDB M;  3I29 B;  3F1R A;  4G1R A;  4QKR A;  4KC3 A;  3O44 A;  4QC4 A;  1AFC A;  4Z9W B;  1M2T B;  4AN6 A;  1FWU A;  4Z8S B;  3V79 C;  1AF9 A;  4EFQ A;  1V6W A;  1M16 A;  4ZFY B;  1FMM S;  4OWL A;  1PZZ A;  4ZFW B;  1EYL A;  4X38 A;  2D23 A;  5G00 A;  1ISW A;  4I7I A;  4LO7 C;  1KNM A;  3CU1 B;  1FWV A;  1Z0H A;  1DIW A;  2QYI B;  3FJB A;  3BA4 A;  3IM6 A;  3AH1 A;  1IHK A;  4ISR A;  1ILR 1;  3O3Q A;  1JT7 A;  4LO1 C;  1Z4S A;  4QBC A;  4ZGR B;  3BAU A;  3FJF A;  1L2H A;  4GAF A;  4LO2 C;  4ZFU B;  4GOY A;  3Q7W A;  2AXM A;  1YF8 B;  3ZC9 A;  3CRH A;  2D24 A;  2RST A;  1Z2V A;  1ITB A;  1FQ9 A;  3N7K A;  2YUG A;  1N4K A;  3VT1 A;  4LO8 B;  3WO2 A;  2F8X C;  3OJ2 A;  1A8D A;  2WBC A;  5DSS B;  3VSF A;  4AN7 B;  3AJ6 A;  3S8J A;  3RSJ A;  2NM1 A;  3A22 A;  4XKI A;  3PG0 A;  3BTA A;  3I2A A;  3FFZ A;  3N7M A;  1W3G A;  2AAI B;  2KKI A;  3MAL A;  3P6I A;  1WBA A;  1S0F A;  5BQU C;  3V0B B;  3BRG C;  4I3N A;  4MZH A;  1S0L A;  1IRA X;  1JY0 A;  2ZR1 B;  3EF2 A;  4JKX B;  1XG6 A;  2VXR A;  4GP3 A;  4JKQ A;  4EKX B;  1HCD A;  1K5V A;  31BI A;  3OBT A;  4G9N A;  1E0O A;  4I4V A;  2DS0 A;  4G6M A;  1JQZ A;  1IIL A;  4KBB A;  3LTQ A;  1AXM A;  3ZX7 A;  5I1B A;  1DQG A;  3F62 B;  1G9C A;  3FJ9 A;  4JPZ A;  1AVA C;  1RG8 A;  3BAO A;  3BAG A;  5JLV A;  3O4B A;  2KI6 B;  5F8Y A;  3FGM A;  5GAQ A;  5D62 A;  4LO7 B;  4H9W A;  1DZC A;  5FNX A;  3O4O A;  5FZU A;  3UDA A;  2BFH A;  1PUM B;  1K5U A;  3WMU A;  3O4D A;  4XFU A;  4QO3 A;  3OGF A;  1FV2 A;  1VCL A;  3A21 A;  3FJ8 A;  2NS2 A;  2NZ9 A;  5BXT A;  4R6U B;  1T9F A;  2LIQ A;  4ZOT A;  3ZXG A;  4J23 B;  4I0Y A;  1FV3 A;  3WO3 A;  1BFG A;  4G9M A;  3VSZ A;  1V6U A;  1HWO B;  3WIN C;  3R4S A;  2VLC A;  4I1B A;  5D63 A;  1W3F A;  3HN1 A;  3H6S E;  3I2X A;  4JQ0 A;  1AVX B;  4KEJ A;  3AJ5 A;  4J2X A;  2F2F C;  3E8L C;  1FN0 A;  2ZQN A;  5DZU A;  5BP5 C;  3W9T A;  1JTC A;  1QQL A;  2FGF A;  3UD9 A;  3WA1 A;  2Z49 A;  1II4 A;  4ION A;  3V0A A;  1YXW A;  1TTU A;  5EHA A;  1Q04 A;  1RML A;  4LO3 C;  1S0G A;  1S0D A;  5B2H A;  4D8H A;  2DRE A;  3BAH A;  4J2S A;  2KI4 A;  1BFB A;  2NYY A;  2VXT I;  8I1B A;  2MC2 A;  1ONK B;  1AVW B;  1ISZ A;  1S0E A;  1DLL A;  2ET2 A;  3P53 A;  3HMY A;  1NUN A;  3JUT A;  3BAD A;  3BRD A;  4A7K A;  3AKI A;  1MC9 A;  1YBI A;  3CA6 A;  1SR4 C;  3O49 A;  3VUO A;  1XHB A;  4L4H A;  2ERM A;  5F8S A;  3T8S A;  4LO0 C;  1T4Q A;  3IIR A;  1PC8 B;  3B9U A;  4I8M A;  2GO2 A;  1AVU A;  3H6R B;  3HAL A;  3AH2 A;  3UD8 A;  4IY8 A;  1SZ6 B;  2IWT B;  4OW4 A;  3AKG A;  2QN4 A;  2Y9X E;  4A7Y A;  5FNW A;  3CA4 A;  4FGF A;  4DCK C;  5JMC A;  1IJT A;  1ABR B;  4LO1 A;  2K8R A;  4Q91 A;  1XZZ A;  1YYN A;  1TP0 A;  3Q7Y A;  1QQK A;  4LO2 A;  5BXP A;  3PUB A;  2ESU A;  1P63 A;  1HIB A;  4I6I A;  1PUU B;  2D20 A;  2K43 A;  3NBC A;  3ZC8 A;  3H6Q A;  1BLD A;  1RY7 A;  2P23 A;  3FUO A;  1UPS A;  3LLP A;  3D7W B;  2P39 A;  3S8K A;  3BA7 A;  2RG9 B;  2IHO A;  4P6A A;  1Q03 A;  4I4R A;  1ISY A;  4KEK A;  5E24 E;  3FJC A;  1CVS A;  3AH4 A;  2KLL A;  1GGP B;  4OEG A;  4D0T A;  5EG6 C;  4IZE A;  3RTJ B;  1DQO A;  1I1B A;  3FJJ A;  2MIB A;  1HCE A;  2D44 A;  2Z48 A;  2WRY A;  1D0H A;  3O4A A;  1Q1U A;  2D7R A;  4QKS A;  3QR5 A;  1BAR A;  2Y9W C;  3A23 A;  4IQP A;  2XOA A;  1R8N A;  2L5X A;  3AKF A;  3C9Z A;  4P0L A;  4I1E A;  3R4U A;  1MD6 A;  3SNV A;  3AZV A;  1NZK A;  3OBR A;  3VT2 A;  2VSA A;  2UUS A;  1JT5 A;  2DRZ A;  4I4Y A;  1DFC A;  3NBD A;  1G9A A;  1RZO B;  3CA3 A;  3IM7 A;  2NTD A;  2ZQO A;  4EB2 B;  3UJ0 A;  1TFM B;  3BB2 A;  5DVH A;  3RMX A;  1F31 A;  4GP0 A;  4HR6 C;  5FZY A;  4H75 A;  3FJH A;  4JRA A;  2E4M C;  5D61 A;  2Q9X A;  2VU9 A;  4QD2 C;  1TOO A;  1DZD A;  5BXS A;  3OGG A;  2D22 A;  9ILB A;  3HOM A;  5EC5 A;  1BAS A;  3FJE A;  3ILA A; 
#chains in the Genus database with same CATH homology
 3PHZ A;  1G9D A;  2F2F A;  1TWE A;  4D0Z A;  5BVP I;  2J3P A;  4J2K A;  3BX1 C;  3OJM A;  3VEQ A;  4I37 A;  2GZB A;  4I2S A;  1W3A A;  3MPP G;  4J2Y A;  1QXM A;  3Q7X A;  1S0B A;  3V0B A;  3BA5 A;  5FZZ A;  4QBV A;  4I96 A;  4UY4 A;  1WD4 A;  1HKN A;  1IOB A;  4LO3 A;  3AKH A;  2D1Z A;  2D7I A;  3FJA A;  3CRG A;  4IYB A;  41BI A;  4OUJ A;  4OWK A;  4ZLB B;  2Q3N B;  4G6J A;  4L4I A;  3FJD A;  3N7J A;  1WD3 A;  1JLY A;  1PWA A;  4IZX A;  3UJ4 A;  1XYF A;  2NP0 A;  2Y9G A;  4I4S A;  4OWJ A;  3KMV A;  2RQ9 A;  3JRR A;  4MZG B;  4XFS A;  4JP0 A;  3FJK A;  4IY9 A;  4KEI A;  2BEB A;  1CE7 B;  5F90 A;  4H04 A;  1SR4 A;  4ZKT B;  1HWM B;  2DRY A;  3OJV A;  3BAQ A;  21BI A;  1IT0 A;  4LO0 A;  4OEE A;  4A7Z A;  4TLP A;  4QD2 B;  3P6J A;  4OEF A;  3N7L A;  3CA1 A;  1EVT A;  1V6V A;  2HWA A;  2BEA A;  1IRP A;  1G82 A;  1HWN B;  3V0A B;  2LIE A;  1EPW A;  3BAV A;  3AZW A;  2KH2 A;  1BFC A;  4END A;  5BXR A;  2FFV A;  4II0 A;  2Y9F A;  4XFT A;  3BRF A;  1DJS B;  1JT4 A;  4Q9P A;  4GAI A;  4EEE B;  5BQU A;  1V6X A;  4I4U A;  3A07 A;  4ISQ A;  4WBC A;  4GOV A;  1YTO A;  3QYD A;  2D43 A;  4ZA3 B;  3CA5 A;  4EFP A;  4F83 A;  4X37 A;  2AFG A;  4I4X A;  2FO1 A;  4CJM A;  3O5W B;  3NBN A;  3RTI B;  5HPZ A;  2R9K B;  3RMY A;  1ISV A;  1S0C A;  4P0K A;  1ISX A;  4JAW A;  4I4P A;  1BLA A;  3HBW A;  5F8W A;  4USO A;  2X2T A;  2VSE A;  4I4Q A;  1TWM A;  4X3A A;  3VWC A;  3PME A;  2HZ9 A;  3CQA A;  3IM5 A;  4PC4 A;  4HJJ A;  4ZBV B;  1TIE A;  4EFR A;  5BOW A;  3WMV A;  3K1X A;  3CRI A;  3VT0 A;  4MZF B;  5DUY A;  1DFQ A;  4IHZ A;  1FGA A;  2AQZ A;  3POK A;  2M49 A;  4P0J A;  3FJI A;  4DEP A;  2HWM A;  1G9B A;  3CAH A;  3NBE A;  1EV2 A;  1FMZ A;  3CA0 A;  3WIN A;  1J0S A;  1BFF A;  1JT3 A;  1WBC A;  3H6R A;  4DEN A;  3O4C A;  1JLX A;  4X39 A;  7I1B A;  3UD7 A;  1BA7 A;  4USP A;  2MLL B;  3HSM A;  3ZXD A;  2E4M A;  3IAG C;  2FFU A;  3FUQ A;  2HW9 A;  3NJ5 A;  3TC2 A;  5BP5 A;  2K4A B;  4I4O A;  1OQL B;  4Q9G A;  1HWP B;  4FVV A;  1I1E A;  6I1B A;  1R8O A;  4QAL A;  3WO4 A;  4YOL A;  4F34 A;  2X2S A;  2VUA A;  2I1B A;  2NVH A;  3N0K A;  4HA2 A;  2FDB M;  3I29 B;  3F1R A;  4G1R A;  4QKR A;  4KC3 A;  3O44 A;  4QC4 A;  1AFC A;  4Z9W B;  1M2T B;  4AN6 A;  1FWU A;  4Z8S B;  3V79 C;  1AF9 A;  4EFQ A;  1V6W A;  1M16 A;  4ZFY B;  1FMM S;  4OWL A;  1PZZ A;  4ZFW B;  1EYL A;  4X38 A;  2D23 A;  5G00 A;  1ISW A;  4I7I A;  4LO7 C;  1KNM A;  3CU1 B;  1FWV A;  1Z0H A;  1DIW A;  2QYI B;  3FJB A;  3BA4 A;  3IM6 A;  3AH1 A;  1IHK A;  4ISR A;  1ILR 1;  3O3Q A;  1JT7 A;  4LO1 C;  1Z4S A;  4QBC A;  4ZGR B;  3BAU A;  3FJF A;  1L2H A;  4GAF A;  4LO2 C;  4ZFU B;  4GOY A;  3Q7W A;  2AXM A;  1YF8 B;  3ZC9 A;  3CRH A;  2D24 A;  2RST A;  1Z2V A;  1ITB A;  1FQ9 A;  3N7K A;  2YUG A;  1N4K A;  3VT1 A;  4LO8 B;  3WO2 A;  2F8X C;  3OJ2 A;  1A8D A;  2WBC A;  5DSS B;  3VSF A;  4AN7 B;  3AJ6 A;  3S8J A;  3RSJ A;  2NM1 A;  3A22 A;  4XKI A;  3PG0 A;  3BTA A;  3I2A A;  3FFZ A;  3N7M A;  1W3G A;  2AAI B;  2KKI A;  3MAL A;  3P6I A;  1WBA A;  1S0F A;  5BQU C;  3V0B B;  3BRG C;  4I3N A;  4MZH A;  1S0L A;  1IRA X;  1JY0 A;  2ZR1 B;  3EF2 A;  4JKX B;  1XG6 A;  2VXR A;  4GP3 A;  4JKQ A;  4EKX B;  1HCD A;  1K5V A;  31BI A;  3OBT A;  4G9N A;  1E0O A;  4I4V A;  2DS0 A;  4G6M A;  1JQZ A;  1IIL A;  4KBB A;  3LTQ A;  1AXM A;  3ZX7 A;  5I1B A;  1DQG A;  3F62 B;  1G9C A;  3FJ9 A;  4JPZ A;  1AVA C;  1RG8 A;  3BAO A;  3BAG A;  5JLV A;  3O4B A;  2KI6 B;  5F8Y A;  3FGM A;  5GAQ A;  5D62 A;  4LO7 B;  4H9W A;  1DZC A;  5FNX A;  3O4O A;  5FZU A;  3UDA A;  2BFH A;  1PUM B;  1K5U A;  3WMU A;  3O4D A;  4XFU A;  4QO3 A;  3OGF A;  1FV2 A;  1VCL A;  3A21 A;  3FJ8 A;  2NS2 A;  2NZ9 A;  5BXT A;  4R6U B;  1T9F A;  2LIQ A;  4ZOT A;  3ZXG A;  4J23 B;  4I0Y A;  1FV3 A;  3WO3 A;  1BFG A;  4G9M A;  3VSZ A;  1V6U A;  1HWO B;  3WIN C;  3R4S A;  2VLC A;  4I1B A;  5D63 A;  1W3F A;  3HN1 A;  3H6S E;  3I2X A;  4JQ0 A;  1AVX B;  4KEJ A;  3AJ5 A;  4J2X A;  2F2F C;  3E8L C;  1FN0 A;  2ZQN A;  5DZU A;  5BP5 C;  3W9T A;  1JTC A;  1QQL A;  2FGF A;  3UD9 A;  3WA1 A;  2Z49 A;  1II4 A;  4ION A;  3V0A A;  1YXW A;  1TTU A;  5EHA A;  1Q04 A;  1RML A;  4LO3 C;  1S0G A;  1S0D A;  5B2H A;  4D8H A;  2DRE A;  3BAH A;  4J2S A;  2KI4 A;  1BFB A;  2NYY A;  2VXT I;  8I1B A;  2MC2 A;  1ONK B;  1AVW B;  1ISZ A;  1S0E A;  1DLL A;  2ET2 A;  3P53 A;  3HMY A;  1NUN A;  3JUT A;  3BAD A;  3BRD A;  4A7K A;  3AKI A;  1MC9 A;  1YBI A;  3CA6 A;  1SR4 C;  3O49 A;  3VUO A;  1XHB A;  4L4H A;  2ERM A;  5F8S A;  3T8S A;  4LO0 C;  1T4Q A;  3IIR A;  1PC8 B;  3B9U A;  4I8M A;  2GO2 A;  1AVU A;  3H6R B;  3HAL A;  3AH2 A;  3UD8 A;  4IY8 A;  1SZ6 B;  2IWT B;  4OW4 A;  3AKG A;  2QN4 A;  2Y9X E;  4A7Y A;  5FNW A;  3CA4 A;  4FGF A;  4DCK C;  5JMC A;  1IJT A;  1ABR B;  4LO1 A;  2K8R A;  4Q91 A;  1XZZ A;  1YYN A;  1TP0 A;  3Q7Y A;  1QQK A;  4LO2 A;  5BXP A;  3PUB A;  2ESU A;  1P63 A;  1HIB A;  4I6I A;  1PUU B;  2D20 A;  2K43 A;  3NBC A;  3ZC8 A;  3H6Q A;  1BLD A;  1RY7 A;  2P23 A;  3FUO A;  1UPS A;  3LLP A;  3D7W B;  2P39 A;  3S8K A;  3BA7 A;  2RG9 B;  2IHO A;  4P6A A;  1Q03 A;  4I4R A;  1ISY A;  4KEK A;  5E24 E;  3FJC A;  1CVS A;  3AH4 A;  2KLL A;  1GGP B;  4OEG A;  4D0T A;  5EG6 C;  4IZE A;  3RTJ B;  1DQO A;  1I1B A;  3FJJ A;  2MIB A;  1HCE A;  2D44 A;  2Z48 A;  2WRY A;  1D0H A;  3O4A A;  1Q1U A;  2D7R A;  4QKS A;  3QR5 A;  1BAR A;  2Y9W C;  3A23 A;  4IQP A;  2XOA A;  1R8N A;  2L5X A;  3AKF A;  3C9Z A;  4P0L A;  4I1E A;  3R4U A;  1MD6 A;  3SNV A;  3AZV A;  1NZK A;  3OBR A;  3VT2 A;  2VSA A;  2UUS A;  1JT5 A;  2DRZ A;  4I4Y A;  1DFC A;  3NBD A;  1G9A A;  1RZO B;  3CA3 A;  3IM7 A;  2NTD A;  2ZQO A;  4EB2 B;  3UJ0 A;  1TFM B;  3BB2 A;  5DVH A;  3RMX A;  1F31 A;  4GP0 A;  4HR6 C;  5FZY A;  4H75 A;  3FJH A;  4JRA A;  2E4M C;  5D61 A;  2Q9X A;  2VU9 A;  4QD2 C;  1TOO A;  1DZD A;  5BXS A;  3OGG A;  2D22 A;  9ILB A;  3HOM A;  5EC5 A;  1BAS A;  3FJE A;  3ILA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...