4OWVA

Anthranilate phosphoribosyl transferase from mycobacterium tuberculosis in complex with anthranilate
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
350
structure length
343
Chain Sequence
b'SVPSWPQILGRLTDNRDLARGQAAWAMDQIMTGNARPAQIAAFAVAMTMKAPTADEVGELAGVMLSHAHPLPADTVPDDAVDVVGTGTVNLSTMAAIVVAAAGVPVVKHGNRASLSGGADTLEALGVRIDLGPDLVARSLAEVGIGFCFAPRFHPSYRHAAAVRREIGVPTVFNLLGPLTNPARPRAGLIGCAFADLAEVMAGVFAARRSSVLVVHGDDGLDELTTTTTSTIWRVAAGSVDKLTFDPAGFGFARAQLDQLAGGDAQANAAAVRAVLGGARGPVRDAVVLNAAGAIVAHAGLSSRAEWLPAWEEGLRRASAAIDTGAAEQLLARWVRFGRQILE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Anthranilate phosphoribosyltransferase
publication title Alternative substrates reveal catalytic cycle and key binding events in the reaction catalysed by anthranilate phosphoribosyltransferase from Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 121
structure length 343
sequence length 350
chains with identical sequence B
ec nomenclature ec 2.4.2.18: Anthranilate phosphoribosyltransferase.
pdb deposition date 2014-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00591 Glycos_transf_3 Glycosyl transferase family, a/b domain
A PF02885 Glycos_trans_3N Glycosyl transferase family, helical bundle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.970.10 Mainly Alpha Up-down Bundle Transferase, Pyrimidine Nucleoside Phosphorylase; Chain A, domain 3 Transferase, Pyrimidine Nucleoside Phosphorylase; Chain C 4owvA01
3.40.1030.10 Alpha Beta 3-Layer(aba) Sandwich Pyrimidine Nucleoside Phosphorylase; Chain A, domain 2 Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain 4owvA02
4N93A 4GA6A 4X59A 1UOUA 2GVQA 5EY3A 4LHMA 3H5QA 5BNEA 1BRWA 3QSAA 4GTNA 5BO3A 4OWQA 3TWPA 4XR5A 2TPTA 4X5CA 1V8GA 5BO2A 4HKMA 3R6CA 1O17A 4ZOFA 4GKMA 4GIUA 4X5BA 3GBRA 1KHDA 1ZYKA 1AZYA 4GA4A 4ZOKA 1ZVWA 5C7SA 2DSJA 4X5EA 3R88A 4EADA 3UU1A 4X46A 2WK6A 4EAFA 4IJ1A 2J0FA 2BPQA 5C1RA 4OWMA 3QS8A 2ELCA 4GA5A 4OWSA 4OWVA 1OTPA 5EP8A 4M0RA 4OWUA 4X5AA 4X5DA 1KGZA 1ZXYA 4YYYA 3QQSA 4N5VA 4ZTVA 1GXBA 2WK5A 1VQUA 4OWNA 5C2LA 4X58A 4ZOJA 4YEKA 4N8QA 4OWOA 4YI7A 4MUOA 3QR9A 5BYTA
chains in the Genus database with same CATH superfamily
4N93A 4GA6A 4X59A 1UOUA 2GVQA 5EY3A 4LHMA 3H5QA 5BNEA 1BRWA 3QSAA 4GTNA 5BO3A 4OWQA 3TWPA 4XR5A 2TPTA 4X5CA 1V8GA 5BO2A 4HKMA 3R6CA 1O17A 4ZOFA 4GKMA 4GIUA 1RRZA 4X5BA 3GBRA 1KHDA 1ZYKA 1AZYA 4GA4A 4F3FC 4ZOKA 1ZVWA 5C7SA 2DSJA 4X5EA 3R88A 4EADA 3UU1A 4X46A 2WK6A 4EAFA 4IJ1A 2J0FA 2BPQA 5C1RA 4OWMA 3QS8A 2ELCA 1RF8B 4GA5A 4OWSA 4OWVA 1OTPA 5EP8A 4M0RA 4OWUA 4X5AA 4X5DA 1KGZA 1ZXYA 4YYYA 3QQSA 4N5VA 4ZTVA 1GXBA 2WK5A 1VQUA 4OWNA 5C2LA 4X58A 4ZOJA 4YEKA 4N8QA 4OWOA 4YI7A 4MUOA 3QR9A 5BYTA
chains in the Genus database with same CATH topology
4N93A 4GA6A 4X59A 1UOUA 2GVQA 5EY3A 4LHMA 3H5QA 5BNEA 1BRWA 3QSAA 4GTNA 5BO3A 4OWQA 3TWPA 4XR5A 2TPTA 4X5CA 1V8GA 5BO2A 4HKMA 3R6CA 1O17A 4ZOFA 4GKMA 4GIUA 4X5BA 3GBRA 1KHDA 1ZYKA 1AZYA 4GA4A 4ZOKA 1ZVWA 5C7SA 2DSJA 4X5EA 3R88A 4EADA 3UU1A 4X46A 2WK6A 4EAFA 4IJ1A 2J0FA 2BPQA 5C1RA 4OWMA 3QS8A 2ELCA 4GA5A 4OWSA 4OWVA 1OTPA 5EP8A 4M0RA 4OWUA 4X5AA 4X5DA 1KGZA 1ZXYA 4YYYA 3QQSA 4N5VA 4ZTVA 1GXBA 2WK5A 1VQUA 4OWNA 5C2LA 4X58A 4ZOJA 4YEKA 4N8QA 4OWOA 4YI7A 4MUOA 3QR9A 5BYTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N93 A;  4GA6 A;  4X59 A;  1UOU A;  2GVQ A;  5EY3 A;  4LHM A;  3H5Q A;  5BNE A;  1BRW A;  3QSA A;  4GTN A;  5BO3 A;  4OWQ A;  3TWP A;  4XR5 A;  2TPT A;  4X5C A;  1V8G A;  5BO2 A;  4HKM A;  3R6C A;  1O17 A;  4ZOF A;  4GKM A;  4GIU A;  4X5B A;  3GBR A;  1KHD A;  1ZYK A;  1AZY A;  4GA4 A;  4ZOK A;  1ZVW A;  5C7S A;  2DSJ A;  4X5E A;  3R88 A;  4EAD A;  3UU1 A;  4X46 A;  2WK6 A;  4EAF A;  4IJ1 A;  2J0F A;  2BPQ A;  5C1R A;  4OWM A;  3QS8 A;  2ELC A;  4GA5 A;  4OWS A;  4OWV A;  1OTP A;  5EP8 A;  4M0R A;  4OWU A;  4X5A A;  4X5D A;  1KGZ A;  1ZXY A;  4YYY A;  3QQS A;  4N5V A;  4ZTV A;  1GXB A;  2WK5 A;  1VQU A;  4OWN A;  5C2L A;  4X58 A;  4ZOJ A;  4YEK A;  4N8Q A;  4OWO A;  4YI7 A;  4MUO A;  3QR9 A;  5BYT A; 
#chains in the Genus database with same CATH topology
 4N93 A;  4GA6 A;  4X59 A;  1UOU A;  2GVQ A;  5EY3 A;  4LHM A;  3H5Q A;  5BNE A;  1BRW A;  3QSA A;  4GTN A;  5BO3 A;  4OWQ A;  3TWP A;  4XR5 A;  2TPT A;  4X5C A;  1V8G A;  5BO2 A;  4HKM A;  3R6C A;  1O17 A;  4ZOF A;  4GKM A;  4GIU A;  1RRZ A;  4X5B A;  3GBR A;  1KHD A;  1ZYK A;  1AZY A;  4GA4 A;  4F3F C;  4ZOK A;  1ZVW A;  5C7S A;  2DSJ A;  4X5E A;  3R88 A;  4EAD A;  3UU1 A;  4X46 A;  2WK6 A;  4EAF A;  4IJ1 A;  2J0F A;  2BPQ A;  5C1R A;  4OWM A;  3QS8 A;  2ELC A;  1RF8 B;  4GA5 A;  4OWS A;  4OWV A;  1OTP A;  5EP8 A;  4M0R A;  4OWU A;  4X5A A;  4X5D A;  1KGZ A;  1ZXY A;  4YYY A;  3QQS A;  4N5V A;  4ZTV A;  1GXB A;  2WK5 A;  1VQU A;  4OWN A;  5C2L A;  4X58 A;  4ZOJ A;  4YEK A;  4N8Q A;  4OWO A;  4YI7 A;  4MUO A;  3QR9 A;  5BYT A; 
#chains in the Genus database with same CATH homology
 4N93 A;  4GA6 A;  4X59 A;  1UOU A;  2GVQ A;  5EY3 A;  4LHM A;  3H5Q A;  5BNE A;  1BRW A;  3QSA A;  4GTN A;  5BO3 A;  4OWQ A;  3TWP A;  4XR5 A;  2TPT A;  4X5C A;  1V8G A;  5BO2 A;  4HKM A;  3R6C A;  1O17 A;  4ZOF A;  4GKM A;  4GIU A;  4X5B A;  3GBR A;  1KHD A;  1ZYK A;  1AZY A;  4GA4 A;  4ZOK A;  1ZVW A;  5C7S A;  2DSJ A;  4X5E A;  3R88 A;  4EAD A;  3UU1 A;  4X46 A;  2WK6 A;  4EAF A;  4IJ1 A;  2J0F A;  2BPQ A;  5C1R A;  4OWM A;  3QS8 A;  2ELC A;  4GA5 A;  4OWS A;  4OWV A;  1OTP A;  5EP8 A;  4M0R A;  4OWU A;  4X5A A;  4X5D A;  1KGZ A;  1ZXY A;  4YYY A;  3QQS A;  4N5V A;  4ZTV A;  1GXB A;  2WK5 A;  1VQU A;  4OWN A;  5C2L A;  4X58 A;  4ZOJ A;  4YEK A;  4N8Q A;  4OWO A;  4YI7 A;  4MUO A;  3QR9 A;  5BYT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...