4OWSA

Anthranilate phosphoribosyl transferase from mycobacterium tuberculosis in complex with 4-methylanthranilate, prpp and magnesium
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
346
structure length
340
Chain Sequence
b'PSWPQILGRLTDNRDLARGQAAWAMDQIMTGNARPAQIAAFAVAMTMKAPTADEVGELAGVMLSHAHPLPADTVPDDAVDVVGTGVNTVNLSTMAAIVVAAAGVPVVKHGNRAASGGADTLEALGVRIDLGPDLVARSLAEVGIGFCFAPRFHPSYRHAAAVRREIGVPTVFNLLGPLTNPARPRAGLIGCAFADLAEVMAGVFAARRSSVLVVHGDDGLDELTTTTTSTIWRVAAGSVDKLTFDPAGFGFARAQLDQLAGGDAQANAAAVRAVLGGARGPVRDAVVLNAAGAIVAHAGLSSRAEWLPAWEEGLRRASAAIDTGAAEQLLARWVRFGRQI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Anthranilate phosphoribosyltransferase
publication title Alternative substrates reveal catalytic cycle and key binding events in the reaction catalysed by anthranilate phosphoribosyltransferase from Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 122
structure length 340
sequence length 346
chains with identical sequence B
ec nomenclature ec 2.4.2.18: Anthranilate phosphoribosyltransferase.
pdb deposition date 2014-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00591 Glycos_transf_3 Glycosyl transferase family, a/b domain
A PF02885 Glycos_trans_3N Glycosyl transferase family, helical bundle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.970.10 Mainly Alpha Up-down Bundle Transferase, Pyrimidine Nucleoside Phosphorylase; Chain A, domain 3 Transferase, Pyrimidine Nucleoside Phosphorylase; Chain C 4owsA01
3.40.1030.10 Alpha Beta 3-Layer(aba) Sandwich Pyrimidine Nucleoside Phosphorylase; Chain A, domain 2 Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain 4owsA02
5EP8A 4X46A 3QSAA 1ZXYA 1V8GA 4OWMA 4GA5A 2TPTA 4GA6A 4X5EA 3QR9A 3H5QA 4ZOJA 1ZVWA 1ZYKA 2BPQA 1KHDA 4X5DA 4LHMA 4MUOA 4X59A 4HKMA 5BYTA 3QQSA 3TWPA 5EY3A 1GXBA 3UU1A 4XR5A 4EAFA 4N5VA 2DSJA 3R6CA 1O17A 4X5AA 2ELCA 3R88A 4GKMA 4OWUA 1VQUA 1UOUA 5C1RA 4X5BA 5BNEA 4OWOA 4OWQA 4OWSA 4OWNA 4M0RA 5C7SA 3GBRA 4GA4A 3QS8A 1OTPA 4ZOKA 4GTNA 4N93A 2GVQA 2WK5A 4OWVA 5C2LA 2WK6A 1AZYA 4GIUA 4N8QA 4ZOFA 4ZTVA 4YEKA 4X5CA 4YYYA 1BRWA 1KGZA 4X58A 4YI7A 2J0FA 4IJ1A 5BO2A 5BO3A 4EADA
chains in the Genus database with same CATH superfamily
5EP8A 4X46A 3QSAA 1ZXYA 1V8GA 4OWMA 4GA5A 2TPTA 4GA6A 4X5EA 1RF8B 3QR9A 3H5QA 4ZOJA 1ZVWA 1ZYKA 2BPQA 1KHDA 4X5DA 4LHMA 4MUOA 4X59A 4HKMA 5BYTA 3QQSA 3TWPA 5EY3A 1GXBA 3UU1A 4XR5A 4EAFA 4N5VA 2DSJA 3R6CA 1O17A 4X5AA 2ELCA 3R88A 1RRZA 4GKMA 4OWUA 1VQUA 1UOUA 5C1RA 4X5BA 5BNEA 4OWOA 4OWQA 4OWSA 4OWNA 4M0RA 5C7SA 3GBRA 4GA4A 3QS8A 1OTPA 4ZOKA 4GTNA 4N93A 2GVQA 2WK5A 4OWVA 5C2LA 2WK6A 1AZYA 4F3FC 4GIUA 4N8QA 4ZOFA 4ZTVA 4YEKA 4X5CA 4YYYA 1BRWA 1KGZA 4X58A 4YI7A 2J0FA 4IJ1A 5BO2A 5BO3A 4EADA
chains in the Genus database with same CATH topology
5EP8A 4X46A 3QSAA 1ZXYA 1V8GA 4OWMA 4GA5A 2TPTA 4GA6A 4X5EA 3QR9A 3H5QA 4ZOJA 1ZVWA 1ZYKA 2BPQA 1KHDA 4X5DA 4LHMA 4MUOA 4X59A 4HKMA 5BYTA 3QQSA 3TWPA 5EY3A 1GXBA 3UU1A 4XR5A 4EAFA 4N5VA 2DSJA 3R6CA 1O17A 4X5AA 2ELCA 3R88A 4GKMA 4OWUA 1VQUA 1UOUA 5C1RA 4X5BA 5BNEA 4OWOA 4OWQA 4OWSA 4OWNA 4M0RA 5C7SA 3GBRA 4GA4A 3QS8A 1OTPA 4ZOKA 4GTNA 4N93A 2GVQA 2WK5A 4OWVA 5C2LA 2WK6A 1AZYA 4GIUA 4N8QA 4ZOFA 4ZTVA 4YEKA 4X5CA 4YYYA 1BRWA 1KGZA 4X58A 4YI7A 2J0FA 4IJ1A 5BO2A 5BO3A 4EADA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EP8 A;  4X46 A;  3QSA A;  1ZXY A;  1V8G A;  4OWM A;  4GA5 A;  2TPT A;  4GA6 A;  4X5E A;  3QR9 A;  3H5Q A;  4ZOJ A;  1ZVW A;  1ZYK A;  2BPQ A;  1KHD A;  4X5D A;  4LHM A;  4MUO A;  4X59 A;  4HKM A;  5BYT A;  3QQS A;  3TWP A;  5EY3 A;  1GXB A;  3UU1 A;  4XR5 A;  4EAF A;  4N5V A;  2DSJ A;  3R6C A;  1O17 A;  4X5A A;  2ELC A;  3R88 A;  4GKM A;  4OWU A;  1VQU A;  1UOU A;  5C1R A;  4X5B A;  5BNE A;  4OWO A;  4OWQ A;  4OWS A;  4OWN A;  4M0R A;  5C7S A;  3GBR A;  4GA4 A;  3QS8 A;  1OTP A;  4ZOK A;  4GTN A;  4N93 A;  2GVQ A;  2WK5 A;  4OWV A;  5C2L A;  2WK6 A;  1AZY A;  4GIU A;  4N8Q A;  4ZOF A;  4ZTV A;  4YEK A;  4X5C A;  4YYY A;  1BRW A;  1KGZ A;  4X58 A;  4YI7 A;  2J0F A;  4IJ1 A;  5BO2 A;  5BO3 A;  4EAD A; 
#chains in the Genus database with same CATH topology
 5EP8 A;  4X46 A;  3QSA A;  1ZXY A;  1V8G A;  4OWM A;  4GA5 A;  2TPT A;  4GA6 A;  4X5E A;  1RF8 B;  3QR9 A;  3H5Q A;  4ZOJ A;  1ZVW A;  1ZYK A;  2BPQ A;  1KHD A;  4X5D A;  4LHM A;  4MUO A;  4X59 A;  4HKM A;  5BYT A;  3QQS A;  3TWP A;  5EY3 A;  1GXB A;  3UU1 A;  4XR5 A;  4EAF A;  4N5V A;  2DSJ A;  3R6C A;  1O17 A;  4X5A A;  2ELC A;  3R88 A;  1RRZ A;  4GKM A;  4OWU A;  1VQU A;  1UOU A;  5C1R A;  4X5B A;  5BNE A;  4OWO A;  4OWQ A;  4OWS A;  4OWN A;  4M0R A;  5C7S A;  3GBR A;  4GA4 A;  3QS8 A;  1OTP A;  4ZOK A;  4GTN A;  4N93 A;  2GVQ A;  2WK5 A;  4OWV A;  5C2L A;  2WK6 A;  1AZY A;  4F3F C;  4GIU A;  4N8Q A;  4ZOF A;  4ZTV A;  4YEK A;  4X5C A;  4YYY A;  1BRW A;  1KGZ A;  4X58 A;  4YI7 A;  2J0F A;  4IJ1 A;  5BO2 A;  5BO3 A;  4EAD A; 
#chains in the Genus database with same CATH homology
 5EP8 A;  4X46 A;  3QSA A;  1ZXY A;  1V8G A;  4OWM A;  4GA5 A;  2TPT A;  4GA6 A;  4X5E A;  3QR9 A;  3H5Q A;  4ZOJ A;  1ZVW A;  1ZYK A;  2BPQ A;  1KHD A;  4X5D A;  4LHM A;  4MUO A;  4X59 A;  4HKM A;  5BYT A;  3QQS A;  3TWP A;  5EY3 A;  1GXB A;  3UU1 A;  4XR5 A;  4EAF A;  4N5V A;  2DSJ A;  3R6C A;  1O17 A;  4X5A A;  2ELC A;  3R88 A;  4GKM A;  4OWU A;  1VQU A;  1UOU A;  5C1R A;  4X5B A;  5BNE A;  4OWO A;  4OWQ A;  4OWS A;  4OWN A;  4M0R A;  5C7S A;  3GBR A;  4GA4 A;  3QS8 A;  1OTP A;  4ZOK A;  4GTN A;  4N93 A;  2GVQ A;  2WK5 A;  4OWV A;  5C2L A;  2WK6 A;  1AZY A;  4GIU A;  4N8Q A;  4ZOF A;  4ZTV A;  4YEK A;  4X5C A;  4YYY A;  1BRW A;  1KGZ A;  4X58 A;  4YI7 A;  2J0F A;  4IJ1 A;  5BO2 A;  5BO3 A;  4EAD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...