4OWRA

Vesiculoviral matrix (m) protein occupies nucleic acid binding site at nucleoporin pair rae1-nup98
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
335
structure length
331
Chain Sequence
b'DIEVTSSPDDSIGCLSFSPPTLPGNFLIAGSWANDVRCWEVQDSGQTIPKAQQMHTGPVLDVCWSDDGSKVFTASCDKTAKMWDLSSNQAIQIAQHDAPVKTIHWIKAPNYSCVMTGSWDKTLKFWDTRSSNPMMVLQLPERCYCADVIYPMAVVATAERGLIVYQLENQPSEFRRIESPLKHQHRCVAIFKDKQNKPTGFALGSIEGRVAIHYINPPNPAKDNFTFKCHRSNSAPQDIYAVNGIAFHPVHGTLATVGSDGRFSFWDKDARTKLKTSEQLDQPISACCFNHNGNIFAYASSYDWSKGHEFYNPQKKNYIFLRNAAEELKPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords mRNA export factor
publication title Vesiculoviral matrix (M) protein occupies nucleic acid binding site at nucleoporin pair (Rae1 Nup98).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 75
structure length 331
sequence length 335
ec nomenclature
pdb deposition date 2014-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4owrA00
3IJ1A 3PXSD 4O1QD 3CIKB 3V9FA 4X60B 2OVRB 3OKYA 4GM9A 2CO0C 1XIPA 5K1CC 5AMSA 5HE2B 4X61B 3MZLA 2H9MA 3KRXB 3OW8A 1GXRA 5CYKA 2H47A 2BBKH 4J82A 3K26A 1U4CA 4LGNA 4KFMB 4FWWA 4GZ8A 4FA9D 2H9PA 4N14A 4IA9A 4ES0A 3UKRC 4EWRA 5FXYA 2I3TA 3VH0A 3MMYA 3RN0D 1OMWB 2P9UC 2HESX 2Z2PA 4CZVA 1NEXB 4D0KA 4CZYA 4FB1D 1YFQA 3RMZD 2PBIB 4FHLA 4Z8LA 2Z2NA 2OJYA 4G56B 3EMHA 1GOTB 2IUQA 2AH1A 4O3TB 2W18A 2AGLA 3U4YA 4PBYA 4ZOYA 1FWXA 4E5ZA 4A09B 5EAPA 4O9DA 3PE7A 2H9LA 1R5MA 1Q47A 2B5MA 3P4FA 3NVNA 4L3GD 1PBYB 3EI2B 4ESGA 2H68A 3UVKA 4H5JA 2GC7A 3AH8B 5HE0B 1U2VC 4E54A 3PVWB 3SJLD 1N6DA 3L4MD 3J81g 5IGOA 3EI3A 3EI1A 3DWLC 4PXWA 2PM9A 1MG2A 4X63B 3JB9L 4A0BA 4PC0A 4QQEA 4AEZA 2B5NA 4O3UB 3RFHA 4BH6A 4PSWB 4CY3A 1A0RB 4QL1A 3JZGA 3DXKC 3J80g 4ZOZA 4ZOXA 3IJCA 2HKMA 4J0WA 3SHFA 2QC5A 3V5WB 1JMXB 2J55H 2O9KA 2I0RA 3UVNA 5AFU3 4BUJC 2CE9A 3PXTD 4J87A 4R7AB 5IC7A 2XU7A 3OTTA 5TF2A 2PM6B 2GC4A 3EI3B 2IWKA 4GGCA 3I8CA 3MXXA 3ORVD 4HDJA 4GQ2P 2QXVA 3I7KA 4BL0A 2HJ4A 1MG3A 2HKRA 2P9KC 5HQGA 2IUVA 5GXHA 3SBQA 4OZUA 3SLED 4TZ4A 2UZXB 4JD2C 3L4OD 2IUPA 3I7LA 3JPXA 1PEVA 4H5IA 4CI3A 3MKQA 3EU7A 2AQ5A 4JSNC 1RI6A 3DM0A 3UKUC 2P9SC 3IKOA 4FAND 4GGAA 2J57G 5EMJB 3B7FA 5FKQA 4FAVD 1SHYB 3JZHA 2HXCA 3N0DA 4J8GA 3GREA 5FKSA 2P9LC 1SQ9A 2AGYA 4ZN4A 2OIZA 2Q7QA 4A2LA 4J73A 4I79A 5AJAA 2OVQB 3AFCA 5EMMB 4PBZA 3DSMA 3HFQA 4MK0B 1P22A 2CN2A 2IWFA 2H9NA 2G9AA 3JZNA 3OKYB 4XYIA 5GMKn 2CNXA 4J86A 3IIWA 3CFSB 4JXMA 1JJUB 3MKSB 3OKWA 4GM3A 1PI6A 5FKTA 4CZXA 4YVDA 4A08A 3RRMC 3SN6B 2CN3A 1XHMA 2H3XA 3IIYA 5CYKB 1GP2B 2P9PC 2I3SA 3NVQA 2YNPA 3AL8A 3VGZA 3NVXA 3PVUB 4CI1A 3SBPA 2AGXA 2H6QA 4A0AA 5CXCA 3CFVA 1JOFA 2MTAH 3PSCB 5FKRA 3I7PA 3JROA 4OWRA 3EI4A 1MDAH 5EARA 5EMLB 2YNNA 3RLMD 3EWEA 3UR4A 1TBGA 4U7AA 4GGDA 3I7HA 2YNOA 2YB8B 3ZWLB 4E5ZB 4JSXC 5H14A 4J8BA 5CXBA 1NR0A 3C5MA 2YMUA 3JRPA 3F3GA 3KRWB 4XEIC 5TDHB 3W15A 3I7OA 2H13A 3GFCA 4JSPC 4FA4D 2H14A 1B9YA 5EM2A 4NSXA 4E54B 4LG8A 2IURA 1JMZB 3FM0A 4CY2A 4JT6C 1XKSA 1SQJA 5GXIA 3EI1B 2I0SA 5KDOB 1K8KC 3EI4B 2H6NA 2PM9B 3ULEC 4A0BB 3A0FA 4CY1A 5EALA 4QT8A 4A11A 1K32A 4GMBA 1GG2B 5FQDA 5IT9g 1L0QA 2BCJB 5HE1B 4L1QD 3E0CA 5A2Qg 4J79A 2J56H 3VA6A 4CY5A 5B4WA 5HYNB 5EM2B 2AGWA 4J81A 3BG1A 4PNKB 2UZYB 2H6KA 3AL9A 3F3PA 4ERQA 5I5JA 3F3FA 3UVMA 1QNIA 2OVPB 2TRCB 4Y5RD 2B5LA 4ERYA 3FGBA 4CI8A 2CO0A 4A09A 3BWSA 2OK6A 5FA5B 5SXMA 1N6EA 2CE8A 3UVOA 4O45A 4AOWA 4XYHA 5K19A 1PGUA 2AH0A 2GNQA 4K3JB 3EI2A 4A11B 3PXWD 5IJ8E 2HYEA 5FLXg 5GSAA 4K3ID 1VYHC 3I89A 4A7JA 2B4EA 3I2NA 5H17A 4JT5C 2YBAA 5IJ7E 3UVLA 2EBSA 5EAMA 3SXTD 3I8EA 3OL2A 4J0XA 4FA5D 3FRXA 3PSLA 3RN1D 3RFGA 1B9XA 4U1EI 2HJBA 5JWZA 3ODTA 4JSVC 4A2MA 4X3EA 4ZOVA 1OLZA 4UI9R 2P9IC 3JAMg 3DXMC 4GQBB 5C2WB 3V7DB 3BG0A 5EMKB 5I5MA 2IAAA 5IGQA 3C75H 2I0TA 4PSXB 4J84A 3SVWD 5H1MA 4A08B 4LG9A 3C9CA 3SCYA 5C2VB 5I5IA 4D6VA 4CI2A 4J77A 5THAA 3AL8B 2G99A 3OL2B 3SFZA 4CC9A 3OKTA 2PM7B 2OK4A 3C99A 4ERZA 5TEEA 4A0AB 5CXCB 3IJ0A 4IMMA 2Z2OA 4GQ1A 3N0EA 4QRJA 4Y7RA 3SBRA 1ERJA 5C9ZB 2XL3A 5TEFA 3EG6A 4J78A 3MZKA 1TYQC 2XL2A 4FA1D 1N6FA 3SMRA 3I7NA 4L9OA 3K27A 1S4UX 3SWSD 2AGZA 3RSEC 5HE3B 4L3HD 2P9NC 4GM8A 5CXBB 2XYIA
chains in the Genus database with same CATH superfamily
3IJ1A 5E6SA 3QI0A 3PXSD 4O1QD 4JHPC 3CIKB 3V9FA 4X60B 1T2XA 2HU5A 4JHNA 2OVRB 4AMYA 3ZDXA 3OKYA 4GM9A 4DNVA 2CO0C 1XIPA 5K1CC 5AMSA 5HE2B 4X61B 3MZLA 2H9MA 3KRXB 3OW8A 1GXRA 2EICA 5CYKA 5HDBA 2H47A 2BBKH 4J82A 2JKXA 3K26A 1U4CA 4LGNA 4KFMB 4FWWA 4GZ8A 4FA9D 2H9PA 4N14A 4IA9A 4ES0A 3UKRC 4EWRA 5FXYA 2I3TA 3VH0A 3MMYA 3RN0D 1OMWB 5M5RA 5M5UA 2P9UC 2HESX 2Z2PA 4CZVA 1NEXB 4D0KA 4CZYA 4FB1D 2BKLA 1YFQA 4AX4A 3RMZD 2PBIB 4FHLA 4Z8LA 2Z2NA 2OJYA 4G56B 3NIDA 2QR5A 3EMHA 1GOTB 2IUQA 2AH1A 4O3TB 2W18A 2AGLA 3U4YA 1C9LA 4PBYA 4ZOYA 1FWXA 4E5ZA 4A09B 5EAPA 4G55A 4O9DA 3PE7A 2H9LA 1R5MA 1Q47A 2B5MA 3P4FA 3NVNA 4L3GD 4BCCA 1JTDB 1PBYB 3EI2B 4ESGA 2H68A 3UVKA 4H5JA 3ZE1A 2GC7A 3AH8B 5HE0B 1A12A 1U2VC 2VDQA 4E54A 3K6SA 2QZPA 3PVWB 3IVMA 3SJLD 3IUMA 5M5TA 1N6DA 1E8MA 1GOFA 3L4MD 1K3IA 3J81g 5IGOA 3EI3A 4WK4A 3K71A 3EI1A 3DWLC 5M5VA 4PXWA 3GD1I 2PM9A 1MG2A 4X63B 3JB9L 3IUQA 4A0BA 4PC0A 4QQEA 2WQ8A 4AEZA 2B5NA 4O3UB 3RFHA 4BH6A 4PSWB 4CY3A 1A0RB 4QL1A 3JZGA 4BP8A 3DXKC 3J80g 4ZOZA 1UOPA 4ZOXA 1UTCA 3IJCA 2HKMA 3V4VA 4J0WA 5FFOA 3SHFA 2QC5A 3T3MA 3V5WB 1JMXB 2J55H 4MMXA 2O9KA 5C86A 2I0RA 3UVNA 5AFU3 1I2MB 5M5SA 4BUJC 2CE9A 3PXTD 4J87A 4R7AB 2VDLA 5IC7A 2XU7A 3OTTA 5TF2A 2PM6B 2GC4A 3EI3B 2IWKA 4GGCA 3I8CA 3MXXA 4WJKA 1UOOA 3ORVD 3OF7A 4HDJA 4GQ2P 2QXVA 3I7KA 4BL0A 2HU8A 2HJ4A 1MG3A 2HKRA 2VZ3A 2P9KC 3O4GA 5HQGA 2IUVA 5GXHA 3SBQA 4OZUA 3SLED 4TZ4A 1H2ZA 2UZXB 4JD2C 4RE5A 3L4OD 2IUPA 3I7LA 3JPXA 1PEVA 4H5IA 4CI3A 1TYEA 2VDPA 3EU7A 3MKQA 2AQ5A 3T3PA 4JSNC 4D9SA 1RI6A 3VI3A 4L1MA 3DM0A 3UKUC 2P9SC 3IKOA 4NAAA 4GGAA 4FAND 2J57G 5EMJB 4WK2A 3B7FA 5FKQA 5E6UA 2XE4A 4FAVD 1SHYB 3JZHA 2HXCA 3N0DA 1M1XA 4J8GA 3GREA 1H2WA 5FKSA 2P9LC 1SQ9A 2AGYA 2VDMA 2OIZA 4ZN4A 2Q7QA 4A2LA 2EIBA 2XZGA 4J73A 4G1MA 4I79A 5AJAA 5C92A 2OVQB 3AFCA 5EMMB 4PBZA 3DSMA 3HFQA 4MK0B 4QAMA 1P22A 2CN2A 2IWFA 2H9NA 3KCIA 2G9AA 3JZNA 3OKYB 4IRZA 4XYIA 5GMKn 1H2XA 2CNXA 3FCSA 3IUJA 4J86A 3IIWA 3CFSB 2XDWA 4DNWA 4JXMA 1JJUB 3MKSB 3OKWA 4GM3A 1PI6A 3EQ9A 4UM8A 5FKTA 4CZXA 4YVDA 4A08A 3RRMC 3SN6B 3K72A 2CN3A 1XHMA 2H3XA 3IIYA 5CYKB 3NIFA 4MMYA 1GP2B 2P9PC 1H2YA 2I3SA 5E6RA 3IUNA 3NVQA 2YNPA 3AL8A 3VGZA 4O02A 1BPOA 3NVXA 3PVUB 4CI1A 2VDRA 3SBPA 1YR2A 2AGXA 2H6QA 4A0AA 5CXCA 3EQ7A 3CFVA 1JOFA 2MTAH 3PSCB 5FKRA 4NBMA 3I7PA 3JROA 4OWRA 1GOHA 3EI4A 1MDAH 4AN1A 5EARA 5EMLB 2YNNA 4BCBA 3RLMD 3EWEA 3UR4A 1TBGA 4U7AA 4GGDA 3MVDK 3I7HA 1U8CA 2YNOA 2YB8B 3ZWLB 4E5ZB 2VC2A 4JSXC 1UOQA 5H14A 4J8BA 5CXBA 1NR0A 3C5MA 4AMZA 2YMUA 3JRPA 2VZ1A 3F3GA 3KRWB 4XEIC 5TDHB 3W15A 3I7OA 1QFSA 2H13A 3GFCA 4JSPC 4FA4D 4NC4A 2H14A 3V4PA 1B9YA 5EM2A 3O4JA 4NSXA 4E54B 4LG8A 2IURA 1JMZB 3FM0A 4CY2A 4JT6C 3IJEA 3IULA 1XKSA 1SQJA 5GXIA 3EI1B 2I0SA 5KDOB 4Z7OA 1K8KC 3EI4B 2H6NA 2PM9B 3ULEC 4A0BB 3A0FA 4CY1A 1VZ3A 5EALA 4QT8A 4A11A 1K32A 4GMBA 4DNUA 1GG2B 5FQDA 5IT9g 1L0QA 2BCJB 3NIGA 5HE1B 3FCUA 4L1QD 3E0CA 5A2Qg 3ZDYA 4J79A 2J56H 3VA6A 4CY5A 5B4WA 5HYNB 5EM2B 2AGWA 4J81A 2HU7A 3BG1A 2EIEA 2UZYB 4PNKB 2H6KA 3AL9A 3F3PA 4ERQA 5I5JA 3F3FA 1VE7A 2VDNA 3UVMA 3QHYB 4RE6A 3O4IA 1QNIA 2OVPB 2TRCB 4Y5RD 2B5LA 4ERYA 3FGBA 4CI8A 2CO0A 4A09A 3BWSA 2EIDA 2OK6A 5FA5B 3MUNA 5SXMA 2CE8A 1N6EA 5M61A 3UVOA 4O45A 4AOWA 4BCDA 4XYHA 5K19A 1PGUA 2AH0A 3VI4A 2GNQA 4K3JB 3EI2A 1O6GA 4UM9A 1JV2A 3PXWD 4A11B 5IJ8E 2HYEA 3ZE2A 5FLXg 5GSAA 4K3ID 1VYHC 3I89A 4Z7QA 3GC3B 4A7JA 2B4EA 3I2NA 1GOGA 5H17A 4JT5C 2YBAA 5IJ7E 3ZE0A 3UVLA 2EBSA 5EAMA 3SXTD 3I8EA 3OL2A 4J0XA 4WK0A 1L5GA 4FA5D 3FRXA 3PSLA 3RN1D 3RFGA 3ZDZA 1B9XA 4U1EI 2HJBA 5JWZA 2VDKA 3ODTA 1E8NA 4JSVC 4A2MA 4X3EA 4ZOVA 4G1EA 1OLZA 4UI9R 2P9IC 3JAMg 3DXMC 4GQBB 5C2WB 3V7DB 3BG0A 5EMKB 5I5MA 2IAAA 5IGQA 3C75H 2I0TA 3MUOA 3O4HA 1C9IA 4PSXB 4J84A 3SVWD 5H1MA 4A08B 4LG9A 3C9CA 3SCYA 5C2VB 5I5IA 4D6VA 4CI2A 4J77A 5THAA 3AL8B 2G99A 3OL2B 4BP9A 3SFZA 4CC9A 1QFMA 3OKTA 2PM7B 2OK4A 3C99A 4ERZA 1E5TA 5TEEA 1VE6A 4A0AB 4Z7NA 5CXCB 3IJ0A 4IMMA 2Z2OA 4GQ1A 3DDUA 3N0EA 4QRJA 4Y7RA 3SBRA 1ERJA 5C9ZB 2XL3A 5TEFA 3EG6A 4J78A 3MZKA 1TYQC 2VDOA 4MMZA 2XL2A 4FA1D 1N6FA 3EQ8A 1VZ2A 3IURA 3I7NA 3SMRA 4L9OA 3K27A 1S4UX 4AN0A 3SWSD 2AGZA 5FFGA 3RSEC 5HE3B 4L3HD 4O2WA 4NENA 2P9NC 1O6FA 4GM8A 5CXBB 2XYIA
chains in the Genus database with same CATH topology
3IJ1A 3PXSD 4O1QD 3CIKB 3V9FA 4X60B 2OVRB 3OKYA 4GM9A 2CO0C 1XIPA 5K1CC 5AMSA 5HE2B 4X61B 3MZLA 2H9MA 3KRXB 3OW8A 1GXRA 5CYKA 2H47A 2BBKH 4J82A 3K26A 1U4CA 4LGNA 4KFMB 4FWWA 4GZ8A 4FA9D 2H9PA 4N14A 4IA9A 4ES0A 3UKRC 4EWRA 5FXYA 2I3TA 3VH0A 3MMYA 3RN0D 1OMWB 2P9UC 2HESX 2Z2PA 4CZVA 1NEXB 4D0KA 4CZYA 4FB1D 1YFQA 3RMZD 2PBIB 4FHLA 4Z8LA 2Z2NA 2OJYA 4G56B 3EMHA 1GOTB 2IUQA 2AH1A 4O3TB 2W18A 2AGLA 3U4YA 4PBYA 4ZOYA 1FWXA 4E5ZA 4A09B 5EAPA 4O9DA 3PE7A 2H9LA 1R5MA 1Q47A 2B5MA 3P4FA 3NVNA 4L3GD 1PBYB 3EI2B 4ESGA 2H68A 3UVKA 4H5JA 2GC7A 3AH8B 5HE0B 1U2VC 4E54A 3PVWB 3SJLD 1N6DA 3L4MD 3J81g 5IGOA 3EI3A 3EI1A 3DWLC 4PXWA 2PM9A 1MG2A 4X63B 3JB9L 4A0BA 4PC0A 4QQEA 4AEZA 2B5NA 4O3UB 3RFHA 4BH6A 4PSWB 4CY3A 1A0RB 4QL1A 3JZGA 3DXKC 3J80g 4ZOZA 4ZOXA 3IJCA 2HKMA 4J0WA 3SHFA 2QC5A 3V5WB 1JMXB 2J55H 2O9KA 2I0RA 3UVNA 5AFU3 4BUJC 2CE9A 3PXTD 4J87A 4R7AB 5IC7A 2XU7A 3OTTA 5TF2A 2PM6B 2GC4A 3EI3B 2IWKA 4GGCA 3I8CA 3MXXA 3ORVD 4HDJA 4GQ2P 2QXVA 3I7KA 4BL0A 2HJ4A 1MG3A 2HKRA 2P9KC 5HQGA 2IUVA 5GXHA 3SBQA 4OZUA 3SLED 4TZ4A 2UZXB 4JD2C 3L4OD 2IUPA 3I7LA 3JPXA 1PEVA 4H5IA 4CI3A 3MKQA 3EU7A 2AQ5A 4JSNC 1RI6A 3DM0A 3UKUC 2P9SC 3IKOA 4FAND 4GGAA 2J57G 5EMJB 3B7FA 5FKQA 4FAVD 1SHYB 3JZHA 2HXCA 3N0DA 4J8GA 3GREA 5FKSA 2P9LC 1SQ9A 2AGYA 4ZN4A 2OIZA 2Q7QA 4A2LA 4J73A 4I79A 5AJAA 2OVQB 3AFCA 5EMMB 4PBZA 3DSMA 3HFQA 4MK0B 1P22A 2CN2A 2IWFA 2H9NA 2G9AA 3JZNA 3OKYB 4XYIA 5GMKn 2CNXA 4J86A 3IIWA 3CFSB 4JXMA 1JJUB 3MKSB 3OKWA 4GM3A 1PI6A 5FKTA 4CZXA 4YVDA 4A08A 3RRMC 3SN6B 2CN3A 1XHMA 2H3XA 3IIYA 5CYKB 1GP2B 2P9PC 2I3SA 3NVQA 2YNPA 3AL8A 3VGZA 3NVXA 3PVUB 4CI1A 3SBPA 2AGXA 2H6QA 4A0AA 5CXCA 3CFVA 1JOFA 2MTAH 3PSCB 5FKRA 3I7PA 3JROA 4OWRA 3EI4A 1MDAH 5EARA 5EMLB 2YNNA 3RLMD 3EWEA 3UR4A 1TBGA 4U7AA 4GGDA 3I7HA 2YNOA 2YB8B 3ZWLB 4E5ZB 4JSXC 5H14A 4J8BA 5CXBA 1NR0A 3C5MA 2YMUA 3JRPA 3F3GA 3KRWB 4XEIC 5TDHB 3W15A 3I7OA 2H13A 3GFCA 4JSPC 4FA4D 2H14A 1B9YA 5EM2A 4NSXA 4E54B 4LG8A 2IURA 1JMZB 3FM0A 4CY2A 4JT6C 1XKSA 1SQJA 5GXIA 3EI1B 2I0SA 5KDOB 1K8KC 3EI4B 2H6NA 2PM9B 3ULEC 4A0BB 3A0FA 4CY1A 5EALA 4QT8A 4A11A 1K32A 4GMBA 1GG2B 5FQDA 5IT9g 1L0QA 2BCJB 5HE1B 4L1QD 3E0CA 5A2Qg 4J79A 2J56H 3VA6A 4CY5A 5B4WA 5HYNB 5EM2B 2AGWA 4J81A 3BG1A 4PNKB 2UZYB 2H6KA 3AL9A 3F3PA 4ERQA 5I5JA 3F3FA 3UVMA 1QNIA 2OVPB 2TRCB 4Y5RD 2B5LA 4ERYA 3FGBA 4CI8A 2CO0A 4A09A 3BWSA 2OK6A 5FA5B 5SXMA 1N6EA 2CE8A 3UVOA 4O45A 4AOWA 4XYHA 5K19A 1PGUA 2AH0A 2GNQA 4K3JB 3EI2A 4A11B 3PXWD 5IJ8E 2HYEA 5FLXg 5GSAA 4K3ID 1VYHC 3I89A 4A7JA 2B4EA 3I2NA 5H17A 4JT5C 2YBAA 5IJ7E 3UVLA 2EBSA 5EAMA 3SXTD 3I8EA 3OL2A 4J0XA 4FA5D 3FRXA 3PSLA 3RN1D 3RFGA 1B9XA 4U1EI 2HJBA 5JWZA 3ODTA 4JSVC 4A2MA 4X3EA 4ZOVA 1OLZA 4UI9R 2P9IC 3JAMg 3DXMC 4GQBB 5C2WB 3V7DB 3BG0A 5EMKB 5I5MA 2IAAA 5IGQA 3C75H 2I0TA 4PSXB 4J84A 3SVWD 5H1MA 4A08B 4LG9A 3C9CA 3SCYA 5C2VB 5I5IA 4D6VA 4CI2A 4J77A 5THAA 3AL8B 2G99A 3OL2B 3SFZA 4CC9A 3OKTA 2PM7B 2OK4A 3C99A 4ERZA 5TEEA 4A0AB 5CXCB 3IJ0A 4IMMA 2Z2OA 4GQ1A 3N0EA 4QRJA 4Y7RA 3SBRA 1ERJA 5C9ZB 2XL3A 5TEFA 3EG6A 4J78A 3MZKA 1TYQC 2XL2A 4FA1D 1N6FA 3SMRA 3I7NA 4L9OA 3K27A 1S4UX 3SWSD 2AGZA 3RSEC 5HE3B 4L3HD 2P9NC 4GM8A 5CXBB 2XYIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IJ1 A;  3PXS D;  4O1Q D;  3CIK B;  3V9F A;  4X60 B;  2OVR B;  3OKY A;  4GM9 A;  2CO0 C;  1XIP A;  5K1C C;  5AMS A;  5HE2 B;  4X61 B;  3MZL A;  2H9M A;  3KRX B;  3OW8 A;  1GXR A;  5CYK A;  2H47 A;  2BBK H;  4J82 A;  3K26 A;  1U4C A;  4LGN A;  4KFM B;  4FWW A;  4GZ8 A;  4FA9 D;  2H9P A;  4N14 A;  4IA9 A;  4ES0 A;  3UKR C;  4EWR A;  5FXY A;  2I3T A;  3VH0 A;  3MMY A;  3RN0 D;  1OMW B;  2P9U C;  2HES X;  2Z2P A;  4CZV A;  1NEX B;  4D0K A;  4CZY A;  4FB1 D;  1YFQ A;  3RMZ D;  2PBI B;  4FHL A;  4Z8L A;  2Z2N A;  2OJY A;  4G56 B;  3EMH A;  1GOT B;  2IUQ A;  2AH1 A;  4O3T B;  2W18 A;  2AGL A;  3U4Y A;  4PBY A;  4ZOY A;  1FWX A;  4E5Z A;  4A09 B;  5EAP A;  4O9D A;  3PE7 A;  2H9L A;  1R5M A;  1Q47 A;  2B5M A;  3P4F A;  3NVN A;  4L3G D;  1PBY B;  3EI2 B;  4ESG A;  2H68 A;  3UVK A;  4H5J A;  2GC7 A;  3AH8 B;  5HE0 B;  1U2V C;  4E54 A;  3PVW B;  3SJL D;  1N6D A;  3L4M D;  3J81 g;  5IGO A;  3EI3 A;  3EI1 A;  3DWL C;  4PXW A;  2PM9 A;  1MG2 A;  4X63 B;  3JB9 L;  4A0B A;  4PC0 A;  4QQE A;  4AEZ A;  2B5N A;  4O3U B;  3RFH A;  4BH6 A;  4PSW B;  4CY3 A;  1A0R B;  4QL1 A;  3JZG A;  3DXK C;  3J80 g;  4ZOZ A;  4ZOX A;  3IJC A;  2HKM A;  4J0W A;  3SHF A;  2QC5 A;  3V5W B;  1JMX B;  2J55 H;  2O9K A;  2I0R A;  3UVN A;  5AFU 3;  4BUJ C;  2CE9 A;  3PXT D;  4J87 A;  4R7A B;  5IC7 A;  2XU7 A;  3OTT A;  5TF2 A;  2PM6 B;  2GC4 A;  3EI3 B;  2IWK A;  4GGC A;  3I8C A;  3MXX A;  3ORV D;  4HDJ A;  4GQ2 P;  2QXV A;  3I7K A;  4BL0 A;  2HJ4 A;  1MG3 A;  2HKR A;  2P9K C;  5HQG A;  2IUV A;  5GXH A;  3SBQ A;  4OZU A;  3SLE D;  4TZ4 A;  2UZX B;  4JD2 C;  3L4O D;  2IUP A;  3I7L A;  3JPX A;  1PEV A;  4H5I A;  4CI3 A;  3MKQ A;  3EU7 A;  2AQ5 A;  4JSN C;  1RI6 A;  3DM0 A;  3UKU C;  2P9S C;  3IKO A;  4FAN D;  4GGA A;  2J57 G;  5EMJ B;  3B7F A;  5FKQ A;  4FAV D;  1SHY B;  3JZH A;  2HXC A;  3N0D A;  4J8G A;  3GRE A;  5FKS A;  2P9L C;  1SQ9 A;  2AGY A;  4ZN4 A;  2OIZ A;  2Q7Q A;  4A2L A;  4J73 A;  4I79 A;  5AJA A;  2OVQ B;  3AFC A;  5EMM B;  4PBZ A;  3DSM A;  3HFQ A;  4MK0 B;  1P22 A;  2CN2 A;  2IWF A;  2H9N A;  2G9A A;  3JZN A;  3OKY B;  4XYI A;  5GMK n;  2CNX A;  4J86 A;  3IIW A;  3CFS B;  4JXM A;  1JJU B;  3MKS B;  3OKW A;  4GM3 A;  1PI6 A;  5FKT A;  4CZX A;  4YVD A;  4A08 A;  3RRM C;  3SN6 B;  2CN3 A;  1XHM A;  2H3X A;  3IIY A;  5CYK B;  1GP2 B;  2P9P C;  2I3S A;  3NVQ A;  2YNP A;  3AL8 A;  3VGZ A;  3NVX A;  3PVU B;  4CI1 A;  3SBP A;  2AGX A;  2H6Q A;  4A0A A;  5CXC A;  3CFV A;  1JOF A;  2MTA H;  3PSC B;  5FKR A;  3I7P A;  3JRO A;  4OWR A;  3EI4 A;  1MDA H;  5EAR A;  5EML B;  2YNN A;  3RLM D;  3EWE A;  3UR4 A;  1TBG A;  4U7A A;  4GGD A;  3I7H A;  2YNO A;  2YB8 B;  3ZWL B;  4E5Z B;  4JSX C;  5H14 A;  4J8B A;  5CXB A;  1NR0 A;  3C5M A;  2YMU A;  3JRP A;  3F3G A;  3KRW B;  4XEI C;  5TDH B;  3W15 A;  3I7O A;  2H13 A;  3GFC A;  4JSP C;  4FA4 D;  2H14 A;  1B9Y A;  5EM2 A;  4NSX A;  4E54 B;  4LG8 A;  2IUR A;  1JMZ B;  3FM0 A;  4CY2 A;  4JT6 C;  1XKS A;  1SQJ A;  5GXI A;  3EI1 B;  2I0S A;  5KDO B;  1K8K C;  3EI4 B;  2H6N A;  2PM9 B;  3ULE C;  4A0B B;  3A0F A;  4CY1 A;  5EAL A;  4QT8 A;  4A11 A;  1K32 A;  4GMB A;  1GG2 B;  5FQD A;  5IT9 g;  1L0Q A;  2BCJ B;  5HE1 B;  4L1Q D;  3E0C A;  5A2Q g;  4J79 A;  2J56 H;  3VA6 A;  4CY5 A;  5B4W A;  5HYN B;  5EM2 B;  2AGW A;  4J81 A;  3BG1 A;  4PNK B;  2UZY B;  2H6K A;  3AL9 A;  3F3P A;  4ERQ A;  5I5J A;  3F3F A;  3UVM A;  1QNI A;  2OVP B;  2TRC B;  4Y5R D;  2B5L A;  4ERY A;  3FGB A;  4CI8 A;  2CO0 A;  4A09 A;  3BWS A;  2OK6 A;  5FA5 B;  5SXM A;  1N6E A;  2CE8 A;  3UVO A;  4O45 A;  4AOW A;  4XYH A;  5K19 A;  1PGU A;  2AH0 A;  2GNQ A;  4K3J B;  3EI2 A;  4A11 B;  3PXW D;  5IJ8 E;  2HYE A;  5FLX g;  5GSA A;  4K3I D;  1VYH C;  3I89 A;  4A7J A;  2B4E A;  3I2N A;  5H17 A;  4JT5 C;  2YBA A;  5IJ7 E;  3UVL A;  2EBS A;  5EAM A;  3SXT D;  3I8E A;  3OL2 A;  4J0X A;  4FA5 D;  3FRX A;  3PSL A;  3RN1 D;  3RFG A;  1B9X A;  4U1E I;  2HJB A;  5JWZ A;  3ODT A;  4JSV C;  4A2M A;  4X3E A;  4ZOV A;  1OLZ A;  4UI9 R;  2P9I C;  3JAM g;  3DXM C;  4GQB B;  5C2W B;  3V7D B;  3BG0 A;  5EMK B;  5I5M A;  2IAA A;  5IGQ A;  3C75 H;  2I0T A;  4PSX B;  4J84 A;  3SVW D;  5H1M A;  4A08 B;  4LG9 A;  3C9C A;  3SCY A;  5C2V B;  5I5I A;  4D6V A;  4CI2 A;  4J77 A;  5THA A;  3AL8 B;  2G99 A;  3OL2 B;  3SFZ A;  4CC9 A;  3OKT A;  2PM7 B;  2OK4 A;  3C99 A;  4ERZ A;  5TEE A;  4A0A B;  5CXC B;  3IJ0 A;  4IMM A;  2Z2O A;  4GQ1 A;  3N0E A;  4QRJ A;  4Y7R A;  3SBR A;  1ERJ A;  5C9Z B;  2XL3 A;  5TEF A;  3EG6 A;  4J78 A;  3MZK A;  1TYQ C;  2XL2 A;  4FA1 D;  1N6F A;  3SMR A;  3I7N A;  4L9O A;  3K27 A;  1S4U X;  3SWS D;  2AGZ A;  3RSE C;  5HE3 B;  4L3H D;  2P9N C;  4GM8 A;  5CXB B;  2XYI A; 
#chains in the Genus database with same CATH topology
 3IJ1 A;  5E6S A;  3QI0 A;  3PXS D;  4O1Q D;  4JHP C;  3CIK B;  3V9F A;  4X60 B;  1T2X A;  2HU5 A;  4JHN A;  2OVR B;  4AMY A;  3ZDX A;  3OKY A;  4GM9 A;  4DNV A;  2CO0 C;  1XIP A;  5K1C C;  5AMS A;  5HE2 B;  4X61 B;  3MZL A;  2H9M A;  3KRX B;  3OW8 A;  1GXR A;  2EIC A;  5CYK A;  5HDB A;  2H47 A;  2BBK H;  4J82 A;  2JKX A;  3K26 A;  1U4C A;  4LGN A;  4KFM B;  4FWW A;  4GZ8 A;  4FA9 D;  2H9P A;  4N14 A;  4IA9 A;  4ES0 A;  3UKR C;  4EWR A;  5FXY A;  2I3T A;  3VH0 A;  3MMY A;  3RN0 D;  1OMW B;  5M5R A;  5M5U A;  2P9U C;  2HES X;  2Z2P A;  4CZV A;  1NEX B;  4D0K A;  4CZY A;  4FB1 D;  2BKL A;  1YFQ A;  4AX4 A;  3RMZ D;  2PBI B;  4FHL A;  4Z8L A;  2Z2N A;  2OJY A;  4G56 B;  3NID A;  2QR5 A;  3EMH A;  1GOT B;  2IUQ A;  2AH1 A;  4O3T B;  2W18 A;  2AGL A;  3U4Y A;  1C9L A;  4PBY A;  4ZOY A;  1FWX A;  4E5Z A;  4A09 B;  5EAP A;  4G55 A;  4O9D A;  3PE7 A;  2H9L A;  1R5M A;  1Q47 A;  2B5M A;  3P4F A;  3NVN A;  4L3G D;  4BCC A;  1JTD B;  1PBY B;  3EI2 B;  4ESG A;  2H68 A;  3UVK A;  4H5J A;  3ZE1 A;  2GC7 A;  3AH8 B;  5HE0 B;  1A12 A;  1U2V C;  2VDQ A;  4E54 A;  3K6S A;  2QZP A;  3PVW B;  3IVM A;  3SJL D;  3IUM A;  5M5T A;  1N6D A;  1E8M A;  1GOF A;  3L4M D;  1K3I A;  3J81 g;  5IGO A;  3EI3 A;  4WK4 A;  3K71 A;  3EI1 A;  3DWL C;  5M5V A;  4PXW A;  3GD1 I;  2PM9 A;  1MG2 A;  4X63 B;  3JB9 L;  3IUQ A;  4A0B A;  4PC0 A;  4QQE A;  2WQ8 A;  4AEZ A;  2B5N A;  4O3U B;  3RFH A;  4BH6 A;  4PSW B;  4CY3 A;  1A0R B;  4QL1 A;  3JZG A;  4BP8 A;  3DXK C;  3J80 g;  4ZOZ A;  1UOP A;  4ZOX A;  1UTC A;  3IJC A;  2HKM A;  3V4V A;  4J0W A;  5FFO A;  3SHF A;  2QC5 A;  3T3M A;  3V5W B;  1JMX B;  2J55 H;  4MMX A;  2O9K A;  5C86 A;  2I0R A;  3UVN A;  5AFU 3;  1I2M B;  5M5S A;  4BUJ C;  2CE9 A;  3PXT D;  4J87 A;  4R7A B;  2VDL A;  5IC7 A;  2XU7 A;  3OTT A;  5TF2 A;  2PM6 B;  2GC4 A;  3EI3 B;  2IWK A;  4GGC A;  3I8C A;  3MXX A;  4WJK A;  1UOO A;  3ORV D;  3OF7 A;  4HDJ A;  4GQ2 P;  2QXV A;  3I7K A;  4BL0 A;  2HU8 A;  2HJ4 A;  1MG3 A;  2HKR A;  2VZ3 A;  2P9K C;  3O4G A;  5HQG A;  2IUV A;  5GXH A;  3SBQ A;  4OZU A;  3SLE D;  4TZ4 A;  1H2Z A;  2UZX B;  4JD2 C;  4RE5 A;  3L4O D;  2IUP A;  3I7L A;  3JPX A;  1PEV A;  4H5I A;  4CI3 A;  1TYE A;  2VDP A;  3EU7 A;  3MKQ A;  2AQ5 A;  3T3P A;  4JSN C;  4D9S A;  1RI6 A;  3VI3 A;  4L1M A;  3DM0 A;  3UKU C;  2P9S C;  3IKO A;  4NAA A;  4GGA A;  4FAN D;  2J57 G;  5EMJ B;  4WK2 A;  3B7F A;  5FKQ A;  5E6U A;  2XE4 A;  4FAV D;  1SHY B;  3JZH A;  2HXC A;  3N0D A;  1M1X A;  4J8G A;  3GRE A;  1H2W A;  5FKS A;  2P9L C;  1SQ9 A;  2AGY A;  2VDM A;  2OIZ A;  4ZN4 A;  2Q7Q A;  4A2L A;  2EIB A;  2XZG A;  4J73 A;  4G1M A;  4I79 A;  5AJA A;  5C92 A;  2OVQ B;  3AFC A;  5EMM B;  4PBZ A;  3DSM A;  3HFQ A;  4MK0 B;  4QAM A;  1P22 A;  2CN2 A;  2IWF A;  2H9N A;  3KCI A;  2G9A A;  3JZN A;  3OKY B;  4IRZ A;  4XYI A;  5GMK n;  1H2X A;  2CNX A;  3FCS A;  3IUJ A;  4J86 A;  3IIW A;  3CFS B;  2XDW A;  4DNW A;  4JXM A;  1JJU B;  3MKS B;  3OKW A;  4GM3 A;  1PI6 A;  3EQ9 A;  4UM8 A;  5FKT A;  4CZX A;  4YVD A;  4A08 A;  3RRM C;  3SN6 B;  3K72 A;  2CN3 A;  1XHM A;  2H3X A;  3IIY A;  5CYK B;  3NIF A;  4MMY A;  1GP2 B;  2P9P C;  1H2Y A;  2I3S A;  5E6R A;  3IUN A;  3NVQ A;  2YNP A;  3AL8 A;  3VGZ A;  4O02 A;  1BPO A;  3NVX A;  3PVU B;  4CI1 A;  2VDR A;  3SBP A;  1YR2 A;  2AGX A;  2H6Q A;  4A0A A;  5CXC A;  3EQ7 A;  3CFV A;  1JOF A;  2MTA H;  3PSC B;  5FKR A;  4NBM A;  3I7P A;  3JRO A;  4OWR A;  1GOH A;  3EI4 A;  1MDA H;  4AN1 A;  5EAR A;  5EML B;  2YNN A;  4BCB A;  3RLM D;  3EWE A;  3UR4 A;  1TBG A;  4U7A A;  4GGD A;  3MVD K;  3I7H A;  1U8C A;  2YNO A;  2YB8 B;  3ZWL B;  4E5Z B;  2VC2 A;  4JSX C;  1UOQ A;  5H14 A;  4J8B A;  5CXB A;  1NR0 A;  3C5M A;  4AMZ A;  2YMU A;  3JRP A;  2VZ1 A;  3F3G A;  3KRW B;  4XEI C;  5TDH B;  3W15 A;  3I7O A;  1QFS A;  2H13 A;  3GFC A;  4JSP C;  4FA4 D;  4NC4 A;  2H14 A;  3V4P A;  1B9Y A;  5EM2 A;  3O4J A;  4NSX A;  4E54 B;  4LG8 A;  2IUR A;  1JMZ B;  3FM0 A;  4CY2 A;  4JT6 C;  3IJE A;  3IUL A;  1XKS A;  1SQJ A;  5GXI A;  3EI1 B;  2I0S A;  5KDO B;  4Z7O A;  1K8K C;  3EI4 B;  2H6N A;  2PM9 B;  3ULE C;  4A0B B;  3A0F A;  4CY1 A;  1VZ3 A;  5EAL A;  4QT8 A;  4A11 A;  1K32 A;  4GMB A;  4DNU A;  1GG2 B;  5FQD A;  5IT9 g;  1L0Q A;  2BCJ B;  3NIG A;  5HE1 B;  3FCU A;  4L1Q D;  3E0C A;  5A2Q g;  3ZDY A;  4J79 A;  2J56 H;  3VA6 A;  4CY5 A;  5B4W A;  5HYN B;  5EM2 B;  2AGW A;  4J81 A;  2HU7 A;  3BG1 A;  2EIE A;  2UZY B;  4PNK B;  2H6K A;  3AL9 A;  3F3P A;  4ERQ A;  5I5J A;  3F3F A;  1VE7 A;  2VDN A;  3UVM A;  3QHY B;  4RE6 A;  3O4I A;  1QNI A;  2OVP B;  2TRC B;  4Y5R D;  2B5L A;  4ERY A;  3FGB A;  4CI8 A;  2CO0 A;  4A09 A;  3BWS A;  2EID A;  2OK6 A;  5FA5 B;  3MUN A;  5SXM A;  2CE8 A;  1N6E A;  5M61 A;  3UVO A;  4O45 A;  4AOW A;  4BCD A;  4XYH A;  5K19 A;  1PGU A;  2AH0 A;  3VI4 A;  2GNQ A;  4K3J B;  3EI2 A;  1O6G A;  4UM9 A;  1JV2 A;  3PXW D;  4A11 B;  5IJ8 E;  2HYE A;  3ZE2 A;  5FLX g;  5GSA A;  4K3I D;  1VYH C;  3I89 A;  4Z7Q A;  3GC3 B;  4A7J A;  2B4E A;  3I2N A;  1GOG A;  5H17 A;  4JT5 C;  2YBA A;  5IJ7 E;  3ZE0 A;  3UVL A;  2EBS A;  5EAM A;  3SXT D;  3I8E A;  3OL2 A;  4J0X A;  4WK0 A;  1L5G A;  4FA5 D;  3FRX A;  3PSL A;  3RN1 D;  3RFG A;  3ZDZ A;  1B9X A;  4U1E I;  2HJB A;  5JWZ A;  2VDK A;  3ODT A;  1E8N A;  4JSV C;  4A2M A;  4X3E A;  4ZOV A;  4G1E A;  1OLZ A;  4UI9 R;  2P9I C;  3JAM g;  3DXM C;  4GQB B;  5C2W B;  3V7D B;  3BG0 A;  5EMK B;  5I5M A;  2IAA A;  5IGQ A;  3C75 H;  2I0T A;  3MUO A;  3O4H A;  1C9I A;  4PSX B;  4J84 A;  3SVW D;  5H1M A;  4A08 B;  4LG9 A;  3C9C A;  3SCY A;  5C2V B;  5I5I A;  4D6V A;  4CI2 A;  4J77 A;  5THA A;  3AL8 B;  2G99 A;  3OL2 B;  4BP9 A;  3SFZ A;  4CC9 A;  1QFM A;  3OKT A;  2PM7 B;  2OK4 A;  3C99 A;  4ERZ A;  1E5T A;  5TEE A;  1VE6 A;  4A0A B;  4Z7N A;  5CXC B;  3IJ0 A;  4IMM A;  2Z2O A;  4GQ1 A;  3DDU A;  3N0E A;  4QRJ A;  4Y7R A;  3SBR A;  1ERJ A;  5C9Z B;  2XL3 A;  5TEF A;  3EG6 A;  4J78 A;  3MZK A;  1TYQ C;  2VDO A;  4MMZ A;  2XL2 A;  4FA1 D;  1N6F A;  3EQ8 A;  1VZ2 A;  3IUR A;  3I7N A;  3SMR A;  4L9O A;  3K27 A;  1S4U X;  4AN0 A;  3SWS D;  2AGZ A;  5FFG A;  3RSE C;  5HE3 B;  4L3H D;  4O2W A;  4NEN A;  2P9N C;  1O6F A;  4GM8 A;  5CXB B;  2XYI A; 
#chains in the Genus database with same CATH homology
 3IJ1 A;  3PXS D;  4O1Q D;  3CIK B;  3V9F A;  4X60 B;  2OVR B;  3OKY A;  4GM9 A;  2CO0 C;  1XIP A;  5K1C C;  5AMS A;  5HE2 B;  4X61 B;  3MZL A;  2H9M A;  3KRX B;  3OW8 A;  1GXR A;  5CYK A;  2H47 A;  2BBK H;  4J82 A;  3K26 A;  1U4C A;  4LGN A;  4KFM B;  4FWW A;  4GZ8 A;  4FA9 D;  2H9P A;  4N14 A;  4IA9 A;  4ES0 A;  3UKR C;  4EWR A;  5FXY A;  2I3T A;  3VH0 A;  3MMY A;  3RN0 D;  1OMW B;  2P9U C;  2HES X;  2Z2P A;  4CZV A;  1NEX B;  4D0K A;  4CZY A;  4FB1 D;  1YFQ A;  3RMZ D;  2PBI B;  4FHL A;  4Z8L A;  2Z2N A;  2OJY A;  4G56 B;  3EMH A;  1GOT B;  2IUQ A;  2AH1 A;  4O3T B;  2W18 A;  2AGL A;  3U4Y A;  4PBY A;  4ZOY A;  1FWX A;  4E5Z A;  4A09 B;  5EAP A;  4O9D A;  3PE7 A;  2H9L A;  1R5M A;  1Q47 A;  2B5M A;  3P4F A;  3NVN A;  4L3G D;  1PBY B;  3EI2 B;  4ESG A;  2H68 A;  3UVK A;  4H5J A;  2GC7 A;  3AH8 B;  5HE0 B;  1U2V C;  4E54 A;  3PVW B;  3SJL D;  1N6D A;  3L4M D;  3J81 g;  5IGO A;  3EI3 A;  3EI1 A;  3DWL C;  4PXW A;  2PM9 A;  1MG2 A;  4X63 B;  3JB9 L;  4A0B A;  4PC0 A;  4QQE A;  4AEZ A;  2B5N A;  4O3U B;  3RFH A;  4BH6 A;  4PSW B;  4CY3 A;  1A0R B;  4QL1 A;  3JZG A;  3DXK C;  3J80 g;  4ZOZ A;  4ZOX A;  3IJC A;  2HKM A;  4J0W A;  3SHF A;  2QC5 A;  3V5W B;  1JMX B;  2J55 H;  2O9K A;  2I0R A;  3UVN A;  5AFU 3;  4BUJ C;  2CE9 A;  3PXT D;  4J87 A;  4R7A B;  5IC7 A;  2XU7 A;  3OTT A;  5TF2 A;  2PM6 B;  2GC4 A;  3EI3 B;  2IWK A;  4GGC A;  3I8C A;  3MXX A;  3ORV D;  4HDJ A;  4GQ2 P;  2QXV A;  3I7K A;  4BL0 A;  2HJ4 A;  1MG3 A;  2HKR A;  2P9K C;  5HQG A;  2IUV A;  5GXH A;  3SBQ A;  4OZU A;  3SLE D;  4TZ4 A;  2UZX B;  4JD2 C;  3L4O D;  2IUP A;  3I7L A;  3JPX A;  1PEV A;  4H5I A;  4CI3 A;  3MKQ A;  3EU7 A;  2AQ5 A;  4JSN C;  1RI6 A;  3DM0 A;  3UKU C;  2P9S C;  3IKO A;  4FAN D;  4GGA A;  2J57 G;  5EMJ B;  3B7F A;  5FKQ A;  4FAV D;  1SHY B;  3JZH A;  2HXC A;  3N0D A;  4J8G A;  3GRE A;  5FKS A;  2P9L C;  1SQ9 A;  2AGY A;  4ZN4 A;  2OIZ A;  2Q7Q A;  4A2L A;  4J73 A;  4I79 A;  5AJA A;  2OVQ B;  3AFC A;  5EMM B;  4PBZ A;  3DSM A;  3HFQ A;  4MK0 B;  1P22 A;  2CN2 A;  2IWF A;  2H9N A;  2G9A A;  3JZN A;  3OKY B;  4XYI A;  5GMK n;  2CNX A;  4J86 A;  3IIW A;  3CFS B;  4JXM A;  1JJU B;  3MKS B;  3OKW A;  4GM3 A;  1PI6 A;  5FKT A;  4CZX A;  4YVD A;  4A08 A;  3RRM C;  3SN6 B;  2CN3 A;  1XHM A;  2H3X A;  3IIY A;  5CYK B;  1GP2 B;  2P9P C;  2I3S A;  3NVQ A;  2YNP A;  3AL8 A;  3VGZ A;  3NVX A;  3PVU B;  4CI1 A;  3SBP A;  2AGX A;  2H6Q A;  4A0A A;  5CXC A;  3CFV A;  1JOF A;  2MTA H;  3PSC B;  5FKR A;  3I7P A;  3JRO A;  4OWR A;  3EI4 A;  1MDA H;  5EAR A;  5EML B;  2YNN A;  3RLM D;  3EWE A;  3UR4 A;  1TBG A;  4U7A A;  4GGD A;  3I7H A;  2YNO A;  2YB8 B;  3ZWL B;  4E5Z B;  4JSX C;  5H14 A;  4J8B A;  5CXB A;  1NR0 A;  3C5M A;  2YMU A;  3JRP A;  3F3G A;  3KRW B;  4XEI C;  5TDH B;  3W15 A;  3I7O A;  2H13 A;  3GFC A;  4JSP C;  4FA4 D;  2H14 A;  1B9Y A;  5EM2 A;  4NSX A;  4E54 B;  4LG8 A;  2IUR A;  1JMZ B;  3FM0 A;  4CY2 A;  4JT6 C;  1XKS A;  1SQJ A;  5GXI A;  3EI1 B;  2I0S A;  5KDO B;  1K8K C;  3EI4 B;  2H6N A;  2PM9 B;  3ULE C;  4A0B B;  3A0F A;  4CY1 A;  5EAL A;  4QT8 A;  4A11 A;  1K32 A;  4GMB A;  1GG2 B;  5FQD A;  5IT9 g;  1L0Q A;  2BCJ B;  5HE1 B;  4L1Q D;  3E0C A;  5A2Q g;  4J79 A;  2J56 H;  3VA6 A;  4CY5 A;  5B4W A;  5HYN B;  5EM2 B;  2AGW A;  4J81 A;  3BG1 A;  4PNK B;  2UZY B;  2H6K A;  3AL9 A;  3F3P A;  4ERQ A;  5I5J A;  3F3F A;  3UVM A;  1QNI A;  2OVP B;  2TRC B;  4Y5R D;  2B5L A;  4ERY A;  3FGB A;  4CI8 A;  2CO0 A;  4A09 A;  3BWS A;  2OK6 A;  5FA5 B;  5SXM A;  1N6E A;  2CE8 A;  3UVO A;  4O45 A;  4AOW A;  4XYH A;  5K19 A;  1PGU A;  2AH0 A;  2GNQ A;  4K3J B;  3EI2 A;  4A11 B;  3PXW D;  5IJ8 E;  2HYE A;  5FLX g;  5GSA A;  4K3I D;  1VYH C;  3I89 A;  4A7J A;  2B4E A;  3I2N A;  5H17 A;  4JT5 C;  2YBA A;  5IJ7 E;  3UVL A;  2EBS A;  5EAM A;  3SXT D;  3I8E A;  3OL2 A;  4J0X A;  4FA5 D;  3FRX A;  3PSL A;  3RN1 D;  3RFG A;  1B9X A;  4U1E I;  2HJB A;  5JWZ A;  3ODT A;  4JSV C;  4A2M A;  4X3E A;  4ZOV A;  1OLZ A;  4UI9 R;  2P9I C;  3JAM g;  3DXM C;  4GQB B;  5C2W B;  3V7D B;  3BG0 A;  5EMK B;  5I5M A;  2IAA A;  5IGQ A;  3C75 H;  2I0T A;  4PSX B;  4J84 A;  3SVW D;  5H1M A;  4A08 B;  4LG9 A;  3C9C A;  3SCY A;  5C2V B;  5I5I A;  4D6V A;  4CI2 A;  4J77 A;  5THA A;  3AL8 B;  2G99 A;  3OL2 B;  3SFZ A;  4CC9 A;  3OKT A;  2PM7 B;  2OK4 A;  3C99 A;  4ERZ A;  5TEE A;  4A0A B;  5CXC B;  3IJ0 A;  4IMM A;  2Z2O A;  4GQ1 A;  3N0E A;  4QRJ A;  4Y7R A;  3SBR A;  1ERJ A;  5C9Z B;  2XL3 A;  5TEF A;  3EG6 A;  4J78 A;  3MZK A;  1TYQ C;  2XL2 A;  4FA1 D;  1N6F A;  3SMR A;  3I7N A;  4L9O A;  3K27 A;  1S4U X;  3SWS D;  2AGZ A;  3RSE C;  5HE3 B;  4L3H D;  2P9N C;  4GM8 A;  5CXB B;  2XYI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...