4OX9K

Crystal structure of the aminoglycoside resistance methyltransferase npma bound to the 30s ribosomal subunit
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Molecular recognition and modification of the 30S ribosome by the aminoglycoside-resistance methyltransferase NpmA.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ribosome/antibiotic
total genus 30
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2014-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4ox9K00
4JI2K 4X66K 4LF6K 4B3TK 4JI3K 4DV7K 4DV0K 4LF5K 4LFAK 1HNZK 4DV6K 4B3SK 2UUAK 4YY3K 1I94K 4NXNK 4GKKK 4JYAK 4LFCK 4LF8K 4JI5K 3J81O 2UUCK 4LF7K 4B3RK 5A2QO 4JI8K 5LL6Z 1XNQK 4DV1K 5BR8K 4LF4K 4X64K 1IBKK 1N34K 4LFBK 4DV5K 2UXDK 5LMNK 1J5EK 5LMUK 3J80O 5FLXO 4DV3K 1N36K 2ZM6K 4CW7B 4KHPK 1N32K 4DR7K 4JI1K 2UU9K 1FJGK 4X62K 4NXMK 4GKJK 4DR2K 1XNRK 4K0KK 3OTOK 4DUZK 4DV2K 4OX9K 5IT9O 4AQYK 1HR0K 3T1HK 1XMQK 2HHHK 2UXBK 4JI0K 2UUBK 4V19S 2E5LK 4DR5K 3T1YK 3J7AP 4B3MK 3J7YP 4JI6K 4YHHK 1IBMK 4JI7K 4LF9K 1HNWK 1XMOK 2UXCK 2F4VK 4DR4K 2VQEK 1IBLK 1N33K 4DR6K 4DR1K 4DV4K 2VQFK 4JI4K 3JAMO 5IWAK 4DR3K 4DUYK 1HNXK 5AJ3K 4X65K 4JV5K 4CVNE
chains in the Genus database with same CATH superfamily
4FLWA 1RCHA 2P9KA 1RDUA 3WNGA 4EP5A 5KPTA 4BRKA 2WBNA 2QKBA 4KV8A 1N6QA 4J2BA 4F2RA 3IRXA 1I94K 3U8XA 1JCEA 3VF4A 2P9UB 1QVFM 1SL2A 1LWEA 1D5AA 3HI0A 2W6LA 1U2VB 1B9DA 4IJAA 3O80A 1EO1A 3M8RA 2HNZA 1XQSC 3EO3A 4H0VB 2I7PA 2IAJA 5ADXA 4FM2A 2HBJA 3NE6A 1IBKK 4KHUA 2NRTA 3C6HA 5AQZA 3CFOA 2Q0RA 4OKEA 1JKHA 3OYMA 3SUOA 3RSEA 3H46O 1T8EA 2VCPA 4PY5A 4LH4A 1Z26A 4XH5A 4DSLA 4ILHA 4G1QA 5E84A 3V9UA 3B6OA 1Q18A 3BEXA 1ZXOA 4I2PA 1C0MA 4B8AB 3ATUA 3C0BA 4XH1A 3RWUA 4CGIA 3ULEA 3R9PA 4JKBA 1XWLA 5C2DA 3J7YP 5AQJA 2VG5A 4O4GA 3CCMN 4OPAA 3HOSA 3THXB 4BR9A 3C7NA 4DTRA 4H0YB 2IGIA 4C8KA 3WXIA 1JLEA 4JKHA 3D2EA 4C1NK 3HVTA 1R59O 4FM0A 1XC9A 2FF6A 5HP1A 3CQXA 4FWRA 3VETA 3T3FA 3ULEB 3S3MA 1Q9XA 1Z25A 3WNFA 4F4KA 3H45C 4WQ5C 1QQMA 3NGIA 2NZTA 1GLFO 2KKZA 5GAGP 3C7NB 4ELVA 4FJHA 4I9LA 4JRPA 4CEQA 5F2RA 3ZYYX 4HUFA 4BVOA 4CZIA 1JCGA 2P9PA 4LF8K 4CZEA 5C12A 5AZIA 4FLXA 3SLCA 3LALA 4O8UA 3D2EB 1BIUA 5BN9A 2OPSA 4AHVA 3MECA 4DB3A 5BPNA 3RRGA 2D0PA 2HHQA 1NWKA 3U6FA 3VQAA 1X9SA 4BRPA 4DQIA 2HMPA 1KLMA 3HOTA 3DI6A 3O9TA 4RW4A 3FFKB 3K9KA 3RVCA 4J2AA 2W40A 2P9PB 2OPRA 5AZIB 1U48A 5EVZA 5AQTA 2JLEA 1MWMA 3AGKA 3KTQA 1J9AA 2HNDA 5AQNA 3BZKA 4WQ5A 3QDKA 4KHWA 4RWTA 2ASOA 2NRWA 2ZQBA 4HWIA 3ZETA 4AHSA 5M1PA 3THYA 2BE2A 3PUFA 2CH5A 4UQGA 4FOIA 4IDHA 4FL9A 3L8BA 3J7AP 3T69A 1IBMK 1HKGA 1NK7A 4Z4HA 3L2UA 4QAGA 1LWFA 1HJOA 3IMXA 5C15A 3TARA 4DQSA 4DTXA 4EHTA 3MN7A 1BCOA 2HOEA 2RN2A 3OJSA 4DR3K 1TKXA 3OYEA 2A3ZA 4JN4A 3ZETB 3THYB 3AVNA 4IFEA 4X66K 3A5MC 3S41A 3BF3A 1J5OA 2ITGA 3MXIA 3LPUA 4M3YA 5FPMA 3MN9A 1OH5A 3AVCA 2UYTA 2W6KA 4CJ3A 3PSIA 1NGDA 3NVMA 4DQRA 1NG9A 3ZT3A 1C1BA 5H1SQ 4WF9L 1S9GA 1HPZA 1U47A 1WBDA 5AQQA 5FPDA 4LF7K 1WAJA 3SJHA 3HYFA 3VQQA 2XY6A 2DFFA 3PIPL 1K73O 1NGJA 3AO5A 2YNGA 4EAHD 3C65A 1I39A 3CJCA 3R8EA 1VSKA 4JKGA 4DV5K 3VA0A 2CGKA 1KFDA 4H5RA 4HTUA 3RMBA 3ID8A 2Q36A 4KHPK 1NBWA 1KD1O 4YOTA 1QQOA 4DU3A 1S1XA 4B1UB 3CMAN 4DSKA 1KLNA 1T44A 1VHXA 2E1ZA 3EYZA 3C6AA 4GNIA 4BRCA 1ZBFA 4KREA 4DFMA 3SBGA 1W2BM 3B6PA 4JKGB 4CJSA 3TAFA 1N8RO 2QWOA 3RMAA 3PX0A 3EZWA 1QQNA 2LSNA 4CGDA 2ZD1A 1C0TA 4OJRA 4FPBA 1FW6A 5GIOA 3A5OC 2D0BA 3HTVA 3IKMA 2YJFA 4DCHA 4KAZA 2FBXA 2PY5A 3MMVA 4QCLA 3DMJA 1UA0A 3CG7A 4B08A 4DF4A 2IC3A 3D6RA 2OPQA 4CEOA 3V4IA 2OYQA 3MAQA 4CHYA 3ATVA 4DFKA 5CY4A 3CETA 2QEXN 1T3VA 1Q9YA 4FLUA 1Q7YO 2NUBA 3HVRA 1VK0A 3VF2A 5I42A 4H5WA 1J54A 4FXDA 3MCAB 4B3OA 1U04A 3AVBA 3TR8A 2GUPA 5JVGL 3U3GA 5LY3A 4O8KA 2F8TA 5GIPA 4ZTJA 1NK4A 4CGFA 2UUCK 4O5FA 4IO8A 4DKWA 4DSIA 4BVPA 3ZSYA 1VQPN 5AQVA 4KH5A 1WAFA 4BDZA 4CEZA 5BRHA 1LW2A 2E6LA 2ZE2A 4CJFA 4J8FA 4PWDA 2A42A 2ZM6K 3V9SA 3H3OB 3EL2A 1BDGA 2WONA 3QBWA 1RT5A 3HPHA 3ZT0A 4HCBA 1NU0A 1L3UA 4ELUA 3GG4A 1EWRA 2UU9K 1FJGK 4WFBL 1BL3A 4FWKA 1VSIA 4RG8A 4CF2A 2XO7A 3D7EO 1IG8A 4E7IA 4LSLA 4HUGA 4BACA 3CJBA 3VEXA 3VEVA 4DSJA 4E19A 2I7NA 1RTHA 2IOCA 3WXJA 3CM6A 5JICA 2B5JA 4IWVA 4DF8A 2UUBK 3ZT1A 3AVHA 1YF5L 5SZTA 4OO1J 5FPNA 3DXMA 3O1WA 3SAHA 3SQ2A 4DHYA 1HMVA 3QFPA 3VA3A 4CJ5A 2KFZA 3L4QA 1X9MA 2V7YA 2O8CA 3P38A 1ATNA 1DLOA 4DV4K 3KLIA 4Z4FA 3PSFA 2HBLA 3QMLA 3VEYA 4CHOA 3EZ5A 2CH6A 1VQ4N 2E8AA 3SV3A 4N56A 4CHNA 2QWPA 4ISFA 3K5LA 4YDUC 3VGLA 4DU1A 1VSJA 5AQHA 1K6YA 1YVNA 3F5TA 3R1XA 1B9FA 4JI2K 4DTMA 5AQSA 3CCQN 2YJEA 5CZ2A 3DXMB 2GTDA 1T05A 2Q3SA 1QSLA 4FJMA 1IV0A 1VSEA 1U49A 3QICA 1GOBA 4YY3K 1TGOA 4NXNK 3KK2A 3AO1A 3WQTA 2KZMA 3KIOA 4FYDA 1XHXA 2H3GX 3O4WA 3HSTB 2NRXA 5A2QO 3SUNA 3F9MA 3JS6A 5K14A 1REVA 3QINA 3O1BA 2FBTA 4KHYA 1N5YA 4C23A 1DGKN 1ZBIA 4B9LA 3EKSA 4CE9A 3ZSRA 2WFBA 3AA5X 3LP2A 4RW6A 1QSSA 2HHVA 4CD3A 1XC3A 3KKRA 1YJ9N 3AVGA 4YDUA 4M7YA 4FJ8A 1H1VA 2HBMA 4OLAA 3O3GA 4NYNA 3VQ7A 4B9MA 3NF8A 2P9NB 5M1NA 2QXFA 1HPMA 2QWLA 1GLJO 3ZLJA 2QKKA 2EHGA 1WSHA 3ALYA 4JKAA 4O44A 3CXCM 1BI4A 1XI1A 4FK2A 4XEIA 4A2BA 3OTOK 2EWSA 4OX9K 1WSIA 1QTMA 5IT9O 4H4MA 3CJAA 2AA4A 3KLGA 1NGBA 3H1QA 4YOXA 4E1JA 3V1RA 3SQ0A 3T19A 4A5BA 1WN7A 2UXBK 2KHOA 3ZCMA 3R6MA 4BE0A 4MQ3A 4GY2B 3O3HA 4CBXA 1S1TA 3CCEN 1MA9B 1XMOK 3DLKA 4A5AA 4PA1A 1NJXA 1IBLK 1OH6A 1GLBG 3LDQA 4JS4A 3CI5A 3TAQA 1CZAN 1BA0A 4H5NA 3W3DA 1BI4B 4JS5A 1X9JA 4KI4A 5AQUA 4LC9B 1KAZA 3VQPA 1NLVA 2Q97A 3SMPA 4CFAA 3L3UA 4PKHA 2GELA 3GE1A 4FM1A 3CHWA 4KB0A 4A2AA 4KBOA 4CZJA 4N76A 3HJFA 5AZJA 2YHXA 4H5VA 4DV0K 1ITGA 4LFAK 3WEEA 4B3SK 1SKWA 2UUAK 1EXQA 3MX5A 2P9SA 2RKIA 4NO7A 1SUQA 1VAZA 3M5RA 2GBZA 1FXXA 4B9UA 3SK3A 3UKRA 2OZSA 4UY8O 1TV6A 4JI5K 4CHZA 3GDQA 1EX4A 3LANA 3ZT2A 4KTWA 1Y64A 2Q2RA 3KKSA 3QESA 2IVPA 5BR8K 1C0FA 4N41A 4LFBK 3AO4A 3LWLA 2B4JA 3CPEA 2VWKA 5KGWA 5M1QA 3CPWM 3O4NA 3CD6N 3WEEB 4CEFA 1KCFA 1MWKA 4DV3K 1N36K 2RF2A 4OPHA 1KFSA 1IG9A 1IKYA 3HBTA 3O9RA 5C2FA 4MLHA 3OYDA 2YNFA 4CGGA 4EHUA 1VRUA 4DS5A 3UKRB 3FZFA 4NXMK 1TYQB 1QSYA 1ASWA 4HUEA 4BG8A 2F8SA 2G8KA 3LPTA 2A5XA 2P9KB 1YIJN 3KLEA 3C94A 2YI1A 3AAQA 3ULDA 5BREA 3CCJN 3I0RA 3QLHA 2FBYA 2O8EA 2O8BA 5DMRA 3T1YK 2ZF5O 1GOCA 3KHYA 3UE5A 4CZKA 3NMUA 2OCEA 4C1NI 2PAVA 1TK8A 2HVIA 3JSMA 4FJ9A 3K5NA 4M3WA 2HHXA 4PHTX 3V9ZA 3O4QA 1SS6A 3ZEUA 1NJIO 3MK6A 1LOTB 3K2PA 2YNIA 3CFPA 1BU6O 1HX1A 4F9OA 3SMSA 1D4XA 4K8ZA 3IFRA 1FKPA 2J4RA 4K25A 3RSEB 3SQ1A 1JJ2M 4O0JA 2O8EB 4LF5K 4DQPA 3OS2A 3TAGA 5HOOA 4BDYA 2WOMA 3OA9A 1K8KA 2HB5A 4JYAK 2DPNA 3AA3A 4M3XA 1WBBA 3AGRA 4CF1A 4O5BA 3E66A 3CCVN 4JKCA 3AO2A 3VENA 4JKDA 4RTFD 3ZEUB 4IBNA 2HW3A 4IFVA 5HBMA 4PUOA 5AQYA 2IS3A 5LL6Z 1SL1A 2NLXA 1RFQA 3A5LC 3M8QA 5BRFA 1VQMN 3CC2N 4QS7A 4M7XA 4BG9A 3H6EA 4DTUA 5TKYA 3P39A 3U9DA 2O8FA 4OVLA 3DLRA 3J80O 1KTQA 3HZ6A 2V7ZA 4IO9L 4DTPA 1T7PA 1N32K 1K8KB 1TVRA 4H0PA 2ITMA 3PX6A 2F7TA 1QS4A 3PV8A 3I8BA 4Q0BA 3HSCA 4RW9A 1W7AA 4GV3A 1RILA 1O1WA 4CJVA 5T7BA 3G6EN 3C95A 4WE1A 4B1ZA 3ZSOA 4FLYA 3TAMA 1YTAA 3T1HK 1DTTA 4FJGA 2KFNA 2KQ2A 4GV9A 2O8FB 4JI0K 3K59A 4B8CA 1CZBA 4J2DA 3CCUN 4FVUA 4FLZA 3KWIA 4ILGB 1YHQN 3K5OA 1HKBA 1CXQA 4BRIA 3TI0A 2QM1A 2P1JA 1N33K 5AQWA 3G25A 3VQDA 2NRRA 1VQKN 1A5VA 2OTLN 3J8AA 4JHDA 3OYFA 1KSPA 1G99A 2E2QA 1C1CA 4CESA 3JYTA 4CJPA 4IOCL 3NF7A 1LCUA 1JLAA 5CYMA 4OGCA 3VQ8A 4K8XA 1A5XA 1YXQA 4PL7A 3T1AA 3RR8A 3GBTA 4KFBA 4N47A 2HHTA 3K0SA 3KK3A 4N5SA 4I7FA 1U4BA 4H0TB 4F3OA 4IEIA 3D45A 1J6ZA 1P90A 1OH7A 3K58A 3MN5A 4GW6A 4Z4IA 2KTQA 2G8IA 5CYQA 2FSNA 1HRHA 5KTQA 2QWRA 4H4OA 3ZSVA 3L6QA 2VWBA 3FZKA 1ATRA 1SAZA 2ZGZA 3VTHA 3QETA 1YJNN 3DRSA 3LZIA 2IDOA 2A1SA 1KXPA 2EX3A 4J2EA 5BPLA 4BE2A 3P4IA 4LY7A 2E4LA 3VMFB 3AVJA 3HT3A 3DOKA 1HYZA 1D8YA 1NKEA 4CJRA 1VQON 4ISGA 1RDBA 4EFHA 2D5RA 3TAEA 3FZHA 3OYLA 3E1YA 1RBTA 4XIUA 5C0YA 5BPMA 2HF3A 3SQ4A 1VQ6N 2PYLA 3MEDA 4ELTA 4M3RA 3VQ5A 1TKDA 3JXUA 1QVGM 3OBYA 2Y1JA 2YCHA 5LJWA 5FRNA 3VF6A 1L5UA 3NCIA 4L8RB 4NCBA 3CM5A 2QK9A 4DQ8A 4BQZA 2F4VK 3RRHA 4KHNA 5E26A 2JWLA 3CCLN 1RT4A 3AVIA 3VPZA 4BGBA 3VQEA 4DU4A 1L3SA 3ID6A 2OANA 2E2PA 2E88A 3GL1A 2FBVA 2GUIA 4C8MA 2YHWA 3M6GA 3NH0A 5IWAK 4LH5A 3QERA 4JV5K 4CIGA 4EIAA 5HRRA 3VQ4A 4KKOA 1BWFO 1RTJA 3NF6A 1G15A 4JNEA 4BC5A 4BE1A 4BR4A 1Q81O 2Z1GA 3ZX0A 3OYIA 4CEEA 4YOVA 2R7YA 4W5QA 4BRNA 3NF9A 1GLAG 2D0CA 3IAYA 2X78A 3OY9A 4F2SA 3U4LA 2HVHA 2BH1A 4FWQA 5AQOA 4W5NA 3ITHA 3AVMA 4NCGA 1KVCA 1ZYQA 3TU5A 1L3TA 3MX2A 2DY4A 2E20A 2VG7A 1E4FT 4E7JA 2VG6A 4ZHRA 3VQ9A 1TAUA 1GLCG 4GVMA 4QS9A 3WXMB 5DM7L 1TUYA 1UAXA 5AQRA 4RCHA 2OZMA 2ASMA 3IS9A 4M3UA 4JI1K 4CGHA 4MDBA 4X62K 3QBXA 4WFAL 4FJNA 2P9LA 3RMCA 3FGUA 5J1EA 1LAVA 4DR2K 4BR2A 4CCHA 4Z4CA 1VSHA 3MDQA 2A40A 3EE9A 5C24A 3S3OA 4NYFA 1A5WA 2YHBA 5ADXH 4AH9A 4CJEA 3AAPA 4Y0WA 3SYZA 4B9TA 4BRMA 4NB4A 4XH4A 5KQDA 1KVAA 1Z05A 4O0IA 1WSJA 4OPKA 1VQ5N 3SJJA 1D9FA 1BQNA 2VYPA 3QNNA 3MCPA 4E7KA 4KO0A 1C1AA 4G9ZA 1TK5A 3HK2A 3DLBA 5JMVA 1RGIA 2XHBA 4IOXA 1O13A 3QNOA 4AHTA 5KQ8A 1GLLO 3P1GA 4CJ4A 2VQFK 3CFRA 2IIRA 5AQFA 3OBWA 4K43A 1IH7A 3JAMO 4KHQA 4IJNA 3O9SA 3LZJA 4H0OA 1DKGD 4DUYK 1Q82O 1HNVA 4W5TA 5AQPA 3OVNA 3L2RA 4M42A 3DM2A 3KWGA 4W5RA 1RBRA 2HF4A 4K41A 4ZTFA 1WSFA 4MO4A 3TPQA 2P5OA 1Z6RA 1NGIA 3DYAA 1OVQA 3A0IX 1LWCA 4FWLA 4LD0A 3MWPA 4FJ5A 1W97L 1OKJA 2KLAA 4CHQA 3SPYA 3ENBA 4OKKA 3G71N 4BC2A 2QI2A 4U67L 4QS8A 4X64K 1VQ7N 4PKIA 2A41A 2O8CB 1K8AO 1HNIA 1ASVA 1NK0A 3N4PA 4CW7B 4CK1A 3TABA 4NCAA 3G4SN 4B9QA 1M90O 3NH2A 1BQMA 5F1XA 5EX5A 3F73A 2IVOA 3C6TA 4PQUA 2DTUA 4BR7A 2FSKA 3OS0A 4DV2K 3L2QA 4FSVA 4AF1A 4CK2A 3D2FA 1LW0A 1XMQK 5J2NA 3OYAA 3WNEA 4CF9A 4V19S 3K5MA 4KI6A 3OYHA 3AVKA 4JI6K 4YHHK 4FCYA 3VGMA 2E2NA 5KRSA 1SKSA 4DR1K 3V81A 2O4GA 4KHSA 4FZXC 1MU2A 4BRAA 2HBKA 2HHUA 4YOYA 4CHPA 4BWJA 4DMNA 3KLFA 5AJ3K 4E1NA 3D2FB 1R0AA 3F9KA 4X65K 1MDUB 4ID5A 4L3QA 3W0LA 4LF6K 5M1FA 4JI3K 4DV7K 4YFUA 1TKZA 3Q7CA 4DLEA 1XUPO 3IDHA 3L4IA 3SI6A 4PKGA 1KVBA 5FROA 3OW2M 1VSFA 1DT9A 2YHYA 1VSDA 1BO5O 4C8NA 1KC8O 5MLCQ 2E1YA 1KAXA 3DWLA 3HP6A 3WT0A 2AJQA 1XHZA 2QXLA 3N4QA 4JKEA 1BHLA 3O5BA 1NJYA 2BGGA 1XNQK 4DV1K 4I2QA 4BDPA 4FK0A 3TTFA 4HVJA 3HPOA 3THWA 5LMUK 4DS4A 4I6MA 3DRRA 4RW7A 1HYSA 1S6QA 3ENHA 3OYCA 1ASUA 1EETA 1RT2A 3DLEA 2ETJA 4GKJK 3ZT4A 2JWKA 3G0ZA 1X3NA 3F2KA 5HRPA 2P9UA 3H1VX 4BWMA 5I9EB 4M45A 4DUZK 4KTQA 2YX6A 1SL0A 5AZJB 4IG3A 4OPJA 1RBVA 3DXKA 1NNEA 5KGXA 3H08A 5JLHA 1JLQA 4FJLA 2W42A 2P9SB 3THWB 2Z1JA 1NOYA 4DR5K 4I6MB 4AM7A 5EU7A 4H5TA 1RBUA 1RNHA 1VQNN 2JGUA 5JS2A 1EQYA 4KB1A 4IDKA 1LV5A 1WUAA 1VQ8N 1NK5A 1OH8A 4BROA 3ZSQA 5KI6A 1UWBA 3VN5A 1BOTO 4CJQA 1RDCA 3LWMA 5M1KA 2GV9A 3VTIA 2Q1NA 2CGJA 4WQ4C 4JRQA 1S1UA 3BGRA 4CBWA 1EKEA 4BR0A 2NRZA 3DXKB 3O8MA 4Z0UA 1V4SA 3J7ZO 5HLFA 5J2QA 1TAQA 4CIEA 1NK8A 1C6VA 1NK6A 2G8HA 4B3TK 2VGMA 3CJ9A 3DJCA 4FO0A 2RHKA 3CYMA 5JVHL 4JK9A 2VWJA 5GAHP 5AFUA 3PO4A 3VESA 1JLBA 4GKKK 3E01A 2G8UA 1LAWA 4I9QA 4CGJA 1RTDA 3BY5A 1VQ9N 5GINA 3O6WA 4FZZA 4YNQA 3HXMA 3THXA 1GLEG 3AVFA 5CHIA 4AILC 3O3FA 2P51A 4FJIA 3T7ZA 4M3TA 4FJJA 2O8BB 4R5PA 3TANA 2X6NA 3OYBA 4MLEA 1JXBA 3AARA 2UXDK 5LMNK 1QHAA 3QIOA 3G10A 1YUWA 4WQ4A 1BGXT 4DFJA 5CR4A 1C0UA 3I0SA 4JD2A 3U9ZA 1NOZA 5F0XA 1QZ6A 3SZ2A 1X9WA 1HUXA 1UOCA 4BRDA 2V52B 3KZBA 3B8AX 2XY5A 2BANA 1JL1A 5JLFA 1M1KO 3AO3A 1BCMA 4A57A 2O4IA 4CEBA 3KD1E 1XNRK 1S3XA 4RW8A 1IKXA 4BR5A 2DFEA 3SV4A 5LJVA 5AQXA 2ASPA 3CCSN 4DSFA 1RDAA 4IG0A 3FZLA 1RT6A 1JXEA 2I5JA 2D4WA 1YJWN 4OLBA 4JD2B 1WB9A 4IFYA 2YNHA 1TUUA 4LF9K 3QIPA 3SNNA 1YAGA 1ZC6A 2YHAA 4F3TA 3AA4A 1YI2N 3QEPA 3EE8A 5C42A 3EKUA 4E3SA 2WC9A 3KD5E 2Z1HA 4GMJB 3NGYA 3KK7A 5FPEA 3V1QA 4IXCA 1E4GT 1NMNA 1JLCA 1NGHA 4BRQA 4CJLA 4AHCA 3FFIA 5HRNA 4FJXA 5AQGA 4ID1A 1KQSM 1ZBHA 4DG1A 1FK9A 2FF3B 4LSNA 3VQCA 4BRHA 3CQ8A 4E7LA 3RR7A 1QZ5A 3O9QA 3DOLA 4KH4A 1S22A 3LAKA 1HQUA 1KAYA 1IO2A 1X3MA 4LFCK 4GVEA 4B9VA 1HJRA 2F9TA 3J81O 3PIOL 4CZLA 2VGNA 4TSXA 2XY8A 3DLGA 1YTUA 3UB5A 4CECA 4H0XB 3NVKA 3S3NA 3NBPA 2P9IA 1N34K 3M1FA 5CZ1A 1VRTA 3L3VA 2O8DA 1B92A 2A6AA 4CFCA 5EOYA 2D0AA 4DWIA 3UIQA 3THVA 3QFUA 5GADP 4B1WB 1SKRA 4DR7K 2XRIA 3MEEA 4JHDB 5D3GA 1WNSA 2FLOA 3HM9A 2E6MA 4Q5VA 4B1YB 1BISA 1JLFA 1NGCA 3HO1A 4U7BA 2OTJN 5EY4A 2Y1IA 1HR0K 1X1PA 2ZJRL 3AV9A 2P9IB 3WXKA 3BDPA 1S1WA 3D0PA 3EY1A 2O8DB 2ZJPL 4OGEA 1RDDA 1RT3A 1W9HA 3S9HA 3NH1A 4FOEA 2G8FA 4BRLA 1RT1A 4BQLA 2OPPA 1BG3A 2PBDA 3DLHA 3CMEN 5BN8A 2D1KA 3L2WA 3TSQA 4O55A 1T6CA 5AR0A 1JLGA 4BC4A 1ZBSA 1T03A 3SAFA 2HHWA 3P31A 1NGAA 3M8SA 4BY9C 1CZ9A 4GV6A 2G8WA 4FWSA 5B8HA 4CEDA 4H8KA 3VQBA 5DK5A 3WQUA 3C6UA 4B1VA 4JEPA 1J53A 1S6PA 1HNXK 1FKOA 1QHTA 3O08A 3K57A 3QEIA 2GX9A 4MDAA 3CCRN 3CF5L 1WSEA 4CZGA 3OHRA 4DFPA 3A2FA 1P8ZA 5E41A 2V51B 4FWMA 4IZ9A 3A5NC 1Y97A 3LDOA 3M8PA 4KPYA 4EZ6A 3EN9A 4YOUA 2WTUA 4JK8A 3LM2A 4Z94A 5KPZA 3V9WA 4EP4A 4IEEA 2YKNA 3NHGA 4JKFA 4B3RK 3HRGA 2IVNA 2HSTA 3VEOA 2E2OA 1HKCA 4K42A 5FDLA 4CFDA 3OJUA 2YV0X 2ZJQL 3TSPA 1IKWA 2P5GA 4DTSA 1S1VA 4WFNL 3ASMA 3MEGA 3QEVA 3LDPA 4E7HA 4CJ7A 3WUHA 3Q7BA 1C0GA 3AY9A 3V9XA 3CC4N 1HYVA 2OA8A 2WUSA 1TL1A 1DTQA 3ISNC 5FRMA 3I56N 4DQQA 2FXUA 3OYGA 3KK1A 4W5OA 1GLDG 4KRFA 3K9JA 3QEWA 3A8YA 3PX4A 2Q0UA 2ZWHA 1U6ZA 4AQYK 4A62A 1NGEA 3QB0A 1TK0A 4E89A 5HRSA 2HHHK 1IKVA 4M63C 4E1MA 5I3UA 4FWOA 2QWNA 4B1XB 1S5JA 2KZZA 2DFHA 4QOZB 1TL3A 1DEJA 2UXCK 4CERA 4DR4K 4NLCA 4AM6A 4WCEL 4M41A 3UKUA 1NMDA 3HM8A 4C8LA 1CXUA 3P83D 4FWNA 3SBTA 2G8VA 3VQ6A 1RBSA 4DTJA 1JCFA 4JK7A 5AQIA 3ZX2A 3V6DA 4HTLA 5CE3A 1YITN 3KVGA 4FK4A 3I33A 1ZBLA 3DRPA 1SZ2A 3BZCA 2PZSA 2RE2A 2NRVA 3O9UA 3E9PA 4E0DA 4NLBA 4FWPA 4CVNE 2GWKA 4FZYA 3HPGA 4C8OA 3RMDA 4H03B 4DTOA 3CJ7A 2BDPA 3VOVA 3SAGA 3LP0A 2F9WA 3VEZA 3I55N 2P9LB 4MFBA 3OS1A 2FC0A 3UKUB 4Y1DA 3BF1A 3WNHA 3PO5A 2GEMA 3KJVA 4ICLA 3GOIA 3HP9A 4DTNA 5AFUH 2HMIA 3E9LA 1IJJA 1Q86O 3EEQA 4WYBA 2BUPA 2F96A 4CF0A 4AHUA 4JI8K 5AQLA 1Q8IA 5KPRA 1GOAA 4OKJA 1TKTA 3SUQA 3MXJA 4CJWA 1BA1A 1RTIA 2HNYA 1NGGA 3AVLA 2QA4N 3CJ1A 4LF4K 1SV5A 2ZGYA 2PFUA 1RT7A 1WSGA 2FSJA 4F8RA 4FVMA 5FLXO 2YKMA 1BIZA 1S72N 4CK3A 4CZHA 3LP1A 3SUPA 4CJKA 3SPZA 3VEWA 3LDNA 3OYJA 4CI6A 4EZ9A 4B9SA 1EP4A 4DLGA 1HQEA 4BREA 2CGLA 4CF8A 1V4TA 1WOQA 4IOAL 2NRHA 4BC3A 3KLHA 4A61A 3QO9A 3RTVA 4ILJA 3CQYA 2ATQA 4M3ZA 4YORA 4IKFA 4FLVA 4FPAA 3LP3A 1E3MA 5BRDA 4BRFA 3BP8A 1D9DA 1NK9A 3TWHA 4PL8A 4B9NA 4Z4GA 3ZSXA 2AP1A 1UA1A 4B3MK 4JI7K 4CZFA 3TSUA 5SWMA 5J2PA 5DM6L 3U3YA 3TTCA 2X74A 4Y1CA 2VQEK 5J2MA 3FR0A 5C25A 3IG1A 3MWTA 1ILYA 3CIPA 5TKWA 3MN6A 4JAXA 2Z1IA 3LAMA 3OYKA 2P9NA 3DAWA 5AQMA 2BTFA 3ZSWA 3L2VA 4CIFA 4CZMA 1NKBA 1VSLA 4FJKA 4CFBA 3VERA 3PY8A 1T6DA 2RPIA 4FW1A 3OYNA 3NFAA 4CJUA 3I8DA 5HL7L 1NJZA 5HROA 4HCCA 3L0QA 4YOWA 4CEAA 3ENOA 4HHTA 3M3ZA 4A59A 3SCXA 3IUCA 1WLJA 1HNZK 3FZMA 4DV6K 3BUZB 4FW2A 3AVAA 4BGAA 4FJ7A 3FLCO 3P5JA 1YT3A 2QWQA 2D0OA 3PLAA 1VQLN 1NM1A 3LL3A 1NJWA 5KRTA 1L3VA 2QWMA 5GAEP 3NGZA 1ESVA 2QW9A 1SQKA 2X6SA 3CC7N 4Z4EA 5ELZA 3NAEA 2A1RA 2Q31A 3ZX3A 1J5EK 2NNWA 1RDWX 1JL2A 3AA2A 3TAPA 1YVUA 3CERA 3LDLA 3ZSZA 4CBUA 4KTZA 4R79A 1OVYA 3QEXA 1W0HA 1ZBUA 1CLQA 3TTDA 4KH6A 2QTDA 1F21A 5M1OA 4FLTA 4K0KK 2HHSA 3MXMA 2XY7A 3WXLA 3H3NO 1EWQA 2W41A 4MO5A 3NDKA 4DSEA 4AHRA 1ATSA 1S9EA 2E5LK 3HL8A 2PYJA 2KW4A 5JS1A 4CJTA 1QE1A 1NKCA 1U45A 1KRPA 3DLLL 3FE1A 1HNWK 5AQKA 1NGFA 2B6AA 3LDSA 4CD1A 5EXWA 1HLUA 1QQCA 2GWJA 1BUPA 4DR6K 3LM9A 1U2VA 1I3AA 4JI4K 1K9MO 3R3LA 3E9OA 3V1OA 3VGKA 5C10A 4JLHA 1TYQA 5BR9A 4BRGA 1VSMA 4ISEA
chains in the Genus database with same CATH topology
4JI2K 4X66K 4LF6K 4B3TK 4JI3K 4DV7K 4DV0K 4LF5K 4LFAK 1HNZK 4DV6K 4B3SK 2UUAK 4YY3K 1I94K 4NXNK 4GKKK 4JYAK 4LFCK 4LF8K 4JI5K 3J81O 2UUCK 4LF7K 4B3RK 5A2QO 4JI8K 5LL6Z 1XNQK 4DV1K 5BR8K 4LF4K 4X64K 1IBKK 1N34K 4LFBK 4DV5K 2UXDK 5LMNK 1J5EK 5LMUK 3J80O 5FLXO 4DV3K 1N36K 2ZM6K 4CW7B 4KHPK 1N32K 4DR7K 4JI1K 2UU9K 1FJGK 4X62K 4NXMK 4GKJK 4DR2K 1XNRK 4K0KK 3OTOK 4DUZK 4DV2K 4OX9K 5IT9O 4AQYK 1HR0K 3T1HK 1XMQK 2HHHK 2UXBK 4JI0K 2UUBK 4V19S 2E5LK 4DR5K 3T1YK 3J7AP 4B3MK 3J7YP 4JI6K 4YHHK 1IBMK 4JI7K 4LF9K 1HNWK 1XMOK 2UXCK 2F4VK 4DR4K 2VQEK 1IBLK 1N33K 4DR6K 4DR1K 4DV4K 2VQFK 4JI4K 3JAMO 5IWAK 4DR3K 4DUYK 1HNXK 5AJ3K 4X65K 4JV5K 4CVNE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI2 K;  4X66 K;  4LF6 K;  4B3T K;  4JI3 K;  4DV7 K;  4DV0 K;  4LF5 K;  4LFA K;  1HNZ K;  4DV6 K;  4B3S K;  2UUA K;  4YY3 K;  1I94 K;  4NXN K;  4GKK K;  4JYA K;  4LFC K;  4LF8 K;  4JI5 K;  3J81 O;  2UUC K;  4LF7 K;  4B3R K;  5A2Q O;  4JI8 K;  5LL6 Z;  1XNQ K;  4DV1 K;  5BR8 K;  4LF4 K;  4X64 K;  1IBK K;  1N34 K;  4LFB K;  4DV5 K;  2UXD K;  5LMN K;  1J5E K;  5LMU K;  3J80 O;  5FLX O;  4DV3 K;  1N36 K;  2ZM6 K;  4CW7 B;  4KHP K;  1N32 K;  4DR7 K;  4JI1 K;  2UU9 K;  1FJG K;  4X62 K;  4NXM K;  4GKJ K;  4DR2 K;  1XNR K;  4K0K K;  3OTO K;  4DUZ K;  4DV2 K;  4OX9 K;  5IT9 O;  4AQY K;  1HR0 K;  3T1H K;  1XMQ K;  2HHH K;  2UXB K;  4JI0 K;  2UUB K;  4V19 S;  2E5L K;  4DR5 K;  3T1Y K;  3J7A P;  4B3M K;  3J7Y P;  4JI6 K;  4YHH K;  1IBM K;  4JI7 K;  4LF9 K;  1HNW K;  1XMO K;  2UXC K;  2F4V K;  4DR4 K;  2VQE K;  1IBL K;  1N33 K;  4DR6 K;  4DR1 K;  4DV4 K;  2VQF K;  4JI4 K;  3JAM O;  5IWA K;  4DR3 K;  4DUY K;  1HNX K;  5AJ3 K;  4X65 K;  4JV5 K;  4CVN E; 
#chains in the Genus database with same CATH topology
 4FLW A;  1RCH A;  2P9K A;  1RDU A;  3WNG A;  4EP5 A;  5KPT A;  4BRK A;  2WBN A;  2QKB A;  4KV8 A;  1N6Q A;  4J2B A;  4F2R A;  3IRX A;  1I94 K;  3U8X A;  1JCE A;  3VF4 A;  2P9U B;  1QVF M;  1SL2 A;  1LWE A;  1D5A A;  3HI0 A;  2W6L A;  1U2V B;  1B9D A;  4IJA A;  3O80 A;  1EO1 A;  3M8R A;  2HNZ A;  1XQS C;  3EO3 A;  4H0V B;  2I7P A;  2IAJ A;  5ADX A;  4FM2 A;  2HBJ A;  3NE6 A;  1IBK K;  4KHU A;  2NRT A;  3C6H A;  5AQZ A;  3CFO A;  2Q0R A;  4OKE A;  1JKH A;  3OYM A;  3SUO A;  3RSE A;  3H46 O;  1T8E A;  2VCP A;  4PY5 A;  4LH4 A;  1Z26 A;  4XH5 A;  4DSL A;  4ILH A;  4G1Q A;  5E84 A;  3V9U A;  3B6O A;  1Q18 A;  3BEX A;  1ZXO A;  4I2P A;  1C0M A;  4B8A B;  3ATU A;  3C0B A;  4XH1 A;  3RWU A;  4CGI A;  3ULE A;  3R9P A;  4JKB A;  1XWL A;  5C2D A;  3J7Y P;  5AQJ A;  2VG5 A;  4O4G A;  3CCM N;  4OPA A;  3HOS A;  3THX B;  4BR9 A;  3C7N A;  4DTR A;  4H0Y B;  2IGI A;  4C8K A;  3WXI A;  1JLE A;  4JKH A;  3D2E A;  4C1N K;  3HVT A;  1R59 O;  4FM0 A;  1XC9 A;  2FF6 A;  5HP1 A;  3CQX A;  4FWR A;  3VET A;  3T3F A;  3ULE B;  3S3M A;  1Q9X A;  1Z25 A;  3WNF A;  4F4K A;  3H45 C;  4WQ5 C;  1QQM A;  3NGI A;  2NZT A;  1GLF O;  2KKZ A;  5GAG P;  3C7N B;  4ELV A;  4FJH A;  4I9L A;  4JRP A;  4CEQ A;  5F2R A;  3ZYY X;  4HUF A;  4BVO A;  4CZI A;  1JCG A;  2P9P A;  4LF8 K;  4CZE A;  5C12 A;  5AZI A;  4FLX A;  3SLC A;  3LAL A;  4O8U A;  3D2E B;  1BIU A;  5BN9 A;  2OPS A;  4AHV A;  3MEC A;  4DB3 A;  5BPN A;  3RRG A;  2D0P A;  2HHQ A;  1NWK A;  3U6F A;  3VQA A;  1X9S A;  4BRP A;  4DQI A;  2HMP A;  1KLM A;  3HOT A;  3DI6 A;  3O9T A;  4RW4 A;  3FFK B;  3K9K A;  3RVC A;  4J2A A;  2W40 A;  2P9P B;  2OPR A;  5AZI B;  1U48 A;  5EVZ A;  5AQT A;  2JLE A;  1MWM A;  3AGK A;  3KTQ A;  1J9A A;  2HND A;  5AQN A;  3BZK A;  4WQ5 A;  3QDK A;  4KHW A;  4RWT A;  2ASO A;  2NRW A;  2ZQB A;  4HWI A;  3ZET A;  4AHS A;  5M1P A;  3THY A;  2BE2 A;  3PUF A;  2CH5 A;  4UQG A;  4FOI A;  4IDH A;  4FL9 A;  3L8B A;  3J7A P;  3T69 A;  1IBM K;  1HKG A;  1NK7 A;  4Z4H A;  3L2U A;  4QAG A;  1LWF A;  1HJO A;  3IMX A;  5C15 A;  3TAR A;  4DQS A;  4DTX A;  4EHT A;  3MN7 A;  1BCO A;  2HOE A;  2RN2 A;  3OJS A;  4DR3 K;  1TKX A;  3OYE A;  2A3Z A;  4JN4 A;  3ZET B;  3THY B;  3AVN A;  4IFE A;  4X66 K;  3A5M C;  3S41 A;  3BF3 A;  1J5O A;  2ITG A;  3MXI A;  3LPU A;  4M3Y A;  5FPM A;  3MN9 A;  1OH5 A;  3AVC A;  2UYT A;  2W6K A;  4CJ3 A;  3PSI A;  1NGD A;  3NVM A;  4DQR A;  1NG9 A;  3ZT3 A;  1C1B A;  5H1S Q;  4WF9 L;  1S9G A;  1HPZ A;  1U47 A;  1WBD A;  5AQQ A;  5FPD A;  4LF7 K;  1WAJ A;  3SJH A;  3HYF A;  3VQQ A;  2XY6 A;  2DFF A;  3PIP L;  1K73 O;  1NGJ A;  3AO5 A;  2YNG A;  4EAH D;  3C65 A;  1I39 A;  3CJC A;  3R8E A;  1VSK A;  4JKG A;  4DV5 K;  3VA0 A;  2CGK A;  1KFD A;  4H5R A;  4HTU A;  3RMB A;  3ID8 A;  2Q36 A;  4KHP K;  1NBW A;  1KD1 O;  4YOT A;  1QQO A;  4DU3 A;  1S1X A;  4B1U B;  3CMA N;  4DSK A;  1KLN A;  1T44 A;  1VHX A;  2E1Z A;  3EYZ A;  3C6A A;  4GNI A;  4BRC A;  1ZBF A;  4KRE A;  4DFM A;  3SBG A;  1W2B M;  3B6P A;  4JKG B;  4CJS A;  3TAF A;  1N8R O;  2QWO A;  3RMA A;  3PX0 A;  3EZW A;  1QQN A;  2LSN A;  4CGD A;  2ZD1 A;  1C0T A;  4OJR A;  4FPB A;  1FW6 A;  5GIO A;  3A5O C;  2D0B A;  3HTV A;  3IKM A;  2YJF A;  4DCH A;  4KAZ A;  2FBX A;  2PY5 A;  3MMV A;  4QCL A;  3DMJ A;  1UA0 A;  3CG7 A;  4B08 A;  4DF4 A;  2IC3 A;  3D6R A;  2OPQ A;  4CEO A;  3V4I A;  2OYQ A;  3MAQ A;  4CHY A;  3ATV A;  4DFK A;  5CY4 A;  3CET A;  2QEX N;  1T3V A;  1Q9Y A;  4FLU A;  1Q7Y O;  2NUB A;  3HVR A;  1VK0 A;  3VF2 A;  5I42 A;  4H5W A;  1J54 A;  4FXD A;  3MCA B;  4B3O A;  1U04 A;  3AVB A;  3TR8 A;  2GUP A;  5JVG L;  3U3G A;  5LY3 A;  4O8K A;  2F8T A;  5GIP A;  4ZTJ A;  1NK4 A;  4CGF A;  2UUC K;  4O5F A;  4IO8 A;  4DKW A;  4DSI A;  4BVP A;  3ZSY A;  1VQP N;  5AQV A;  4KH5 A;  1WAF A;  4BDZ A;  4CEZ A;  5BRH A;  1LW2 A;  2E6L A;  2ZE2 A;  4CJF A;  4J8F A;  4PWD A;  2A42 A;  2ZM6 K;  3V9S A;  3H3O B;  3EL2 A;  1BDG A;  2WON A;  3QBW A;  1RT5 A;  3HPH A;  3ZT0 A;  4HCB A;  1NU0 A;  1L3U A;  4ELU A;  3GG4 A;  1EWR A;  2UU9 K;  1FJG K;  4WFB L;  1BL3 A;  4FWK A;  1VSI A;  4RG8 A;  4CF2 A;  2XO7 A;  3D7E O;  1IG8 A;  4E7I A;  4LSL A;  4HUG A;  4BAC A;  3CJB A;  3VEX A;  3VEV A;  4DSJ A;  4E19 A;  2I7N A;  1RTH A;  2IOC A;  3WXJ A;  3CM6 A;  5JIC A;  2B5J A;  4IWV A;  4DF8 A;  2UUB K;  3ZT1 A;  3AVH A;  1YF5 L;  5SZT A;  4OO1 J;  5FPN A;  3DXM A;  3O1W A;  3SAH A;  3SQ2 A;  4DHY A;  1HMV A;  3QFP A;  3VA3 A;  4CJ5 A;  2KFZ A;  3L4Q A;  1X9M A;  2V7Y A;  2O8C A;  3P38 A;  1ATN A;  1DLO A;  4DV4 K;  3KLI A;  4Z4F A;  3PSF A;  2HBL A;  3QML A;  3VEY A;  4CHO A;  3EZ5 A;  2CH6 A;  1VQ4 N;  2E8A A;  3SV3 A;  4N56 A;  4CHN A;  2QWP A;  4ISF A;  3K5L A;  4YDU C;  3VGL A;  4DU1 A;  1VSJ A;  5AQH A;  1K6Y A;  1YVN A;  3F5T A;  3R1X A;  1B9F A;  4JI2 K;  4DTM A;  5AQS A;  3CCQ N;  2YJE A;  5CZ2 A;  3DXM B;  2GTD A;  1T05 A;  2Q3S A;  1QSL A;  4FJM A;  1IV0 A;  1VSE A;  1U49 A;  3QIC A;  1GOB A;  4YY3 K;  1TGO A;  4NXN K;  3KK2 A;  3AO1 A;  3WQT A;  2KZM A;  3KIO A;  4FYD A;  1XHX A;  2H3G X;  3O4W A;  3HST B;  2NRX A;  5A2Q O;  3SUN A;  3F9M A;  3JS6 A;  5K14 A;  1REV A;  3QIN A;  3O1B A;  2FBT A;  4KHY A;  1N5Y A;  4C23 A;  1DGK N;  1ZBI A;  4B9L A;  3EKS A;  4CE9 A;  3ZSR A;  2WFB A;  3AA5 X;  3LP2 A;  4RW6 A;  1QSS A;  2HHV A;  4CD3 A;  1XC3 A;  3KKR A;  1YJ9 N;  3AVG A;  4YDU A;  4M7Y A;  4FJ8 A;  1H1V A;  2HBM A;  4OLA A;  3O3G A;  4NYN A;  3VQ7 A;  4B9M A;  3NF8 A;  2P9N B;  5M1N A;  2QXF A;  1HPM A;  2QWL A;  1GLJ O;  3ZLJ A;  2QKK A;  2EHG A;  1WSH A;  3ALY A;  4JKA A;  4O44 A;  3CXC M;  1BI4 A;  1XI1 A;  4FK2 A;  4XEI A;  4A2B A;  3OTO K;  2EWS A;  4OX9 K;  1WSI A;  1QTM A;  5IT9 O;  4H4M A;  3CJA A;  2AA4 A;  3KLG A;  1NGB A;  3H1Q A;  4YOX A;  4E1J A;  3V1R A;  3SQ0 A;  3T19 A;  4A5B A;  1WN7 A;  2UXB K;  2KHO A;  3ZCM A;  3R6M A;  4BE0 A;  4MQ3 A;  4GY2 B;  3O3H A;  4CBX A;  1S1T A;  3CCE N;  1MA9 B;  1XMO K;  3DLK A;  4A5A A;  4PA1 A;  1NJX A;  1IBL K;  1OH6 A;  1GLB G;  3LDQ A;  4JS4 A;  3CI5 A;  3TAQ A;  1CZA N;  1BA0 A;  4H5N A;  3W3D A;  1BI4 B;  4JS5 A;  1X9J A;  4KI4 A;  5AQU A;  4LC9 B;  1KAZ A;  3VQP A;  1NLV A;  2Q97 A;  3SMP A;  4CFA A;  3L3U A;  4PKH A;  2GEL A;  3GE1 A;  4FM1 A;  3CHW A;  4KB0 A;  4A2A A;  4KBO A;  4CZJ A;  4N76 A;  3HJF A;  5AZJ A;  2YHX A;  4H5V A;  4DV0 K;  1ITG A;  4LFA K;  3WEE A;  4B3S K;  1SKW A;  2UUA K;  1EXQ A;  3MX5 A;  2P9S A;  2RKI A;  4NO7 A;  1SUQ A;  1VAZ A;  3M5R A;  2GBZ A;  1FXX A;  4B9U A;  3SK3 A;  3UKR A;  2OZS A;  4UY8 O;  1TV6 A;  4JI5 K;  4CHZ A;  3GDQ A;  1EX4 A;  3LAN A;  3ZT2 A;  4KTW A;  1Y64 A;  2Q2R A;  3KKS A;  3QES A;  2IVP A;  5BR8 K;  1C0F A;  4N41 A;  4LFB K;  3AO4 A;  3LWL A;  2B4J A;  3CPE A;  2VWK A;  5KGW A;  5M1Q A;  3CPW M;  3O4N A;  3CD6 N;  3WEE B;  4CEF A;  1KCF A;  1MWK A;  4DV3 K;  1N36 K;  2RF2 A;  4OPH A;  1KFS A;  1IG9 A;  1IKY A;  3HBT A;  3O9R A;  5C2F A;  4MLH A;  3OYD A;  2YNF A;  4CGG A;  4EHU A;  1VRU A;  4DS5 A;  3UKR B;  3FZF A;  4NXM K;  1TYQ B;  1QSY A;  1ASW A;  4HUE A;  4BG8 A;  2F8S A;  2G8K A;  3LPT A;  2A5X A;  2P9K B;  1YIJ N;  3KLE A;  3C94 A;  2YI1 A;  3AAQ A;  3ULD A;  5BRE A;  3CCJ N;  3I0R A;  3QLH A;  2FBY A;  2O8E A;  2O8B A;  5DMR A;  3T1Y K;  2ZF5 O;  1GOC A;  3KHY A;  3UE5 A;  4CZK A;  3NMU A;  2OCE A;  4C1N I;  2PAV A;  1TK8 A;  2HVI A;  3JSM A;  4FJ9 A;  3K5N A;  4M3W A;  2HHX A;  4PHT X;  3V9Z A;  3O4Q A;  1SS6 A;  3ZEU A;  1NJI O;  3MK6 A;  1LOT B;  3K2P A;  2YNI A;  3CFP A;  1BU6 O;  1HX1 A;  4F9O A;  3SMS A;  1D4X A;  4K8Z A;  3IFR A;  1FKP A;  2J4R A;  4K25 A;  3RSE B;  3SQ1 A;  1JJ2 M;  4O0J A;  2O8E B;  4LF5 K;  4DQP A;  3OS2 A;  3TAG A;  5HOO A;  4BDY A;  2WOM A;  3OA9 A;  1K8K A;  2HB5 A;  4JYA K;  2DPN A;  3AA3 A;  4M3X A;  1WBB A;  3AGR A;  4CF1 A;  4O5B A;  3E66 A;  3CCV N;  4JKC A;  3AO2 A;  3VEN A;  4JKD A;  4RTF D;  3ZEU B;  4IBN A;  2HW3 A;  4IFV A;  5HBM A;  4PUO A;  5AQY A;  2IS3 A;  5LL6 Z;  1SL1 A;  2NLX A;  1RFQ A;  3A5L C;  3M8Q A;  5BRF A;  1VQM N;  3CC2 N;  4QS7 A;  4M7X A;  4BG9 A;  3H6E A;  4DTU A;  5TKY A;  3P39 A;  3U9D A;  2O8F A;  4OVL A;  3DLR A;  3J80 O;  1KTQ A;  3HZ6 A;  2V7Z A;  4IO9 L;  4DTP A;  1T7P A;  1N32 K;  1K8K B;  1TVR A;  4H0P A;  2ITM A;  3PX6 A;  2F7T A;  1QS4 A;  3PV8 A;  3I8B A;  4Q0B A;  3HSC A;  4RW9 A;  1W7A A;  4GV3 A;  1RIL A;  1O1W A;  4CJV A;  5T7B A;  3G6E N;  3C95 A;  4WE1 A;  4B1Z A;  3ZSO A;  4FLY A;  3TAM A;  1YTA A;  3T1H K;  1DTT A;  4FJG A;  2KFN A;  2KQ2 A;  4GV9 A;  2O8F B;  4JI0 K;  3K59 A;  4B8C A;  1CZB A;  4J2D A;  3CCU N;  4FVU A;  4FLZ A;  3KWI A;  4ILG B;  1YHQ N;  3K5O A;  1HKB A;  1CXQ A;  4BRI A;  3TI0 A;  2QM1 A;  2P1J A;  1N33 K;  5AQW A;  3G25 A;  3VQD A;  2NRR A;  1VQK N;  1A5V A;  2OTL N;  3J8A A;  4JHD A;  3OYF A;  1KSP A;  1G99 A;  2E2Q A;  1C1C A;  4CES A;  3JYT A;  4CJP A;  4IOC L;  3NF7 A;  1LCU A;  1JLA A;  5CYM A;  4OGC A;  3VQ8 A;  4K8X A;  1A5X A;  1YXQ A;  4PL7 A;  3T1A A;  3RR8 A;  3GBT A;  4KFB A;  4N47 A;  2HHT A;  3K0S A;  3KK3 A;  4N5S A;  4I7F A;  1U4B A;  4H0T B;  4F3O A;  4IEI A;  3D45 A;  1J6Z A;  1P90 A;  1OH7 A;  3K58 A;  3MN5 A;  4GW6 A;  4Z4I A;  2KTQ A;  2G8I A;  5CYQ A;  2FSN A;  1HRH A;  5KTQ A;  2QWR A;  4H4O A;  3ZSV A;  3L6Q A;  2VWB A;  3FZK A;  1ATR A;  1SAZ A;  2ZGZ A;  3VTH A;  3QET A;  1YJN N;  3DRS A;  3LZI A;  2IDO A;  2A1S A;  1KXP A;  2EX3 A;  4J2E A;  5BPL A;  4BE2 A;  3P4I A;  4LY7 A;  2E4L A;  3VMF B;  3AVJ A;  3HT3 A;  3DOK A;  1HYZ A;  1D8Y A;  1NKE A;  4CJR A;  1VQO N;  4ISG A;  1RDB A;  4EFH A;  2D5R A;  3TAE A;  3FZH A;  3OYL A;  3E1Y A;  1RBT A;  4XIU A;  5C0Y A;  5BPM A;  2HF3 A;  3SQ4 A;  1VQ6 N;  2PYL A;  3MED A;  4ELT A;  4M3R A;  3VQ5 A;  1TKD A;  3JXU A;  1QVG M;  3OBY A;  2Y1J A;  2YCH A;  5LJW A;  5FRN A;  3VF6 A;  1L5U A;  3NCI A;  4L8R B;  4NCB A;  3CM5 A;  2QK9 A;  4DQ8 A;  4BQZ A;  2F4V K;  3RRH A;  4KHN A;  5E26 A;  2JWL A;  3CCL N;  1RT4 A;  3AVI A;  3VPZ A;  4BGB A;  3VQE A;  4DU4 A;  1L3S A;  3ID6 A;  2OAN A;  2E2P A;  2E88 A;  3GL1 A;  2FBV A;  2GUI A;  4C8M A;  2YHW A;  3M6G A;  3NH0 A;  5IWA K;  4LH5 A;  3QER A;  4JV5 K;  4CIG A;  4EIA A;  5HRR A;  3VQ4 A;  4KKO A;  1BWF O;  1RTJ A;  3NF6 A;  1G15 A;  4JNE A;  4BC5 A;  4BE1 A;  4BR4 A;  1Q81 O;  2Z1G A;  3ZX0 A;  3OYI A;  4CEE A;  4YOV A;  2R7Y A;  4W5Q A;  4BRN A;  3NF9 A;  1GLA G;  2D0C A;  3IAY A;  2X78 A;  3OY9 A;  4F2S A;  3U4L A;  2HVH A;  2BH1 A;  4FWQ A;  5AQO A;  4W5N A;  3ITH A;  3AVM A;  4NCG A;  1KVC A;  1ZYQ A;  3TU5 A;  1L3T A;  3MX2 A;  2DY4 A;  2E20 A;  2VG7 A;  1E4F T;  4E7J A;  2VG6 A;  4ZHR A;  3VQ9 A;  1TAU A;  1GLC G;  4GVM A;  4QS9 A;  3WXM B;  5DM7 L;  1TUY A;  1UAX A;  5AQR A;  4RCH A;  2OZM A;  2ASM A;  3IS9 A;  4M3U A;  4JI1 K;  4CGH A;  4MDB A;  4X62 K;  3QBX A;  4WFA L;  4FJN A;  2P9L A;  3RMC A;  3FGU A;  5J1E A;  1LAV A;  4DR2 K;  4BR2 A;  4CCH A;  4Z4C A;  1VSH A;  3MDQ A;  2A40 A;  3EE9 A;  5C24 A;  3S3O A;  4NYF A;  1A5W A;  2YHB A;  5ADX H;  4AH9 A;  4CJE A;  3AAP A;  4Y0W A;  3SYZ A;  4B9T A;  4BRM A;  4NB4 A;  4XH4 A;  5KQD A;  1KVA A;  1Z05 A;  4O0I A;  1WSJ A;  4OPK A;  1VQ5 N;  3SJJ A;  1D9F A;  1BQN A;  2VYP A;  3QNN A;  3MCP A;  4E7K A;  4KO0 A;  1C1A A;  4G9Z A;  1TK5 A;  3HK2 A;  3DLB A;  5JMV A;  1RGI A;  2XHB A;  4IOX A;  1O13 A;  3QNO A;  4AHT A;  5KQ8 A;  1GLL O;  3P1G A;  4CJ4 A;  2VQF K;  3CFR A;  2IIR A;  5AQF A;  3OBW A;  4K43 A;  1IH7 A;  3JAM O;  4KHQ A;  4IJN A;  3O9S A;  3LZJ A;  4H0O A;  1DKG D;  4DUY K;  1Q82 O;  1HNV A;  4W5T A;  5AQP A;  3OVN A;  3L2R A;  4M42 A;  3DM2 A;  3KWG A;  4W5R A;  1RBR A;  2HF4 A;  4K41 A;  4ZTF A;  1WSF A;  4MO4 A;  3TPQ A;  2P5O A;  1Z6R A;  1NGI A;  3DYA A;  1OVQ A;  3A0I X;  1LWC A;  4FWL A;  4LD0 A;  3MWP A;  4FJ5 A;  1W97 L;  1OKJ A;  2KLA A;  4CHQ A;  3SPY A;  3ENB A;  4OKK A;  3G71 N;  4BC2 A;  2QI2 A;  4U67 L;  4QS8 A;  4X64 K;  1VQ7 N;  4PKI A;  2A41 A;  2O8C B;  1K8A O;  1HNI A;  1ASV A;  1NK0 A;  3N4P A;  4CW7 B;  4CK1 A;  3TAB A;  4NCA A;  3G4S N;  4B9Q A;  1M90 O;  3NH2 A;  1BQM A;  5F1X A;  5EX5 A;  3F73 A;  2IVO A;  3C6T A;  4PQU A;  2DTU A;  4BR7 A;  2FSK A;  3OS0 A;  4DV2 K;  3L2Q A;  4FSV A;  4AF1 A;  4CK2 A;  3D2F A;  1LW0 A;  1XMQ K;  5J2N A;  3OYA A;  3WNE A;  4CF9 A;  4V19 S;  3K5M A;  4KI6 A;  3OYH A;  3AVK A;  4JI6 K;  4YHH K;  4FCY A;  3VGM A;  2E2N A;  5KRS A;  1SKS A;  4DR1 K;  3V81 A;  2O4G A;  4KHS A;  4FZX C;  1MU2 A;  4BRA A;  2HBK A;  2HHU A;  4YOY A;  4CHP A;  4BWJ A;  4DMN A;  3KLF A;  5AJ3 K;  4E1N A;  3D2F B;  1R0A A;  3F9K A;  4X65 K;  1MDU B;  4ID5 A;  4L3Q A;  3W0L A;  4LF6 K;  5M1F A;  4JI3 K;  4DV7 K;  4YFU A;  1TKZ A;  3Q7C A;  4DLE A;  1XUP O;  3IDH A;  3L4I A;  3SI6 A;  4PKG A;  1KVB A;  5FRO A;  3OW2 M;  1VSF A;  1DT9 A;  2YHY A;  1VSD A;  1BO5 O;  4C8N A;  1KC8 O;  5MLC Q;  2E1Y A;  1KAX A;  3DWL A;  3HP6 A;  3WT0 A;  2AJQ A;  1XHZ A;  2QXL A;  3N4Q A;  4JKE A;  1BHL A;  3O5B A;  1NJY A;  2BGG A;  1XNQ K;  4DV1 K;  4I2Q A;  4BDP A;  4FK0 A;  3TTF A;  4HVJ A;  3HPO A;  3THW A;  5LMU K;  4DS4 A;  4I6M A;  3DRR A;  4RW7 A;  1HYS A;  1S6Q A;  3ENH A;  3OYC A;  1ASU A;  1EET A;  1RT2 A;  3DLE A;  2ETJ A;  4GKJ K;  3ZT4 A;  2JWK A;  3G0Z A;  1X3N A;  3F2K A;  5HRP A;  2P9U A;  3H1V X;  4BWM A;  5I9E B;  4M45 A;  4DUZ K;  4KTQ A;  2YX6 A;  1SL0 A;  5AZJ B;  4IG3 A;  4OPJ A;  1RBV A;  3DXK A;  1NNE A;  5KGX A;  3H08 A;  5JLH A;  1JLQ A;  4FJL A;  2W42 A;  2P9S B;  3THW B;  2Z1J A;  1NOY A;  4DR5 K;  4I6M B;  4AM7 A;  5EU7 A;  4H5T A;  1RBU A;  1RNH A;  1VQN N;  2JGU A;  5JS2 A;  1EQY A;  4KB1 A;  4IDK A;  1LV5 A;  1WUA A;  1VQ8 N;  1NK5 A;  1OH8 A;  4BRO A;  3ZSQ A;  5KI6 A;  1UWB A;  3VN5 A;  1BOT O;  4CJQ A;  1RDC A;  3LWM A;  5M1K A;  2GV9 A;  3VTI A;  2Q1N A;  2CGJ A;  4WQ4 C;  4JRQ A;  1S1U A;  3BGR A;  4CBW A;  1EKE A;  4BR0 A;  2NRZ A;  3DXK B;  3O8M A;  4Z0U A;  1V4S A;  3J7Z O;  5HLF A;  5J2Q A;  1TAQ A;  4CIE A;  1NK8 A;  1C6V A;  1NK6 A;  2G8H A;  4B3T K;  2VGM A;  3CJ9 A;  3DJC A;  4FO0 A;  2RHK A;  3CYM A;  5JVH L;  4JK9 A;  2VWJ A;  5GAH P;  5AFU A;  3PO4 A;  3VES A;  1JLB A;  4GKK K;  3E01 A;  2G8U A;  1LAW A;  4I9Q A;  4CGJ A;  1RTD A;  3BY5 A;  1VQ9 N;  5GIN A;  3O6W A;  4FZZ A;  4YNQ A;  3HXM A;  3THX A;  1GLE G;  3AVF A;  5CHI A;  4AIL C;  3O3F A;  2P51 A;  4FJI A;  3T7Z A;  4M3T A;  4FJJ A;  2O8B B;  4R5P A;  3TAN A;  2X6N A;  3OYB A;  4MLE A;  1JXB A;  3AAR A;  2UXD K;  5LMN K;  1QHA A;  3QIO A;  3G10 A;  1YUW A;  4WQ4 A;  1BGX T;  4DFJ A;  5CR4 A;  1C0U A;  3I0S A;  4JD2 A;  3U9Z A;  1NOZ A;  5F0X A;  1QZ6 A;  3SZ2 A;  1X9W A;  1HUX A;  1UOC A;  4BRD A;  2V52 B;  3KZB A;  3B8A X;  2XY5 A;  2BAN A;  1JL1 A;  5JLF A;  1M1K O;  3AO3 A;  1BCM A;  4A57 A;  2O4I A;  4CEB A;  3KD1 E;  1XNR K;  1S3X A;  4RW8 A;  1IKX A;  4BR5 A;  2DFE A;  3SV4 A;  5LJV A;  5AQX A;  2ASP A;  3CCS N;  4DSF A;  1RDA A;  4IG0 A;  3FZL A;  1RT6 A;  1JXE A;  2I5J A;  2D4W A;  1YJW N;  4OLB A;  4JD2 B;  1WB9 A;  4IFY A;  2YNH A;  1TUU A;  4LF9 K;  3QIP A;  3SNN A;  1YAG A;  1ZC6 A;  2YHA A;  4F3T A;  3AA4 A;  1YI2 N;  3QEP A;  3EE8 A;  5C42 A;  3EKU A;  4E3S A;  2WC9 A;  3KD5 E;  2Z1H A;  4GMJ B;  3NGY A;  3KK7 A;  5FPE A;  3V1Q A;  4IXC A;  1E4G T;  1NMN A;  1JLC A;  1NGH A;  4BRQ A;  4CJL A;  4AHC A;  3FFI A;  5HRN A;  4FJX A;  5AQG A;  4ID1 A;  1KQS M;  1ZBH A;  4DG1 A;  1FK9 A;  2FF3 B;  4LSN A;  3VQC A;  4BRH A;  3CQ8 A;  4E7L A;  3RR7 A;  1QZ5 A;  3O9Q A;  3DOL A;  4KH4 A;  1S22 A;  3LAK A;  1HQU A;  1KAY A;  1IO2 A;  1X3M A;  4LFC K;  4GVE A;  4B9V A;  1HJR A;  2F9T A;  3J81 O;  3PIO L;  4CZL A;  2VGN A;  4TSX A;  2XY8 A;  3DLG A;  1YTU A;  3UB5 A;  4CEC A;  4H0X B;  3NVK A;  3S3N A;  3NBP A;  2P9I A;  1N34 K;  3M1F A;  5CZ1 A;  1VRT A;  3L3V A;  2O8D A;  1B92 A;  2A6A A;  4CFC A;  5EOY A;  2D0A A;  4DWI A;  3UIQ A;  3THV A;  3QFU A;  5GAD P;  4B1W B;  1SKR A;  4DR7 K;  2XRI A;  3MEE A;  4JHD B;  5D3G A;  1WNS A;  2FLO A;  3HM9 A;  2E6M A;  4Q5V A;  4B1Y B;  1BIS A;  1JLF A;  1NGC A;  3HO1 A;  4U7B A;  2OTJ N;  5EY4 A;  2Y1I A;  1HR0 K;  1X1P A;  2ZJR L;  3AV9 A;  2P9I B;  3WXK A;  3BDP A;  1S1W A;  3D0P A;  3EY1 A;  2O8D B;  2ZJP L;  4OGE A;  1RDD A;  1RT3 A;  1W9H A;  3S9H A;  3NH1 A;  4FOE A;  2G8F A;  4BRL A;  1RT1 A;  4BQL A;  2OPP A;  1BG3 A;  2PBD A;  3DLH A;  3CME N;  5BN8 A;  2D1K A;  3L2W A;  3TSQ A;  4O55 A;  1T6C A;  5AR0 A;  1JLG A;  4BC4 A;  1ZBS A;  1T03 A;  3SAF A;  2HHW A;  3P31 A;  1NGA A;  3M8S A;  4BY9 C;  1CZ9 A;  4GV6 A;  2G8W A;  4FWS A;  5B8H A;  4CED A;  4H8K A;  3VQB A;  5DK5 A;  3WQU A;  3C6U A;  4B1V A;  4JEP A;  1J53 A;  1S6P A;  1HNX K;  1FKO A;  1QHT A;  3O08 A;  3K57 A;  3QEI A;  2GX9 A;  4MDA A;  3CCR N;  3CF5 L;  1WSE A;  4CZG A;  3OHR A;  4DFP A;  3A2F A;  1P8Z A;  5E41 A;  2V51 B;  4FWM A;  4IZ9 A;  3A5N C;  1Y97 A;  3LDO A;  3M8P A;  4KPY A;  4EZ6 A;  3EN9 A;  4YOU A;  2WTU A;  4JK8 A;  3LM2 A;  4Z94 A;  5KPZ A;  3V9W A;  4EP4 A;  4IEE A;  2YKN A;  3NHG A;  4JKF A;  4B3R K;  3HRG A;  2IVN A;  2HST A;  3VEO A;  2E2O A;  1HKC A;  4K42 A;  5FDL A;  4CFD A;  3OJU A;  2YV0 X;  2ZJQ L;  3TSP A;  1IKW A;  2P5G A;  4DTS A;  1S1V A;  4WFN L;  3ASM A;  3MEG A;  3QEV A;  3LDP A;  4E7H A;  4CJ7 A;  3WUH A;  3Q7B A;  1C0G A;  3AY9 A;  3V9X A;  3CC4 N;  1HYV A;  2OA8 A;  2WUS A;  1TL1 A;  1DTQ A;  3ISN C;  5FRM A;  3I56 N;  4DQQ A;  2FXU A;  3OYG A;  3KK1 A;  4W5O A;  1GLD G;  4KRF A;  3K9J A;  3QEW A;  3A8Y A;  3PX4 A;  2Q0U A;  2ZWH A;  1U6Z A;  4AQY K;  4A62 A;  1NGE A;  3QB0 A;  1TK0 A;  4E89 A;  5HRS A;  2HHH K;  1IKV A;  4M63 C;  4E1M A;  5I3U A;  4FWO A;  2QWN A;  4B1X B;  1S5J A;  2KZZ A;  2DFH A;  4QOZ B;  1TL3 A;  1DEJ A;  2UXC K;  4CER A;  4DR4 K;  4NLC A;  4AM6 A;  4WCE L;  4M41 A;  3UKU A;  1NMD A;  3HM8 A;  4C8L A;  1CXU A;  3P83 D;  4FWN A;  3SBT A;  2G8V A;  3VQ6 A;  1RBS A;  4DTJ A;  1JCF A;  4JK7 A;  5AQI A;  3ZX2 A;  3V6D A;  4HTL A;  5CE3 A;  1YIT N;  3KVG A;  4FK4 A;  3I33 A;  1ZBL A;  3DRP A;  1SZ2 A;  3BZC A;  2PZS A;  2RE2 A;  2NRV A;  3O9U A;  3E9P A;  4E0D A;  4NLB A;  4FWP A;  4CVN E;  2GWK A;  4FZY A;  3HPG A;  4C8O A;  3RMD A;  4H03 B;  4DTO A;  3CJ7 A;  2BDP A;  3VOV A;  3SAG A;  3LP0 A;  2F9W A;  3VEZ A;  3I55 N;  2P9L B;  4MFB A;  3OS1 A;  2FC0 A;  3UKU B;  4Y1D A;  3BF1 A;  3WNH A;  3PO5 A;  2GEM A;  3KJV A;  4ICL A;  3GOI A;  3HP9 A;  4DTN A;  5AFU H;  2HMI A;  3E9L A;  1IJJ A;  1Q86 O;  3EEQ A;  4WYB A;  2BUP A;  2F96 A;  4CF0 A;  4AHU A;  4JI8 K;  5AQL A;  1Q8I A;  5KPR A;  1GOA A;  4OKJ A;  1TKT A;  3SUQ A;  3MXJ A;  4CJW A;  1BA1 A;  1RTI A;  2HNY A;  1NGG A;  3AVL A;  2QA4 N;  3CJ1 A;  4LF4 K;  1SV5 A;  2ZGY A;  2PFU A;  1RT7 A;  1WSG A;  2FSJ A;  4F8R A;  4FVM A;  5FLX O;  2YKM A;  1BIZ A;  1S72 N;  4CK3 A;  4CZH A;  3LP1 A;  3SUP A;  4CJK A;  3SPZ A;  3VEW A;  3LDN A;  3OYJ A;  4CI6 A;  4EZ9 A;  4B9S A;  1EP4 A;  4DLG A;  1HQE A;  4BRE A;  2CGL A;  4CF8 A;  1V4T A;  1WOQ A;  4IOA L;  2NRH A;  4BC3 A;  3KLH A;  4A61 A;  3QO9 A;  3RTV A;  4ILJ A;  3CQY A;  2ATQ A;  4M3Z A;  4YOR A;  4IKF A;  4FLV A;  4FPA A;  3LP3 A;  1E3M A;  5BRD A;  4BRF A;  3BP8 A;  1D9D A;  1NK9 A;  3TWH A;  4PL8 A;  4B9N A;  4Z4G A;  3ZSX A;  2AP1 A;  1UA1 A;  4B3M K;  4JI7 K;  4CZF A;  3TSU A;  5SWM A;  5J2P A;  5DM6 L;  3U3Y A;  3TTC A;  2X74 A;  4Y1C A;  2VQE K;  5J2M A;  3FR0 A;  5C25 A;  3IG1 A;  3MWT A;  1ILY A;  3CIP A;  5TKW A;  3MN6 A;  4JAX A;  2Z1I A;  3LAM A;  3OYK A;  2P9N A;  3DAW A;  5AQM A;  2BTF A;  3ZSW A;  3L2V A;  4CIF A;  4CZM A;  1NKB A;  1VSL A;  4FJK A;  4CFB A;  3VER A;  3PY8 A;  1T6D A;  2RPI A;  4FW1 A;  3OYN A;  3NFA A;  4CJU A;  3I8D A;  5HL7 L;  1NJZ A;  5HRO A;  4HCC A;  3L0Q A;  4YOW A;  4CEA A;  3ENO A;  4HHT A;  3M3Z A;  4A59 A;  3SCX A;  3IUC A;  1WLJ A;  1HNZ K;  3FZM A;  4DV6 K;  3BUZ B;  4FW2 A;  3AVA A;  4BGA A;  4FJ7 A;  3FLC O;  3P5J A;  1YT3 A;  2QWQ A;  2D0O A;  3PLA A;  1VQL N;  1NM1 A;  3LL3 A;  1NJW A;  5KRT A;  1L3V A;  2QWM A;  5GAE P;  3NGZ A;  1ESV A;  2QW9 A;  1SQK A;  2X6S A;  3CC7 N;  4Z4E A;  5ELZ A;  3NAE A;  2A1R A;  2Q31 A;  3ZX3 A;  1J5E K;  2NNW A;  1RDW X;  1JL2 A;  3AA2 A;  3TAP A;  1YVU A;  3CER A;  3LDL A;  3ZSZ A;  4CBU A;  4KTZ A;  4R79 A;  1OVY A;  3QEX A;  1W0H A;  1ZBU A;  1CLQ A;  3TTD A;  4KH6 A;  2QTD A;  1F21 A;  5M1O A;  4FLT A;  4K0K K;  2HHS A;  3MXM A;  2XY7 A;  3WXL A;  3H3N O;  1EWQ A;  2W41 A;  4MO5 A;  3NDK A;  4DSE A;  4AHR A;  1ATS A;  1S9E A;  2E5L K;  3HL8 A;  2PYJ A;  2KW4 A;  5JS1 A;  4CJT A;  1QE1 A;  1NKC A;  1U45 A;  1KRP A;  3DLL L;  3FE1 A;  1HNW K;  5AQK A;  1NGF A;  2B6A A;  3LDS A;  4CD1 A;  5EXW A;  1HLU A;  1QQC A;  2GWJ A;  1BUP A;  4DR6 K;  3LM9 A;  1U2V A;  1I3A A;  4JI4 K;  1K9M O;  3R3L A;  3E9O A;  3V1O A;  3VGK A;  5C10 A;  4JLH A;  1TYQ A;  5BR9 A;  4BRG A;  1VSM A;  4ISE A; 
#chains in the Genus database with same CATH homology
 4JI2 K;  4X66 K;  4LF6 K;  4B3T K;  4JI3 K;  4DV7 K;  4DV0 K;  4LF5 K;  4LFA K;  1HNZ K;  4DV6 K;  4B3S K;  2UUA K;  4YY3 K;  1I94 K;  4NXN K;  4GKK K;  4JYA K;  4LFC K;  4LF8 K;  4JI5 K;  3J81 O;  2UUC K;  4LF7 K;  4B3R K;  5A2Q O;  4JI8 K;  5LL6 Z;  1XNQ K;  4DV1 K;  5BR8 K;  4LF4 K;  4X64 K;  1IBK K;  1N34 K;  4LFB K;  4DV5 K;  2UXD K;  5LMN K;  1J5E K;  5LMU K;  3J80 O;  5FLX O;  4DV3 K;  1N36 K;  2ZM6 K;  4CW7 B;  4KHP K;  1N32 K;  4DR7 K;  4JI1 K;  2UU9 K;  1FJG K;  4X62 K;  4NXM K;  4GKJ K;  4DR2 K;  1XNR K;  4K0K K;  3OTO K;  4DUZ K;  4DV2 K;  4OX9 K;  5IT9 O;  4AQY K;  1HR0 K;  3T1H K;  1XMQ K;  2HHH K;  2UXB K;  4JI0 K;  2UUB K;  4V19 S;  2E5L K;  4DR5 K;  3T1Y K;  3J7A P;  4B3M K;  3J7Y P;  4JI6 K;  4YHH K;  1IBM K;  4JI7 K;  4LF9 K;  1HNW K;  1XMO K;  2UXC K;  2F4V K;  4DR4 K;  2VQE K;  1IBL K;  1N33 K;  4DR6 K;  4DR1 K;  4DV4 K;  2VQF K;  4JI4 K;  3JAM O;  5IWA K;  4DR3 K;  4DUY K;  1HNX K;  5AJ3 K;  4X65 K;  4JV5 K;  4CVN E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...