4OWRA

Vesiculoviral matrix (m) protein occupies nucleic acid binding site at nucleoporin pair rae1-nup98
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
335
structure length
331
Chain Sequence
DIEVTSSPDDSIGCLSFSPPTLPGNFLIAGSWANDVRCWEVQDSGQTIPKAQQMHTGPVLDVCWSDDGSKVFTASCDKTAKMWDLSSNQAIQIAQHDAPVKTIHWIKAPNYSCVMTGSWDKTLKFWDTRSSNPMMVLQLPERCYCADVIYPMAVVATAERGLIVYQLENQPSEFRRIESPLKHQHRCVAIFKDKQNKPTGFALGSIEGRVAIHYINPPNPAKDNFTFKCHRSNSAPQDIYAVNGIAFHPVHGTLATVGSDGRFSFWDKDARTKLKTSEQLDQPISACCFNHNGNIFAYASSYDWSKGHEFYNPQKKNYIFLRNAAEELKPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords mRNA export factor
publication title Vesiculoviral matrix (M) protein occupies nucleic acid binding site at nucleoporin pair (Rae1 Nup98).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 75
structure length 331
sequence length 335
ec nomenclature
pdb deposition date 2014-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4owrA00
3UKRC 5K1CC 5EMMB 3SLED 4OWRA 3I2NA 2OK6A 2XL2A 3EI2A 3SWSD 3SFZA 2PBIB 4E5ZA 4ZOXA 3PXSD 3U4YA 3UVLA 4J0XA 3I7OA 2Q7QA 5C2WB 3OL2A 2GNQA 2P9KC 1JMZB 3P4FA 1PBYB 3AL8B 2AGYA 5AJAA 3NVXA 3W15A 4ZOYA 2I0TA 2YNOA 5AMSA 5I5IA 3B7FA 4GGDA 2PM9B 4X3EA 4JT5C 3SMRA 3RMZD 5HQGA 1GXRA 3PXTD 3JAMg 2H9MA 4QRJA 5GXIA 3KRWB 5AFU3 4A11B 3SVWD 2OVPB 3I8EA 3PXWD 4X61B 3EI3B 3CIKB 5KDOB 3AL9A 5FLXg 5K19A 4CC9A 4TZ4A 3OKYB 2B4EA 5FXYA 3KRXB 1U4CA 5IJ8E 1GG2B 4AEZA 2CO0C 3JZNA 3I7KA 1A0RB 5FKTA 2AGXA 2P9UC 3RRMC 3EI4B 3AL8A 4HDJA 4E54B 4X63B 3N0EA 3SJLD 1MDAH 1R5MA 3SBRA 3VH0A 3C5MA 4JSVC 4ERQA 2I3TA 4JT6C 2J55H 4CY3A 4U1EI 4GMBA 4FA5D 1L0QA 3UR4A 3VGZA 5CYKB 2P9SC 3V7DB 4LGNA 4A0BA 4H5IA 2H9NA 4QL1A 3OTTA 3UVOA 3JPXA 4LG8A 4CY2A 4LG9A 4PXWA 4L9OA 4KFMB 3RFGA 4CI8A 4H5JA 2G9AA 2P9LC 2BCJB 5EMKB 2HKRA 5FQDA 5GMKn 4CI3A 2P9NC 1TBGA 1B9YA 2PM7B 3OW8A 4A09A 2YNNA 3HFQA 4Z8LA 2CE8A 2OIZA 3CFVA 2CNXA 2Z2NA 4A2LA 3EU7A 2H13A 3I7NA 4G56B 2GC4A 4FWWA 2CE9A 1VYHC 2XL3A 2IUPA 1TYQC 5HE1B 5HE2B 4PBYA 5EMLB 3SBQA 4K3ID 2HJ4A 1U2VC 5FKQA 1RI6A 2OVQB 4GQBB 3UVKA 5IGQA 4OZUA 5EM2B 2Z2OA 4FHLA 3VA6A 3EG6A 3SCYA 5CXCB 3MZKA 4CI2A 3AFCA 5FA5B 4FA4D 4L3GD 4ERZA 3DSMA 4ERYA 2HESX 1JMXB 3RN0D 3EI1A 2H68A 3ORVD 4O9DA 4GZ8A 3FGBA 3OKWA 2IUQA 4XYHA 2P9PC 2B5NA 4GM3A 1S4UX 2O9KA 5H14A 3EWEA 1PI6A 4J0WA 5HE0B 3JROA 5IJ7E 3PVWB 4A0AA 3J80g 5GSAA 2OK4A 4J86A 2I0RA 2IURA 1B9XA 4A08A 2IWFA 5EARA 3V5WB 5JWZA 3MZLA 3A0FA 4ZOVA 3K26A 4BL0A 3UVNA 1YFQA 1N6FA 4CY5A 4QQEA 1XKSA 2J56H 4CI1A 3I7PA 3DXKC 1OMWB 3EMHA 2XU7A 2CN2A 4FA9D 4IA9A 1N6DA 3GREA 4X60B 5EMJB 1XHMA 5C2VB 4EWRA 2YBAA 2I0SA 3SBPA 5H17A 3DWLC 3ZWLB 3GFCA 3BG0A 4JSXC 2PM9A 5CXBB 4J82A 3BWSA 4GM8A 2CN3A 5EALA 4AOWA 3F3FA 5EAMA 2HYEA 4GGCA 4ESGA 4FAVD 4A11A 3C75H 3I7HA 1QNIA 3EI2B 3EI3A 4IMMA 4J87A 3PE7A 4O3TB 2H6KA 3OKYA 4I79A 2CO0A 4L1QD 4PC0A 3OL2B 2IWKA 2AQ5A 4Y5RD 3UVMA 5I5JA 5FKRA 4D6VA 2Z2PA 2AH1A 5HYNB 1ERJA 2EBSA 2MTAH 1NEXB 1P22A 3AH8B 2YB8B 1K8KC 4J78A 3EI4A 4E54A 4N14A 1JOFA 4L3HD 3L4OD 3OKTA 4QT8A 4CY1A 3L4MD 2HXCA 3IJ1A 3SXTD 2QXVA 2HJBA 5CYKA 3F3PA 2PM6B 4XEIC 2QC5A 4GQ2P 4O1QD 2YMUA 3DM0A 3MMYA 3JRPA 2H6QA 4J77A 3SN6B 3N0DA 5IC7A 1GOTB 4U7AA 2P9IC 1JJUB 1PEVA 3FM0A 3NVQA 4UI9R 4FAND 3JZGA 1SQ9A 4A2MA 3IIYA 1OLZA 1PGUA 3MXXA 4D0KA 2G99A 4JSNC 5TF2A 5I5MA 3I8CA 5FKSA 2AH0A 4GM9A 1Q47A 2H9LA 2OVRB 2UZYB 3J81g 3JB9L 2IAAA 2AGWA 4CZYA 4PNKB 4JD2C 2UZXB 5EM2A 1MG2A 1SHYB 3I89A 5TEFA 4A0BB 3V9FA 4FA1D 3K27A 5CXCA 4CZVA 3I7LA 4Y7RA 5SXMA 3NVNA 2W18A 3RFHA 4PBZA 4ZOZA 3BG1A 3MKQA 5B4WA 3C99A 3IJCA 4A09B 5THAA 3ODTA 3F3GA 3MKSB 2H3XA 4ES0A 4XYIA 4R7AB 1GP2B 5IGOA 2B5MA 3RSEC 4JSPC 4A7JA 1MG3A 4J8GA 2BBKH 2I3SA 3PSCB 3RLMD 3UKUC 1N6EA 4BUJC 4O3UB 4PSWB 4J79A 4NSXA 1XIPA 1SQJA 3SHFA 5IT9g 2GC7A 4K3JB 4E5ZB 5A2Qg 4J8BA 3FRXA 4J81A 1NR0A 3CFSB 2H9PA 4O45A 2OJYA 1FWXA 4GGAA 2IUVA 2J57G 4FB1D 3EI1B 1K32A 3RN1D 2AGLA 3IKOA 5TEEA 4ZN4A 5C9ZB 3IJ0A 2H14A 2TRCB 4CZXA 3E0CA 5EAPA 2YNPA 2HKMA 3IIWA 2H47A 3ULEC 2XYIA 5GXHA 4YVDA 2AGZA 5HE3B 3PSLA 2B5LA 4J73A 3PVUB 4A0AB 4GQ1A 2H6NA 5CXBA 3C9CA 4PSXB 4A08B 5H1MA 3JZHA 4MK0B 3DXMC 4BH6A 4JXMA 4J84A 5TDHB
chains in the Genus database with same CATH superfamily
3UKRC 5K1CC 5EMMB 3SLED 4G55A 4OWRA 3I2NA 5E6RA 2OK6A 2XL2A 3EI2A 3SWSD 3SFZA 3V4PA 2PBIB 4E5ZA 4ZOXA 2XZGA 1BPOA 3PXSD 4NBMA 4AMZA 4WK2A 3U4YA 3UVLA 4J0XA 2BKLA 3MVDK 3I7OA 4MMZA 2Q7QA 5C2WB 3IUNA 3OL2A 4NC4A 2GNQA 1GOHA 2P9KC 1JMZB 3P4FA 1PBYB 1GOGA 3AL8B 2AGYA 4BP9A 5AJAA 3NVXA 3W15A 4ZOYA 3O4HA 3OF7A 2I0TA 2YNOA 3DDUA 5AMSA 5I5IA 3IUJA 1QFSA 3B7FA 4GGDA 2PM9B 4X3EA 4JT5C 3SMRA 3RMZD 5HQGA 1GXRA 1JTDB 3PXTD 2VDNA 3JAMg 2H9MA 4QRJA 5GXIA 4D9SA 3KRWB 5AFU3 4WJKA 4A11B 3SVWD 2OVPB 3I8EA 5HDBA 3PXWD 4IRZA 4X61B 3EI3B 1VZ3A 3CIKB 5KDOB 3EQ9A 3AL9A 1QFMA 5FLXg 5K19A 4CC9A 4TZ4A 3OKYB 4UM8A 2B4EA 5FXYA 3KRXB 1U4CA 5IJ8E 1VE6A 1GG2B 4AEZA 2CO0C 2EIDA 3JZNA 3VI4A 3I7KA 1A0RB 5FKTA 2AGXA 2P9UC 3RRMC 3K6SA 3EI4B 3AL8A 4HDJA 4E54B 3KCIA 4MMYA 1H2WA 4WK0A 3N0EA 4X63B 3SJLD 1MDAH 1R5MA 3SBRA 5M5VA 3VH0A 3C5MA 4JSVC 4ERQA 2I3TA 3K72A 4JT6C 4RE6A 4AMYA 2J55H 4CY3A 4U1EI 4RE5A 3O4IA 4GMBA 4FA5D 1L0QA 4G1MA 3UR4A 3VGZA 5CYKB 2P9SC 3MUOA 3V7DB 5C92A 3GC3B 1H2ZA 4LGNA 2JKXA 4A0BA 4H5IA 2H9NA 4QL1A 3OTTA 3UVOA 2QZPA 3JPXA 4L1MA 4LG8A 4CY2A 4LG9A 4PXWA 4L9OA 4KFMB 1U8CA 3RFGA 4CI8A 4H5JA 2G9AA 2P9LC 2BCJB 5EMKB 2HKRA 5FQDA 5GMKn 4CI3A 2P9NC 1TBGA 1B9YA 2PM7B 3OW8A 4A09A 4AN1A 2YNNA 3HFQA 4Z8LA 2CE8A 2OIZA 3CFVA 2CNXA 2Z2NA 4A2LA 3EU7A 1L5GA 2H13A 3I7NA 4G56B 2GC4A 4FWWA 2CE9A 1VYHC 2XL3A 2IUPA 1TYQC 5HE1B 3NIDA 5HE2B 4PBYA 5EMLB 3SBQA 1TYEA 4K3ID 2HJ4A 1U2VC 4JHPC 1M1XA 5FKQA 2XE4A 1RI6A 2OVQB 4GQBB 3UVKA 2HU7A 5IGQA 4OZUA 5EM2B 1C9LA 2EIBA 2Z2OA 4FHLA 1O6FA 3VA6A 3EG6A 3SCYA 5CXCB 3MZKA 4CI2A 3AFCA 5FA5B 4FA4D 4L3GD 4ERZA 4ERYA 3EQ8A 4DNUA 3ZDXA 1YR2A 2HESX 1JMXB 3RN0D 3EI1A 4BCDA 2H68A 3ORVD 3QI0A 4O9DA 4GZ8A 1VZ2A 3FGBA 3OKWA 4AN0A 2IUQA 4XYHA 2P9PC 2B5NA 4GM3A 1S4UX 3VI3A 2O9KA 5H14A 3IJEA 3EWEA 1PI6A 4J0WA 5HE0B 3JROA 5IJ7E 3PVWB 4A0AA 1VE7A 3J80g 5GSAA 2OK4A 5M5UA 4J86A 2I0RA 2IURA 1B9XA 4A08A 2IWFA 5EARA 3V5WB 5JWZA 3MZLA 5E6SA 1E5TA 3A0FA 5M61A 4ZOVA 3K26A 2VDQA 4BL0A 3UVNA 1YFQA 1N6FA 3IVMA 3IULA 4CY5A 4QQEA 1XKSA 2J56H 4CI1A 3I7PA 3DXKC 4DNWA 3T3PA 1OMWB 2WQ8A 3EMHA 1E8MA 2XU7A 3ZDYA 2CN2A 4FA9D 4IA9A 1N6DA 3GREA 4X60B 5EMJB 1XHMA 2HU8A 4EWRA 2YBAA 5C2VB 2I0SA 3SBPA 5H17A 2VDRA 4QAMA 3DWLC 2VDMA 3ZWLB 3GFCA 3BG0A 4JSXC 2PM9A 1H2YA 5CXBB 1K3IA 4J82A 3BWSA 3V4VA 4GM8A 2VZ3A 2CN3A 5EALA 4AOWA 3F3FA 5EAMA 2HYEA 2VC2A 4GGCA 4ESGA 4FAVD 4A11A 3C75H 3I7HA 1QNIA 3EI2B 3T3MA 3FCUA 3IUQA 3EI3A 4IMMA 4AX4A 4J87A 3PE7A 4BP8A 4O3TB 2H6KA 3OKYA 4I79A 2CO0A 4L1QD 4PC0A 3OL2B 2IWKA 2AQ5A 4Y5RD 3UVMA 5I5JA 5FKRA 2EICA 4D6VA 3EQ7A 2Z2PA 1UOOA 2AH1A 1ERJA 2EBSA 3ZE1A 5HYNB 2MTAH 1NEXB 1P22A 3AH8B 4UM9A 3GD1I 1E8NA 2YB8B 1K8KC 4J78A 3EI4A 4E54A 4Z7OA 4N14A 1JOFA 4L3HD 4WK4A 4NAAA 3L4OD 3K71A 3OKTA 2HU5A 4QT8A 4CY1A 3L4MD 2HXCA 3IJ1A 3SXTD 4Z7NA 2QXVA 2HJBA 4NENA 5CYKA 2VDOA 3F3PA 1C9IA 2PM6B 3O4JA 5FFOA 4XEIC 2QC5A 4GQ2P 1H2XA 4O1QD 2YMUA 3DM0A 3MMYA 3JRPA 2H6QA 4J77A 3SN6B 4Z7QA 3N0DA 4O2WA 5IC7A 1GOTB 4U7AA 2P9IC 4BCBA 1JJUB 2XDWA 1PEVA 3FM0A 3NVQA 3NIGA 4UI9R 4FAND 5M5SA 3JZGA 1SQ9A 4A2MA 3IIYA 1O6GA 1OLZA 1PGUA 3MXXA 4D0KA 2G99A 3QHYB 4BCCA 4JSNC 3FCSA 5TF2A 3ZE0A 5I5MA 3I8CA 5FKSA 2AH0A 4GM9A 1Q47A 1UOPA 2H9LA 2OVRB 2UZYB 3J81g 3JB9L 5M5RA 2IAAA 2AGWA 4CZYA 4PNKB 3IUMA 5C86A 2VDPA 4JD2C 2UZXB 2VDLA 5EM2A 1MG2A 1SHYB 1UOQA 3I89A 5TEFA 4A0BB 3V9FA 4FA1D 3K27A 5CXCA 4CZVA 3I7LA 4Y7RA 5SXMA 3NVNA 2W18A 3RFHA 4PBZA 4ZOZA 3BG1A 2VZ1A 3MKQA 5B4WA 3C99A 3IJCA 4A09B 5E6UA 5THAA 2VDKA 3ODTA 3F3GA 3MKSB 2H3XA 5FFGA 3ZE2A 4ES0A 4XYIA 4R7AB 1GP2B 4MMXA 5IGOA 2B5MA 3RSEC 4JSPC 4A7JA 1MG3A 1A12A 4J8GA 2BBKH 2I3SA 3PSCB 3RLMD 3UKUC 1N6EA 4BUJC 4O3UB 4PSWB 4J79A 4NSXA 1XIPA 1T2XA 4O02A 1SQJA 3SHFA 5IT9g 1UTCA 2GC7A 3ZDZA 4K3JB 1GOFA 4E5ZB 5A2Qg 4J8BA 4JHNA 3FRXA 4J81A 1NR0A 3CFSB 2H9PA 4O45A 2OJYA 5M5TA 1FWXA 1JV2A 4GGAA 2IUVA 2EIEA 2J57G 4FB1D 3EI1B 1K32A 3RN1D 2AGLA 3IKOA 5TEEA 4ZN4A 5C9ZB 3IJ0A 3MUNA 2H14A 2TRCB 4CZXA 3E0CA 5EAPA 2YNPA 2HKMA 2QR5A 3NIFA 4JXMA 3IIWA 2H47A 3ULEC 2XYIA 5GXHA 1I2MB 4YVDA 2AGZA 4G1EA 5HE3B 3PSLA 2B5LA 4J73A 3O4GA 3PVUB 4A0AB 4GQ1A 2H6NA 5CXBA 3C9CA 4DNVA 4PSXB 4A08B 5H1MA 3JZHA 3IURA 4MK0B 3DXMC 4BH6A 3DSMA 4J84A 5TDHB
chains in the Genus database with same CATH topology
3UKRC 5K1CC 5EMMB 3SLED 4OWRA 3I2NA 2OK6A 2XL2A 3EI2A 3SWSD 3SFZA 2PBIB 4E5ZA 4ZOXA 3PXSD 3U4YA 3UVLA 4J0XA 3I7OA 2Q7QA 5C2WB 3OL2A 2GNQA 2P9KC 1JMZB 3P4FA 1PBYB 3AL8B 2AGYA 5AJAA 3NVXA 3W15A 4ZOYA 2I0TA 2YNOA 5AMSA 5I5IA 3B7FA 4GGDA 2PM9B 4X3EA 4JT5C 3SMRA 3RMZD 5HQGA 1GXRA 3PXTD 3JAMg 2H9MA 4QRJA 5GXIA 3KRWB 5AFU3 4A11B 3SVWD 2OVPB 3I8EA 3PXWD 4X61B 3EI3B 3CIKB 5KDOB 3AL9A 5FLXg 5K19A 4CC9A 4TZ4A 3OKYB 2B4EA 5FXYA 3KRXB 1U4CA 5IJ8E 1GG2B 4AEZA 2CO0C 3JZNA 3I7KA 1A0RB 5FKTA 2AGXA 2P9UC 3RRMC 3EI4B 3AL8A 4HDJA 4E54B 4X63B 3N0EA 3SJLD 1MDAH 1R5MA 3SBRA 3VH0A 3C5MA 4JSVC 4ERQA 2I3TA 4JT6C 2J55H 4CY3A 4U1EI 4GMBA 4FA5D 1L0QA 3UR4A 3VGZA 5CYKB 2P9SC 3V7DB 4LGNA 4A0BA 4H5IA 2H9NA 4QL1A 3OTTA 3UVOA 3JPXA 4LG8A 4CY2A 4LG9A 4PXWA 4L9OA 4KFMB 3RFGA 4CI8A 4H5JA 2G9AA 2P9LC 2BCJB 5EMKB 2HKRA 5FQDA 5GMKn 4CI3A 2P9NC 1TBGA 1B9YA 2PM7B 3OW8A 4A09A 2YNNA 3HFQA 4Z8LA 2CE8A 2OIZA 3CFVA 2CNXA 2Z2NA 4A2LA 3EU7A 2H13A 3I7NA 4G56B 2GC4A 4FWWA 2CE9A 1VYHC 2XL3A 2IUPA 1TYQC 5HE1B 5HE2B 4PBYA 5EMLB 3SBQA 4K3ID 2HJ4A 1U2VC 5FKQA 1RI6A 2OVQB 4GQBB 3UVKA 5IGQA 4OZUA 5EM2B 2Z2OA 4FHLA 3VA6A 3EG6A 3SCYA 5CXCB 3MZKA 4CI2A 3AFCA 5FA5B 4FA4D 4L3GD 4ERZA 3DSMA 4ERYA 2HESX 1JMXB 3RN0D 3EI1A 2H68A 3ORVD 4O9DA 4GZ8A 3FGBA 3OKWA 2IUQA 4XYHA 2P9PC 2B5NA 4GM3A 1S4UX 2O9KA 5H14A 3EWEA 1PI6A 4J0WA 5HE0B 3JROA 5IJ7E 3PVWB 4A0AA 3J80g 5GSAA 2OK4A 4J86A 2I0RA 2IURA 1B9XA 4A08A 2IWFA 5EARA 3V5WB 5JWZA 3MZLA 3A0FA 4ZOVA 3K26A 4BL0A 3UVNA 1YFQA 1N6FA 4CY5A 4QQEA 1XKSA 2J56H 4CI1A 3I7PA 3DXKC 1OMWB 3EMHA 2XU7A 2CN2A 4FA9D 4IA9A 1N6DA 3GREA 4X60B 5EMJB 1XHMA 5C2VB 4EWRA 2YBAA 2I0SA 3SBPA 5H17A 3DWLC 3ZWLB 3GFCA 3BG0A 4JSXC 2PM9A 5CXBB 4J82A 3BWSA 4GM8A 2CN3A 5EALA 4AOWA 3F3FA 5EAMA 2HYEA 4GGCA 4ESGA 4FAVD 4A11A 3C75H 3I7HA 1QNIA 3EI2B 3EI3A 4IMMA 4J87A 3PE7A 4O3TB 2H6KA 3OKYA 4I79A 2CO0A 4L1QD 4PC0A 3OL2B 2IWKA 2AQ5A 4Y5RD 3UVMA 5I5JA 5FKRA 4D6VA 2Z2PA 2AH1A 5HYNB 1ERJA 2EBSA 2MTAH 1NEXB 1P22A 3AH8B 2YB8B 1K8KC 4J78A 3EI4A 4E54A 4N14A 1JOFA 4L3HD 3L4OD 3OKTA 4QT8A 4CY1A 3L4MD 2HXCA 3IJ1A 3SXTD 2QXVA 2HJBA 5CYKA 3F3PA 2PM6B 4XEIC 2QC5A 4GQ2P 4O1QD 2YMUA 3DM0A 3MMYA 3JRPA 2H6QA 4J77A 3SN6B 3N0DA 5IC7A 1GOTB 4U7AA 2P9IC 1JJUB 1PEVA 3FM0A 3NVQA 4UI9R 4FAND 3JZGA 1SQ9A 4A2MA 3IIYA 1OLZA 1PGUA 3MXXA 4D0KA 2G99A 4JSNC 5TF2A 5I5MA 3I8CA 5FKSA 2AH0A 4GM9A 1Q47A 2H9LA 2OVRB 2UZYB 3J81g 3JB9L 2IAAA 2AGWA 4CZYA 4PNKB 4JD2C 2UZXB 5EM2A 1MG2A 1SHYB 3I89A 5TEFA 4A0BB 3V9FA 4FA1D 3K27A 5CXCA 4CZVA 3I7LA 4Y7RA 5SXMA 3NVNA 2W18A 3RFHA 4PBZA 4ZOZA 3BG1A 3MKQA 5B4WA 3C99A 3IJCA 4A09B 5THAA 3ODTA 3F3GA 3MKSB 2H3XA 4ES0A 4XYIA 4R7AB 1GP2B 5IGOA 2B5MA 3RSEC 4JSPC 4A7JA 1MG3A 4J8GA 2BBKH 2I3SA 3PSCB 3RLMD 3UKUC 1N6EA 4BUJC 4O3UB 4PSWB 4J79A 4NSXA 1XIPA 1SQJA 3SHFA 5IT9g 2GC7A 4K3JB 4E5ZB 5A2Qg 4J8BA 3FRXA 4J81A 1NR0A 3CFSB 2H9PA 4O45A 2OJYA 1FWXA 4GGAA 2IUVA 2J57G 4FB1D 3EI1B 1K32A 3RN1D 2AGLA 3IKOA 5TEEA 4ZN4A 5C9ZB 3IJ0A 2H14A 2TRCB 4CZXA 3E0CA 5EAPA 2YNPA 2HKMA 3IIWA 2H47A 3ULEC 2XYIA 5GXHA 4YVDA 2AGZA 5HE3B 3PSLA 2B5LA 4J73A 3PVUB 4A0AB 4GQ1A 2H6NA 5CXBA 3C9CA 4PSXB 4A08B 5H1MA 3JZHA 4MK0B 3DXMC 4BH6A 4JXMA 4J84A 5TDHB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UKR C;  5K1C C;  5EMM B;  3SLE D;  4OWR A;  3I2N A;  2OK6 A;  2XL2 A;  3EI2 A;  3SWS D;  3SFZ A;  2PBI B;  4E5Z A;  4ZOX A;  3PXS D;  3U4Y A;  3UVL A;  4J0X A;  3I7O A;  2Q7Q A;  5C2W B;  3OL2 A;  2GNQ A;  2P9K C;  1JMZ B;  3P4F A;  1PBY B;  3AL8 B;  2AGY A;  5AJA A;  3NVX A;  3W15 A;  4ZOY A;  2I0T A;  2YNO A;  5AMS A;  5I5I A;  3B7F A;  4GGD A;  2PM9 B;  4X3E A;  4JT5 C;  3SMR A;  3RMZ D;  5HQG A;  1GXR A;  3PXT D;  3JAM g;  2H9M A;  4QRJ A;  5GXI A;  3KRW B;  5AFU 3;  4A11 B;  3SVW D;  2OVP B;  3I8E A;  3PXW D;  4X61 B;  3EI3 B;  3CIK B;  5KDO B;  3AL9 A;  5FLX g;  5K19 A;  4CC9 A;  4TZ4 A;  3OKY B;  2B4E A;  5FXY A;  3KRX B;  1U4C A;  5IJ8 E;  1GG2 B;  4AEZ A;  2CO0 C;  3JZN A;  3I7K A;  1A0R B;  5FKT A;  2AGX A;  2P9U C;  3RRM C;  3EI4 B;  3AL8 A;  4HDJ A;  4E54 B;  4X63 B;  3N0E A;  3SJL D;  1MDA H;  1R5M A;  3SBR A;  3VH0 A;  3C5M A;  4JSV C;  4ERQ A;  2I3T A;  4JT6 C;  2J55 H;  4CY3 A;  4U1E I;  4GMB A;  4FA5 D;  1L0Q A;  3UR4 A;  3VGZ A;  5CYK B;  2P9S C;  3V7D B;  4LGN A;  4A0B A;  4H5I A;  2H9N A;  4QL1 A;  3OTT A;  3UVO A;  3JPX A;  4LG8 A;  4CY2 A;  4LG9 A;  4PXW A;  4L9O A;  4KFM B;  3RFG A;  4CI8 A;  4H5J A;  2G9A A;  2P9L C;  2BCJ B;  5EMK B;  2HKR A;  5FQD A;  5GMK n;  4CI3 A;  2P9N C;  1TBG A;  1B9Y A;  2PM7 B;  3OW8 A;  4A09 A;  2YNN A;  3HFQ A;  4Z8L A;  2CE8 A;  2OIZ A;  3CFV A;  2CNX A;  2Z2N A;  4A2L A;  3EU7 A;  2H13 A;  3I7N A;  4G56 B;  2GC4 A;  4FWW A;  2CE9 A;  1VYH C;  2XL3 A;  2IUP A;  1TYQ C;  5HE1 B;  5HE2 B;  4PBY A;  5EML B;  3SBQ A;  4K3I D;  2HJ4 A;  1U2V C;  5FKQ A;  1RI6 A;  2OVQ B;  4GQB B;  3UVK A;  5IGQ A;  4OZU A;  5EM2 B;  2Z2O A;  4FHL A;  3VA6 A;  3EG6 A;  3SCY A;  5CXC B;  3MZK A;  4CI2 A;  3AFC A;  5FA5 B;  4FA4 D;  4L3G D;  4ERZ A;  3DSM A;  4ERY A;  2HES X;  1JMX B;  3RN0 D;  3EI1 A;  2H68 A;  3ORV D;  4O9D A;  4GZ8 A;  3FGB A;  3OKW A;  2IUQ A;  4XYH A;  2P9P C;  2B5N A;  4GM3 A;  1S4U X;  2O9K A;  5H14 A;  3EWE A;  1PI6 A;  4J0W A;  5HE0 B;  3JRO A;  5IJ7 E;  3PVW B;  4A0A A;  3J80 g;  5GSA A;  2OK4 A;  4J86 A;  2I0R A;  2IUR A;  1B9X A;  4A08 A;  2IWF A;  5EAR A;  3V5W B;  5JWZ A;  3MZL A;  3A0F A;  4ZOV A;  3K26 A;  4BL0 A;  3UVN A;  1YFQ A;  1N6F A;  4CY5 A;  4QQE A;  1XKS A;  2J56 H;  4CI1 A;  3I7P A;  3DXK C;  1OMW B;  3EMH A;  2XU7 A;  2CN2 A;  4FA9 D;  4IA9 A;  1N6D A;  3GRE A;  4X60 B;  5EMJ B;  1XHM A;  5C2V B;  4EWR A;  2YBA A;  2I0S A;  3SBP A;  5H17 A;  3DWL C;  3ZWL B;  3GFC A;  3BG0 A;  4JSX C;  2PM9 A;  5CXB B;  4J82 A;  3BWS A;  4GM8 A;  2CN3 A;  5EAL A;  4AOW A;  3F3F A;  5EAM A;  2HYE A;  4GGC A;  4ESG A;  4FAV D;  4A11 A;  3C75 H;  3I7H A;  1QNI A;  3EI2 B;  3EI3 A;  4IMM A;  4J87 A;  3PE7 A;  4O3T B;  2H6K A;  3OKY A;  4I79 A;  2CO0 A;  4L1Q D;  4PC0 A;  3OL2 B;  2IWK A;  2AQ5 A;  4Y5R D;  3UVM A;  5I5J A;  5FKR A;  4D6V A;  2Z2P A;  2AH1 A;  5HYN B;  1ERJ A;  2EBS A;  2MTA H;  1NEX B;  1P22 A;  3AH8 B;  2YB8 B;  1K8K C;  4J78 A;  3EI4 A;  4E54 A;  4N14 A;  1JOF A;  4L3H D;  3L4O D;  3OKT A;  4QT8 A;  4CY1 A;  3L4M D;  2HXC A;  3IJ1 A;  3SXT D;  2QXV A;  2HJB A;  5CYK A;  3F3P A;  2PM6 B;  4XEI C;  2QC5 A;  4GQ2 P;  4O1Q D;  2YMU A;  3DM0 A;  3MMY A;  3JRP A;  2H6Q A;  4J77 A;  3SN6 B;  3N0D A;  5IC7 A;  1GOT B;  4U7A A;  2P9I C;  1JJU B;  1PEV A;  3FM0 A;  3NVQ A;  4UI9 R;  4FAN D;  3JZG A;  1SQ9 A;  4A2M A;  3IIY A;  1OLZ A;  1PGU A;  3MXX A;  4D0K A;  2G99 A;  4JSN C;  5TF2 A;  5I5M A;  3I8C A;  5FKS A;  2AH0 A;  4GM9 A;  1Q47 A;  2H9L A;  2OVR B;  2UZY B;  3J81 g;  3JB9 L;  2IAA A;  2AGW A;  4CZY A;  4PNK B;  4JD2 C;  2UZX B;  5EM2 A;  1MG2 A;  1SHY B;  3I89 A;  5TEF A;  4A0B B;  3V9F A;  4FA1 D;  3K27 A;  5CXC A;  4CZV A;  3I7L A;  4Y7R A;  5SXM A;  3NVN A;  2W18 A;  3RFH A;  4PBZ A;  4ZOZ A;  3BG1 A;  3MKQ A;  5B4W A;  3C99 A;  3IJC A;  4A09 B;  5THA A;  3ODT A;  3F3G A;  3MKS B;  2H3X A;  4ES0 A;  4XYI A;  4R7A B;  1GP2 B;  5IGO A;  2B5M A;  3RSE C;  4JSP C;  4A7J A;  1MG3 A;  4J8G A;  2BBK H;  2I3S A;  3PSC B;  3RLM D;  3UKU C;  1N6E A;  4BUJ C;  4O3U B;  4PSW B;  4J79 A;  4NSX A;  1XIP A;  1SQJ A;  3SHF A;  5IT9 g;  2GC7 A;  4K3J B;  4E5Z B;  5A2Q g;  4J8B A;  3FRX A;  4J81 A;  1NR0 A;  3CFS B;  2H9P A;  4O45 A;  2OJY A;  1FWX A;  4GGA A;  2IUV A;  2J57 G;  4FB1 D;  3EI1 B;  1K32 A;  3RN1 D;  2AGL A;  3IKO A;  5TEE A;  4ZN4 A;  5C9Z B;  3IJ0 A;  2H14 A;  2TRC B;  4CZX A;  3E0C A;  5EAP A;  2YNP A;  2HKM A;  3IIW A;  2H47 A;  3ULE C;  2XYI A;  5GXH A;  4YVD A;  2AGZ A;  5HE3 B;  3PSL A;  2B5L A;  4J73 A;  3PVU B;  4A0A B;  4GQ1 A;  2H6N A;  5CXB A;  3C9C A;  4PSX B;  4A08 B;  5H1M A;  3JZH A;  4MK0 B;  3DXM C;  4BH6 A;  4JXM A;  4J84 A;  5TDH B; 
#chains in the Genus database with same CATH topology
 3UKR C;  5K1C C;  5EMM B;  3SLE D;  4G55 A;  4OWR A;  3I2N A;  5E6R A;  2OK6 A;  2XL2 A;  3EI2 A;  3SWS D;  3SFZ A;  3V4P A;  2PBI B;  4E5Z A;  4ZOX A;  2XZG A;  1BPO A;  3PXS D;  4NBM A;  4AMZ A;  4WK2 A;  3U4Y A;  3UVL A;  4J0X A;  2BKL A;  3MVD K;  3I7O A;  4MMZ A;  2Q7Q A;  5C2W B;  3IUN A;  3OL2 A;  4NC4 A;  2GNQ A;  1GOH A;  2P9K C;  1JMZ B;  3P4F A;  1PBY B;  1GOG A;  3AL8 B;  2AGY A;  4BP9 A;  5AJA A;  3NVX A;  3W15 A;  4ZOY A;  3O4H A;  3OF7 A;  2I0T A;  2YNO A;  3DDU A;  5AMS A;  5I5I A;  3IUJ A;  1QFS A;  3B7F A;  4GGD A;  2PM9 B;  4X3E A;  4JT5 C;  3SMR A;  3RMZ D;  5HQG A;  1GXR A;  1JTD B;  3PXT D;  2VDN A;  3JAM g;  2H9M A;  4QRJ A;  5GXI A;  4D9S A;  3KRW B;  5AFU 3;  4WJK A;  4A11 B;  3SVW D;  2OVP B;  3I8E A;  5HDB A;  3PXW D;  4IRZ A;  4X61 B;  3EI3 B;  1VZ3 A;  3CIK B;  5KDO B;  3EQ9 A;  3AL9 A;  1QFM A;  5FLX g;  5K19 A;  4CC9 A;  4TZ4 A;  3OKY B;  4UM8 A;  2B4E A;  5FXY A;  3KRX B;  1U4C A;  5IJ8 E;  1VE6 A;  1GG2 B;  4AEZ A;  2CO0 C;  2EID A;  3JZN A;  3VI4 A;  3I7K A;  1A0R B;  5FKT A;  2AGX A;  2P9U C;  3RRM C;  3K6S A;  3EI4 B;  3AL8 A;  4HDJ A;  4E54 B;  3KCI A;  4MMY A;  1H2W A;  4WK0 A;  3N0E A;  4X63 B;  3SJL D;  1MDA H;  1R5M A;  3SBR A;  5M5V A;  3VH0 A;  3C5M A;  4JSV C;  4ERQ A;  2I3T A;  3K72 A;  4JT6 C;  4RE6 A;  4AMY A;  2J55 H;  4CY3 A;  4U1E I;  4RE5 A;  3O4I A;  4GMB A;  4FA5 D;  1L0Q A;  4G1M A;  3UR4 A;  3VGZ A;  5CYK B;  2P9S C;  3MUO A;  3V7D B;  5C92 A;  3GC3 B;  1H2Z A;  4LGN A;  2JKX A;  4A0B A;  4H5I A;  2H9N A;  4QL1 A;  3OTT A;  3UVO A;  2QZP A;  3JPX A;  4L1M A;  4LG8 A;  4CY2 A;  4LG9 A;  4PXW A;  4L9O A;  4KFM B;  1U8C A;  3RFG A;  4CI8 A;  4H5J A;  2G9A A;  2P9L C;  2BCJ B;  5EMK B;  2HKR A;  5FQD A;  5GMK n;  4CI3 A;  2P9N C;  1TBG A;  1B9Y A;  2PM7 B;  3OW8 A;  4A09 A;  4AN1 A;  2YNN A;  3HFQ A;  4Z8L A;  2CE8 A;  2OIZ A;  3CFV A;  2CNX A;  2Z2N A;  4A2L A;  3EU7 A;  1L5G A;  2H13 A;  3I7N A;  4G56 B;  2GC4 A;  4FWW A;  2CE9 A;  1VYH C;  2XL3 A;  2IUP A;  1TYQ C;  5HE1 B;  3NID A;  5HE2 B;  4PBY A;  5EML B;  3SBQ A;  1TYE A;  4K3I D;  2HJ4 A;  1U2V C;  4JHP C;  1M1X A;  5FKQ A;  2XE4 A;  1RI6 A;  2OVQ B;  4GQB B;  3UVK A;  2HU7 A;  5IGQ A;  4OZU A;  5EM2 B;  1C9L A;  2EIB A;  2Z2O A;  4FHL A;  1O6F A;  3VA6 A;  3EG6 A;  3SCY A;  5CXC B;  3MZK A;  4CI2 A;  3AFC A;  5FA5 B;  4FA4 D;  4L3G D;  4ERZ A;  4ERY A;  3EQ8 A;  4DNU A;  3ZDX A;  1YR2 A;  2HES X;  1JMX B;  3RN0 D;  3EI1 A;  4BCD A;  2H68 A;  3ORV D;  3QI0 A;  4O9D A;  4GZ8 A;  1VZ2 A;  3FGB A;  3OKW A;  4AN0 A;  2IUQ A;  4XYH A;  2P9P C;  2B5N A;  4GM3 A;  1S4U X;  3VI3 A;  2O9K A;  5H14 A;  3IJE A;  3EWE A;  1PI6 A;  4J0W A;  5HE0 B;  3JRO A;  5IJ7 E;  3PVW B;  4A0A A;  1VE7 A;  3J80 g;  5GSA A;  2OK4 A;  5M5U A;  4J86 A;  2I0R A;  2IUR A;  1B9X A;  4A08 A;  2IWF A;  5EAR A;  3V5W B;  5JWZ A;  3MZL A;  5E6S A;  1E5T A;  3A0F A;  5M61 A;  4ZOV A;  3K26 A;  2VDQ A;  4BL0 A;  3UVN A;  1YFQ A;  1N6F A;  3IVM A;  3IUL A;  4CY5 A;  4QQE A;  1XKS A;  2J56 H;  4CI1 A;  3I7P A;  3DXK C;  4DNW A;  3T3P A;  1OMW B;  2WQ8 A;  3EMH A;  1E8M A;  2XU7 A;  3ZDY A;  2CN2 A;  4FA9 D;  4IA9 A;  1N6D A;  3GRE A;  4X60 B;  5EMJ B;  1XHM A;  2HU8 A;  4EWR A;  2YBA A;  5C2V B;  2I0S A;  3SBP A;  5H17 A;  2VDR A;  4QAM A;  3DWL C;  2VDM A;  3ZWL B;  3GFC A;  3BG0 A;  4JSX C;  2PM9 A;  1H2Y A;  5CXB B;  1K3I A;  4J82 A;  3BWS A;  3V4V A;  4GM8 A;  2VZ3 A;  2CN3 A;  5EAL A;  4AOW A;  3F3F A;  5EAM A;  2HYE A;  2VC2 A;  4GGC A;  4ESG A;  4FAV D;  4A11 A;  3C75 H;  3I7H A;  1QNI A;  3EI2 B;  3T3M A;  3FCU A;  3IUQ A;  3EI3 A;  4IMM A;  4AX4 A;  4J87 A;  3PE7 A;  4BP8 A;  4O3T B;  2H6K A;  3OKY A;  4I79 A;  2CO0 A;  4L1Q D;  4PC0 A;  3OL2 B;  2IWK A;  2AQ5 A;  4Y5R D;  3UVM A;  5I5J A;  5FKR A;  2EIC A;  4D6V A;  3EQ7 A;  2Z2P A;  1UOO A;  2AH1 A;  1ERJ A;  2EBS A;  3ZE1 A;  5HYN B;  2MTA H;  1NEX B;  1P22 A;  3AH8 B;  4UM9 A;  3GD1 I;  1E8N A;  2YB8 B;  1K8K C;  4J78 A;  3EI4 A;  4E54 A;  4Z7O A;  4N14 A;  1JOF A;  4L3H D;  4WK4 A;  4NAA A;  3L4O D;  3K71 A;  3OKT A;  2HU5 A;  4QT8 A;  4CY1 A;  3L4M D;  2HXC A;  3IJ1 A;  3SXT D;  4Z7N A;  2QXV A;  2HJB A;  4NEN A;  5CYK A;  2VDO A;  3F3P A;  1C9I A;  2PM6 B;  3O4J A;  5FFO A;  4XEI C;  2QC5 A;  4GQ2 P;  1H2X A;  4O1Q D;  2YMU A;  3DM0 A;  3MMY A;  3JRP A;  2H6Q A;  4J77 A;  3SN6 B;  4Z7Q A;  3N0D A;  4O2W A;  5IC7 A;  1GOT B;  4U7A A;  2P9I C;  4BCB A;  1JJU B;  2XDW A;  1PEV A;  3FM0 A;  3NVQ A;  3NIG A;  4UI9 R;  4FAN D;  5M5S A;  3JZG A;  1SQ9 A;  4A2M A;  3IIY A;  1O6G A;  1OLZ A;  1PGU A;  3MXX A;  4D0K A;  2G99 A;  3QHY B;  4BCC A;  4JSN C;  3FCS A;  5TF2 A;  3ZE0 A;  5I5M A;  3I8C A;  5FKS A;  2AH0 A;  4GM9 A;  1Q47 A;  1UOP A;  2H9L A;  2OVR B;  2UZY B;  3J81 g;  3JB9 L;  5M5R A;  2IAA A;  2AGW A;  4CZY A;  4PNK B;  3IUM A;  5C86 A;  2VDP A;  4JD2 C;  2UZX B;  2VDL A;  5EM2 A;  1MG2 A;  1SHY B;  1UOQ A;  3I89 A;  5TEF A;  4A0B B;  3V9F A;  4FA1 D;  3K27 A;  5CXC A;  4CZV A;  3I7L A;  4Y7R A;  5SXM A;  3NVN A;  2W18 A;  3RFH A;  4PBZ A;  4ZOZ A;  3BG1 A;  2VZ1 A;  3MKQ A;  5B4W A;  3C99 A;  3IJC A;  4A09 B;  5E6U A;  5THA A;  2VDK A;  3ODT A;  3F3G A;  3MKS B;  2H3X A;  5FFG A;  3ZE2 A;  4ES0 A;  4XYI A;  4R7A B;  1GP2 B;  4MMX A;  5IGO A;  2B5M A;  3RSE C;  4JSP C;  4A7J A;  1MG3 A;  1A12 A;  4J8G A;  2BBK H;  2I3S A;  3PSC B;  3RLM D;  3UKU C;  1N6E A;  4BUJ C;  4O3U B;  4PSW B;  4J79 A;  4NSX A;  1XIP A;  1T2X A;  4O02 A;  1SQJ A;  3SHF A;  5IT9 g;  1UTC A;  2GC7 A;  3ZDZ A;  4K3J B;  1GOF A;  4E5Z B;  5A2Q g;  4J8B A;  4JHN A;  3FRX A;  4J81 A;  1NR0 A;  3CFS B;  2H9P A;  4O45 A;  2OJY A;  5M5T A;  1FWX A;  1JV2 A;  4GGA A;  2IUV A;  2EIE A;  2J57 G;  4FB1 D;  3EI1 B;  1K32 A;  3RN1 D;  2AGL A;  3IKO A;  5TEE A;  4ZN4 A;  5C9Z B;  3IJ0 A;  3MUN A;  2H14 A;  2TRC B;  4CZX A;  3E0C A;  5EAP A;  2YNP A;  2HKM A;  2QR5 A;  3NIF A;  4JXM A;  3IIW A;  2H47 A;  3ULE C;  2XYI A;  5GXH A;  1I2M B;  4YVD A;  2AGZ A;  4G1E A;  5HE3 B;  3PSL A;  2B5L A;  4J73 A;  3O4G A;  3PVU B;  4A0A B;  4GQ1 A;  2H6N A;  5CXB A;  3C9C A;  4DNV A;  4PSX B;  4A08 B;  5H1M A;  3JZH A;  3IUR A;  4MK0 B;  3DXM C;  4BH6 A;  3DSM A;  4J84 A;  5TDH B; 
#chains in the Genus database with same CATH homology
 3UKR C;  5K1C C;  5EMM B;  3SLE D;  4OWR A;  3I2N A;  2OK6 A;  2XL2 A;  3EI2 A;  3SWS D;  3SFZ A;  2PBI B;  4E5Z A;  4ZOX A;  3PXS D;  3U4Y A;  3UVL A;  4J0X A;  3I7O A;  2Q7Q A;  5C2W B;  3OL2 A;  2GNQ A;  2P9K C;  1JMZ B;  3P4F A;  1PBY B;  3AL8 B;  2AGY A;  5AJA A;  3NVX A;  3W15 A;  4ZOY A;  2I0T A;  2YNO A;  5AMS A;  5I5I A;  3B7F A;  4GGD A;  2PM9 B;  4X3E A;  4JT5 C;  3SMR A;  3RMZ D;  5HQG A;  1GXR A;  3PXT D;  3JAM g;  2H9M A;  4QRJ A;  5GXI A;  3KRW B;  5AFU 3;  4A11 B;  3SVW D;  2OVP B;  3I8E A;  3PXW D;  4X61 B;  3EI3 B;  3CIK B;  5KDO B;  3AL9 A;  5FLX g;  5K19 A;  4CC9 A;  4TZ4 A;  3OKY B;  2B4E A;  5FXY A;  3KRX B;  1U4C A;  5IJ8 E;  1GG2 B;  4AEZ A;  2CO0 C;  3JZN A;  3I7K A;  1A0R B;  5FKT A;  2AGX A;  2P9U C;  3RRM C;  3EI4 B;  3AL8 A;  4HDJ A;  4E54 B;  4X63 B;  3N0E A;  3SJL D;  1MDA H;  1R5M A;  3SBR A;  3VH0 A;  3C5M A;  4JSV C;  4ERQ A;  2I3T A;  4JT6 C;  2J55 H;  4CY3 A;  4U1E I;  4GMB A;  4FA5 D;  1L0Q A;  3UR4 A;  3VGZ A;  5CYK B;  2P9S C;  3V7D B;  4LGN A;  4A0B A;  4H5I A;  2H9N A;  4QL1 A;  3OTT A;  3UVO A;  3JPX A;  4LG8 A;  4CY2 A;  4LG9 A;  4PXW A;  4L9O A;  4KFM B;  3RFG A;  4CI8 A;  4H5J A;  2G9A A;  2P9L C;  2BCJ B;  5EMK B;  2HKR A;  5FQD A;  5GMK n;  4CI3 A;  2P9N C;  1TBG A;  1B9Y A;  2PM7 B;  3OW8 A;  4A09 A;  2YNN A;  3HFQ A;  4Z8L A;  2CE8 A;  2OIZ A;  3CFV A;  2CNX A;  2Z2N A;  4A2L A;  3EU7 A;  2H13 A;  3I7N A;  4G56 B;  2GC4 A;  4FWW A;  2CE9 A;  1VYH C;  2XL3 A;  2IUP A;  1TYQ C;  5HE1 B;  5HE2 B;  4PBY A;  5EML B;  3SBQ A;  4K3I D;  2HJ4 A;  1U2V C;  5FKQ A;  1RI6 A;  2OVQ B;  4GQB B;  3UVK A;  5IGQ A;  4OZU A;  5EM2 B;  2Z2O A;  4FHL A;  3VA6 A;  3EG6 A;  3SCY A;  5CXC B;  3MZK A;  4CI2 A;  3AFC A;  5FA5 B;  4FA4 D;  4L3G D;  4ERZ A;  3DSM A;  4ERY A;  2HES X;  1JMX B;  3RN0 D;  3EI1 A;  2H68 A;  3ORV D;  4O9D A;  4GZ8 A;  3FGB A;  3OKW A;  2IUQ A;  4XYH A;  2P9P C;  2B5N A;  4GM3 A;  1S4U X;  2O9K A;  5H14 A;  3EWE A;  1PI6 A;  4J0W A;  5HE0 B;  3JRO A;  5IJ7 E;  3PVW B;  4A0A A;  3J80 g;  5GSA A;  2OK4 A;  4J86 A;  2I0R A;  2IUR A;  1B9X A;  4A08 A;  2IWF A;  5EAR A;  3V5W B;  5JWZ A;  3MZL A;  3A0F A;  4ZOV A;  3K26 A;  4BL0 A;  3UVN A;  1YFQ A;  1N6F A;  4CY5 A;  4QQE A;  1XKS A;  2J56 H;  4CI1 A;  3I7P A;  3DXK C;  1OMW B;  3EMH A;  2XU7 A;  2CN2 A;  4FA9 D;  4IA9 A;  1N6D A;  3GRE A;  4X60 B;  5EMJ B;  1XHM A;  5C2V B;  4EWR A;  2YBA A;  2I0S A;  3SBP A;  5H17 A;  3DWL C;  3ZWL B;  3GFC A;  3BG0 A;  4JSX C;  2PM9 A;  5CXB B;  4J82 A;  3BWS A;  4GM8 A;  2CN3 A;  5EAL A;  4AOW A;  3F3F A;  5EAM A;  2HYE A;  4GGC A;  4ESG A;  4FAV D;  4A11 A;  3C75 H;  3I7H A;  1QNI A;  3EI2 B;  3EI3 A;  4IMM A;  4J87 A;  3PE7 A;  4O3T B;  2H6K A;  3OKY A;  4I79 A;  2CO0 A;  4L1Q D;  4PC0 A;  3OL2 B;  2IWK A;  2AQ5 A;  4Y5R D;  3UVM A;  5I5J A;  5FKR A;  4D6V A;  2Z2P A;  2AH1 A;  5HYN B;  1ERJ A;  2EBS A;  2MTA H;  1NEX B;  1P22 A;  3AH8 B;  2YB8 B;  1K8K C;  4J78 A;  3EI4 A;  4E54 A;  4N14 A;  1JOF A;  4L3H D;  3L4O D;  3OKT A;  4QT8 A;  4CY1 A;  3L4M D;  2HXC A;  3IJ1 A;  3SXT D;  2QXV A;  2HJB A;  5CYK A;  3F3P A;  2PM6 B;  4XEI C;  2QC5 A;  4GQ2 P;  4O1Q D;  2YMU A;  3DM0 A;  3MMY A;  3JRP A;  2H6Q A;  4J77 A;  3SN6 B;  3N0D A;  5IC7 A;  1GOT B;  4U7A A;  2P9I C;  1JJU B;  1PEV A;  3FM0 A;  3NVQ A;  4UI9 R;  4FAN D;  3JZG A;  1SQ9 A;  4A2M A;  3IIY A;  1OLZ A;  1PGU A;  3MXX A;  4D0K A;  2G99 A;  4JSN C;  5TF2 A;  5I5M A;  3I8C A;  5FKS A;  2AH0 A;  4GM9 A;  1Q47 A;  2H9L A;  2OVR B;  2UZY B;  3J81 g;  3JB9 L;  2IAA A;  2AGW A;  4CZY A;  4PNK B;  4JD2 C;  2UZX B;  5EM2 A;  1MG2 A;  1SHY B;  3I89 A;  5TEF A;  4A0B B;  3V9F A;  4FA1 D;  3K27 A;  5CXC A;  4CZV A;  3I7L A;  4Y7R A;  5SXM A;  3NVN A;  2W18 A;  3RFH A;  4PBZ A;  4ZOZ A;  3BG1 A;  3MKQ A;  5B4W A;  3C99 A;  3IJC A;  4A09 B;  5THA A;  3ODT A;  3F3G A;  3MKS B;  2H3X A;  4ES0 A;  4XYI A;  4R7A B;  1GP2 B;  5IGO A;  2B5M A;  3RSE C;  4JSP C;  4A7J A;  1MG3 A;  4J8G A;  2BBK H;  2I3S A;  3PSC B;  3RLM D;  3UKU C;  1N6E A;  4BUJ C;  4O3U B;  4PSW B;  4J79 A;  4NSX A;  1XIP A;  1SQJ A;  3SHF A;  5IT9 g;  2GC7 A;  4K3J B;  4E5Z B;  5A2Q g;  4J8B A;  3FRX A;  4J81 A;  1NR0 A;  3CFS B;  2H9P A;  4O45 A;  2OJY A;  1FWX A;  4GGA A;  2IUV A;  2J57 G;  4FB1 D;  3EI1 B;  1K32 A;  3RN1 D;  2AGL A;  3IKO A;  5TEE A;  4ZN4 A;  5C9Z B;  3IJ0 A;  2H14 A;  2TRC B;  4CZX A;  3E0C A;  5EAP A;  2YNP A;  2HKM A;  3IIW A;  2H47 A;  3ULE C;  2XYI A;  5GXH A;  4YVD A;  2AGZ A;  5HE3 B;  3PSL A;  2B5L A;  4J73 A;  3PVU B;  4A0A B;  4GQ1 A;  2H6N A;  5CXB A;  3C9C A;  4PSX B;  4A08 B;  5H1M A;  3JZH A;  4MK0 B;  3DXM C;  4BH6 A;  4JXM A;  4J84 A;  5TDH B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...