4OX9K

Crystal structure of the aminoglycoside resistance methyltransferase npma bound to the 30s ribosomal subunit
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular recognition and modification of the 30S ribosome by the aminoglycoside-resistance methyltransferase NpmA.
pubmed doi rcsb
molecule keywords 16S rRNA
molecule tags Ribosome/antibiotic
source organism Escherichia coli
total genus 30
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2014-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4ox9K00
1HNXK 4JYAK 2ZM6K 2UUCK 5IWAK 1HNZK 1N32K 4LFAK 2UU9K 4JI7K 4JI6K 4YHHK 4NXNK 4B3RK 4JI8K 3T1YK 4DR1K 4JI5K 4OX9K 4LF9K 4DV3K 2UUAK 4GKKK 4JI2K 1N36K 4B3TK 4JI4K 1XNRK 1HR0K 4JI3K 4GKJK 1FJGK 5LMNK 5FLXO 3J7AP 4LFCK 4LF6K 4DV0K 1IBLK 4JV5K 4JI0K 2UXBK 1N34K 1I94K 5BR8K 4KHPK 2UXCK 5A2QO 4X66K 4DV4K 1J5EK 1XMOK 4K0KK 3J7YP 5IT9O 2HHHK 4B3SK 4DR6K 4B3MK 1XMQK 5LL6Z 4DUZK 4JI1K 4LF5K 2E5LK 2F4VK 4AQYK 4YY3K 1XNQK 2VQEK 4DV1K 4DV7K 1IBMK 3JAMO 5AJ3K 4CVNE 2UXDK 4X62K 4LF4K 4X65K 2VQFK 4DV5K 4DR5K 4DR7K 4LF7K 4LFBK 3OTOK 4DR2K 1N33K 1HNWK 1IBKK 4DR4K 5LMUK 4V19S 4DV6K 4DV2K 4X64K 3T1HK 4DUYK 4LF8K 4CW7B 2UUBK 4DR3K 3J81O 4NXMK 3J80O
chains in the Genus database with same CATH superfamily
3M3ZA 3CM5A 5C0YA 1EXQA 4CZFA 3C7NA 2Z1GA 1EX4A 4EP5A 3ZSQA 4Z4EA 5T7BA 1NGDA 1NGBA 3VQDA 3NMUA 2HNZA 1X9MA 3A2FA 4FSVA 3TR8A 2VGNA 2IOCA 3AA2A 4IG0A 3CETA 2NZTA 5DM6L 1NJIO 1TKXA 3ZSWA 3FGUA 4HUGA 4OX9K 4DV3K 3O9SA 4BRNA 4JI2K 3LZJA 3JXUA 4QS8A 3LDLA 3TSUA 1NK0A 3RMBA 5FLXO 3ZCMA 2A40A 4F8RA 2CH6A 2HHSA 3GL1A 1NGFA 4BWJA 5EXWA 2HHTA 4I6MA 3O4QA 1SUQA 3MDQA 4KO0A 4CHQA 2G8IA 2F8SA 1XWLA 1I94K 3QERA 1D9FA 1UA1A 3DLBA 2E4LA 3ZSZA 3WXJA 4NCGA 4I6MB 2HHWA 1GLAG 4M45A 4ILGB 4CFBA 4M3XA 3AO4A 3HPGA 3ZSRA 4LC9B 1XMQK 2QWLA 4M3RA 2OPSA 4DUZK 2WC9A 3ENBA 4M3UA 1EWQA 3HI0A 2HBMA 1QSYA 4CF2A 4QCLA 3CCVN 4CJ3A 3DLHA 2P9SA 3ZSYA 2HHXA 1NJXA 4CD1A 1KTQA 2QKBA 2FBTA 2W6LA 2OTJN 2NRXA 1KFDA 1YT3A 2QWMA 1K6YA 1NGHA 2P9SB 3KK7A 3TPQA 1VQ8N 4FJ9A 1JLBA 3GG4A 4B1XB 4FWQA 2FBYA 1NGGA 4FJMA 4ISEA 3AGKA 2F9TA 3IS9A 1IKVA 2YNGA 4K8XA 3F2KA 1KLMA 3HSCA 3BF1A 5F1XA 3DYAA 4HTLA 5M1NA 3O3HA 3FZFA 4F2RA 3AVFA 5KQDA 3MAQA 5IWAK 2P9IB 2QXLA 4IOXA 4GV9A 1S1UA 3HJFA 4FLTA 1GOBA 2E6MA 2HNDA 3R9PA 3ZX0A 4AH9A 4BRGA 1VSKA 2KZMA 3L8BA 4CJ5A 2BE2A 5CY4A 1O13A 4M63C 3ISNC 1NK6A 3PO5A 2UUAK 1JCFA 1BIUA 3I55N 2JWLA 3UB5A 4IWVA 4BY9C 3O1WA 3C6UA 2GTDA 4BRDA 4H5NA 3RTVA 1DEJA 4DTJA 2J4RA 3QO9A 1VQ7N 4CJSA 4FZZA 3J7AP 2OZSA 3BZCA 4BR9A 4MQ3A 4J2AA 5F2RA 3HXMA 1TV6A 2QWRA 4C8NA 4O4GA 3MN9A 3A5OC 4J2DA 3OYBA 1WBDA 1WSJA 3KWIA 1VQLN 4CF8A 4NCAA 4DS5A 4KTQA 5FPEA 5BPLA 1SKSA 3K57A 1BL3A 3RWUA 3IMXA 1RDAA 3CFOA 5BRDA 4JEPA 1G99A 3KKSA 5TKYA 2JLEA 4KFBA 1U49A 3CCMN 1WAFA 3NGIA 3QICA 1JCEA 1XNQK 1HYSA 4JK7A 1GLCG 2QTDA 3K58A 3NHGA 4CJVA 1HKCA 1ZBUA 3SV3A 3RMAA 5AJ3K 4BRQA 1Y97A 3MX2A 5BN8A 4OPJA 4DTXA 2VWJA 4AHVA 5HRNA 2CGJA 2A5XA 4W5OA 1HPMA 5DK5A 1TVRA 4B9QA 4CBXA 3OTOK 3TTFA 4MLHA 3V6DA 1VQKN 4AM7A 1SS6A 4C23A 1XC3A 3LM2A 2Q36A 3BUZB 2WONA 3O8MA 3H45C 2HBLA 3N4QA 4ZTFA 4DSEA 1VHXA 3D2EA 1ESVA 4KHQA 3RR7A 4DTMA 4WQ5C 3M8QA 2VYPA 2FSNA 3D2EB 4IJAA 2YKMA 3FFIA 5AQQA 4MO5A 1IJJA 4GV3A 3ENOA 4JKFA 1VSDA 1OH5A 3ZSOA 4Z4HA 3VQCA 3LDNA 5AQNA 2F9WA 4BQLA 1TL3A 4ISFA 1DT9A 1K8KA 1NU0A 4CIGA 1ASWA 3CMAN 1NKEA 3DLGA 4M3ZA 4JS5A 1ITGA 4CI6A 3MXJA 3AVGA 3I8BA 1SL2A 3CCLN 4GKJK 2NLXA 1RBTA 3KK3A 1IG8A 1QZ5A 2HF3A 4H8KA 3SQ2A 1RBRA 1T8EA 1W0HA 3AVKA 2A1SA 2YHAA 2HBKA 1YI2N 4E1NA 5BR8K 4LH5A 2V52B 3ZEUB 4YORA 4BRPA 3M6GA 1U4BA 4R79A 3QESA 3G71N 4YOXA 1CZ9A 4CJFA 1BI4A 3OYCA 3KTQA 4WYBA 3K5NA 4BREA 3RRGA 2XY8A 3FR0A 3VF4A 3WXMB 3DLKA 4KH6A 4FWRA 4IG3A 3R3LA 1QQOA 3HM8A 3WEEA 1BI4B 1VSMA 4GMJB 3S3MA 2VQEK 4DV1K 1QE1A 4E1JA 4PKHA 3DLEA 3JAMO 2XHBA 3KD1E 4R5PA 3WEEB 1C1CA 4X65K 4I9QA 1YTUA 1NK9A 4DV5K 4L8RB 4BR2A 2Y1IA 4NO7A 4B3OA 4JNEA 1ZC6A 4H5WA 2FBVA 3OVNA 1NK7A 1XUPO 3ATUA 4IEIA 4HHTA 1LW2A 2ASOA 5GIPA 4KI4A 4CW7B 5AQRA 1GLLO 3QIOA 4EZ9A 3RRHA 3DOKA 3SBTA 1HNXK 3UKRB 1KD1O 4BVOA 2AA4A 2X6NA 3NF7A 2RPIA 2YJEA 4OLAA 1LCUA 2YV0X 3NF9A 1TAQA 3HVRA 2UU9K 3SV4A 5EU7A 2HMPA 1XQSC 1RFQA 5GAEP 3SQ4A 3OYHA 3N4PA 1YHQN 4JKDA 5KPTA 4MDBA 5CYQA 4DR1K 4FVMA 3SUQA 4ICLA 3LDSA 2OYQA 3B6OA 3OYNA 1QTMA 5AQUA 4JKGA 3W0LA 3CJAA 4PA1A 4UY8O 1FJGK 3K5LA 3V4IA 1OH7A 3IFRA 3NDKA 3PSIA 4JI0K 1NGAA 3QINA 4H0TB 4KB1A 2E8AA 3E01A 2ZGYA 3ENHA 1BO5O 2E1ZA 4JHDA 5AFUA 3SK3A 1BIZA 5CYMA 4CERA 5JVGL 4EAHD 4N5SA 4K42A 4FLYA 4JHDB 2P9LA 4LF5K 3OS0A 3O4WA 1QSSA 4BR4A 4B9VA 1KVCA 2QKKA 3VEXA 2OTLN 4JKHA 1CXQA 5SZTA 2GEMA 4CCHA 4G9ZA 3VEWA 2NRZA 2P9LB 4M7XA 1QVFM 4I2PA 3O3FA 3OYDA 3LANA 4F3TA 4CFDA 1VQNN 2W6KA 4NYNA 4X62K 4LF4K 1QQNA 2VQFK 3KJVA 3NE6A 4L3QA 4XEIA 1Q81O 3FLCO 5KRTA 4DFMA 3SNNA 4DR4K 4C1NI 4E3SA 1NKCA 1TL1A 3AO5A 1YVUA 5EVZA 3IDHA 4YNQA 3NFAA 1KLNA 4CEBA 1P90A 4NXMK 2NRTA 3WXLA 2Q31A 1RT5A 1HLUA 3ID8A 4Z4GA 1S72N 3SPZA 3GBTA 3PSFA 1RBSA 2P5GA 3HT3A 3DMJA 1T03A 4IBNA 1DLOA 4FWOA 4C1NK 4FPAA 4Y1CA 1NOYA 1YXQA 3DI6A 4M3WA 1IH7A 4FJXA 1A5VA 1E4GT 5ADXH 1JXEA 1BG3A 2WUSA 1VSHA 3AV9A 3W3DA 3QB0A 4AHSA 1NGEA 1RT6A 2QW9A 1QZ6A 1IBLK 1B92A 4O5BA 4FLWA 4CGHA 1Q8IA 1C0MA 4Z4FA 5AQZA 4GVEA 1FKPA 4CFAA 4DFJA 5M1PA 3ZT1A 4KHNA 3AVJA 2RF2A 2B5JA 3VPZA 3D2FA 4C8MA 4BE2A 1JJ2M 4O44A 3WQUA 3ZETA 1D4XA 1J6ZA 3CHWA 4BRIA 4CK1A 4H0VB 3QFPA 1EWRA 4OGEA 3D2FB 2P1JA 2QWNA 3THVA 4A5AA 3ZETB 3AVLA 3TAMA 3CI5A 4EHTA 4Z94A 1J54A 4H0OA 3WNGA 4HCCA 3BP8A 2WFBA 3PUFA 3BY5A 4B9SA 4DR5K 2O4GA 2Q1NA 2QEXN 4CZEA 5JICA 2GX9A 2VCPA 4DLGA 3KKRA 4OPAA 4ZTJA 2D0BA 3SAHA 1KFSA 4M7YA 4FJKA 1VAZA 4WQ5A 4CK3A 2FF3B 3S9HA 3O9UA 5MLCQ 3J80O 4Z4IA 2PBDA 3AVIA 4C8OA 2FBXA 4BDPA 4WF9L 1HQEA 3R6MA 1Q7YO 1HNZK 1L3SA 3DAWA 3P31A 1U45A 3K5OA 3NVKA 4OO1J 1T7PA 4JI7K 3KLGA 1YAGA 2XY7A 2D0AA 2YX6A 4BROA 3T1YK 3AAQA 4U7BA 4NB4A 1HMVA 3C6TA 3CCEN 4FZYA 1KQSM 5BRFA 1GOAA 4JI4K 3CCJN 1T6DA 4O0JA 4KHYA 4NLBA 4MO4A 3DM2A 4A59A 3PX4A 3RMCA 1G15A 5LJVA 4JS4A 3K9JA 5HL7L 4Y1DA 3CQXA 4LY7A 3CD6N 2QWPA 3D0PA 1YJNN 4YOVA 4I9LA 1VSIA 4BGAA 3TWHA 1OVQA 3KLHA 3LWMA 2D1KA 3P38A 4HWIA 2ZJPL 1XMOK 4ELVA 3J7YP 2ASMA 4C8KA 3TSQA 2XO7A 4KRFA 3CQ8A 3OY9A 4FZXC 2O8DA 3GOIA 3ZSVA 4CBUA 4FWLA 5JLHA 1M1KO 1TK0A 3K5MA 2ASPA 4EZ6A 3LP1A 1U2VA 1QQMA 2PFUA 5E26A 2O8DB 3JS6A 3VEYA 4OKEA 3HRGA 5EOYA 3DWLA 1RDDA 1U2VB 4KPYA 2G8UA 1YVNA 1GOCA 3QBXA 1RGIA 2FSJA 1IKYA 1TKDA 4E0DA 2E2QA 2OCEA 5AQYA 1YJWN 3VETA 4XIUA 4CEEA 4KBOA 4CHPA 2F8TA 4CJ4A 3KLFA 1LWFA 2FF6A 3OYKA 4KHWA 3KLEA 3LPUA 4DQQA 1JLCA 4CFCA 1WNSA 1JLEA 2CGLA 3KD5E 1X1PA 2NRWA 2XRIA 3AVNA 1QSLA 4CGIA 3T7ZA 3SUPA 3AGRA 1I39A 1XI1A 1RTJA 3JSMA 3SUOA 2A41A 2V7YA 4C8LA 4F3OA 2NUBA 3QNOA 3U9DA 3CPWM 3J8AA 2Y1JA 1NGIA 4YHHK 2JWKA 1VSJA 4OGCA 5CZ1A 4CECA 1UAXA 4FJLA 1S5JA 4GV6A 4EHUA 2GELA 3KHYA 2P9IA 1NOZA 1BUPA 3LM9A 3SAFA 4Z0UA 3TANA 4FJ5A 1SL1A 3R1XA 2D0PA 3JYTA 4RW6A 4CZJA 5M1OA 3K59A 3I8DA 3SZ2A 1FW6A 1X3NA 1BA0A 5F0XA 5LJWA 4JV5K 4CZLA 4A2AA 5AQIA 3GE1A 1J53A 2XY6A 4DV4K 3HVTA 3H46O 1NNEA 3MX5A 3VQ6A 3O08A 4IZ9A 2JGUA 1K9MO 1KVAA 4DQPA 5LL6Z 1BU6O 3E1YA 4CJQA 4ILHA 1F21A 3V9XA 2ATQA 1LV5A 3VERA 4DSIA 4FWKA 5I3UA 3ITHA 5JS1A 2VG5A 2OANA 1CZBA 5TKWA 3R8EA 3CCSN 4K43A 1WUAA 2ZF5O 3CJCA 5BPMA 1N33K 3HBTA 2KQ2A 1IBKK 5D3GA 5J2PA 2KTQA 3HK2A 4ID1A 1S1VA 4DV6K 5JLFA 3T1HK 1L3UA 4DUYK 1D5AA 3A8YA 4U67L 3IAYA 3DRSA 4HTUA 3I56N 3H3NO 2ZGZA 1NKBA 5FRMA 4PY5A 4FW2A 2PYLA 3DLLL 1DTQA 3CYMA 4A62A 1RDWX 3ALYA 3CCQN 1ZBFA 5FPDA 3V1RA 3EYZA 1S1XA 1P8ZA 1GLFO 1VQ9N 3L2QA 1VRTA 1SZ2A 2E2PA 1S3XA 1TAUA 3IRXA 4YFUA 4OKKA 2KLAA 2VG6A 4CF9A 3AVCA 2G8WA 3DLRA 1LWCA 4FWSA 1X9SA 1HR0K 1T44A 1SL0A 1NBWA 2DFEA 5LMNK 3WUHA 4N76A 4F9OA 1Q18A 4BR7A 1ZBIA 4CZMA 1WBBA 1HX1A 4LF6K 4JK8A 2UXBK 2D0CA 1RT7A 4G1QA 1BQMA 4CGFA 3ZX2A 3NVMA 5KPZA 2G8VA 5A2QO 3OYMA 4DCHA 5BR9A 5BRHA 4FO0A 1TKTA 4BG8A 4K0KK 1ILYA 1QHTA 4JK9A 3K2PA 1A5WA 3T69A 1N8RO 4FK0A 1TUUA 4IOCL 2E5LK 1JLAA 3ZEUA 5GIOA 1Y64A 4DU4A 1I3AA 1IG9A 2YNFA 1IBMK 4BRLA 4CVNE 2QXFA 3L2VA 2QWOA 3KK1A 4E7HA 5AQHA 1OH6A 5AQPA 1YTAA 5HOOA 3A5NC 2DTUA 1BWFO 2G8FA 3PLAA 1YF5L 2VGMA 4KKOA 4PQUA 3ZT0A 1ASVA 4DLEA 3OYIA 1NMDA 4CESA 4CGJA 4X64K 3OJSA 4CE9A 1X9JA 3V1OA 4K41A 5HRSA 3BF3A 3SPYA 4BRHA 4EP4A 4QOZB 4E7JA 2R7YA 2KZZA 2GUPA 5C24A 3MN6A 2BH1A 4DMNA 4CEQA 3VGKA 3QEWA 4WCEL 1NK8A 3OBYA 3F5TA 3VEVA 4PKIA 4W5RA 1RBVA 3A5LC 4JI6K 1JKHA 1SQKA 2NRVA 4CBWA 3UKRA 3V9ZA 5FPMA 2FXUA 3O4NA 3BGRA 3WXKA 4JI5K 3QFUA 3O9QA 5AR0A 5KTQA 3VQ5A 4FM1A 1KAYA 3TAGA 1NJWA 1N36K 3U3YA 3OHRA 4YOYA 4AF1A 3MEGA 2IS3A 2NRRA 1RTDA 3D45A 3H3OB 3AARA 2YJFA 1X3MA 5J2MA 4BC4A 2ETJA 4H4MA 3HP6A 1GLJO 3VTHA 4DF8A 3CCUN 4FLZA 1NK4A 4BR5A 1C1BA 4H5VA 2V7ZA 1S1WA 3LAKA 4Q0BA 3PY8A 4CEAA 3WNHA 2F4VK 3KK2A 4N47A 1WAJA 4WFBL 3QMLA 3LDQA 4B9MA 4Y0WA 4DF4A 1LOTB 4B08A 4OPKA 1Z26A 3OYFA 3AVBA 4KHUA 4I7FA 1IKXA 3AO1A 2A6AA 2CH5A 2VWKA 1DTTA 4BRAA 4DR7K 4J2EA 2OPPA 4KB0A 4IFYA 5AFUH 2FC0A 5KGXA 4Q5VA 4DR2K 1GLBG 2BANA 1OVYA 4DV2K 2I7PA 1MWKA 3RSEB 3SQ0A 1NM1A 4F2SA 3L0QA 4XH5A 3J81O 4E7IA 2B4JA 4NLCA 3FZLA 3EE8A 1RDUA 4Z4CA 1A5XA 1HUXA 4JN4A 4B1WB 4FK2A 1MWMA 2BUPA 4JYAK 3E66A 2UUCK 2DY4A 3U6FA 3B6PA 4AHTA 3CJ1A 4QS7A 2ZD1A 4LFAK 2Z1IA 5DMRA 3QNNA 4RW7A 4CK2A 4O8KA 3V9WA 3MN7A 1HYZA 3TARA 3M8RA 3EN9A 3QIPA 2F7TA 2GWKA 3FZHA 1HJOA 2IIRA 5C25A 3PX6A 3NH0A 1ZXOA 4DQ8A 1RT2A 3SJJA 1VSLA 1XC9A 1NGJA 1XNRK 2W41A 2IAJA 3P5JA 1KXPA 3UIQA 4B9TA 4KTWA 4FJJA 3LP0A 3QEPA 1QHAA 4BWMA 1HNVA 2VWBA 3G6EN 3HP9A 1KAXA 3CCRN 3QBWA 4X66K 4CHZA 2E2OA 4BACA 4FJGA 2GBZA 4H0XB 2HHVA 1KCFA 2A1RA 4B1UB 2HHHK 2YHWA 3CPEA 2NRHA 4J8FA 3LZIA 3VF2A 4BGBA 3OYLA 5AZIB 4I2QA 2HVHA 1RDCA 4FWPA 3KZBA 1RCHA 2OPQA 3OYJA 3HOTA 4RW8A 1IO2A 1WSGA 4WFNL 3MCPA 1FXXA 1EETA 3EE9A 3GDQA 4H4OA 4BRMA 4DTNA 3NGYA 2O8FB 3EEQA 3VQ7A 2O4IA 3CG7A 1LWEA 4FM2A 1R0AA 4FJNA 2I5JA 2Q0UA 3I0SA 3FZKA 2QK9A 3EO3A 3L4QA 1S1TA 5C12A 2BGGA 3O6WA 2O8CB 4FCYA 1BCMA 4KHSA 4BRCA 3BEXA 4A2BA 3CFRA 2IC3A 1TGOA 1U48A 5KGWA 3SQ1A 4CEOA 3KIOA 3CJ9A 4BDYA 4JLHA 4FWNA 1Q82O 3TTDA 1VQ6N 1KSPA 3P39A 4XH1A 2O8BA 3OBWA 3CC2N 3L6QA 4MFBA 1XHXA 3HTVA 2NNWA 5GAGP 4PUOA 5M1FA 4JD2A 4JKBA 2O8BB 3ASMA 3CFPA 4W5QA 1BISA 4CHYA 3AY9A 5AQOA 3THWA 5HBMA 4IFEA 4JD2B 1EO1A 4A61A 4BVPA 1YUWA 3DOLA 2YHXA 2E2NA 2A42A 4E7LA 3THWB 3H1VX 4RTFD 3HYFA 3LALA 1JL2A 1IKWA 5ELZA 1DGKN 5B8HA 1WLJA 3VGLA 4BC5A 3F9MA 2RKIA 4KHPK 3BZKA 1YJ9N 3HPHA 1VK0A 4CZIA 3QEXA 1RTIA 1J5EK 5LY3A 1TKZA 4DSJA 3AO3A 3NF8A 3MEDA 4CHNA 3CXCM 3L2UA 3ATVA 2X78A 4CJPA 3T3FA 3SUNA 4IDHA 4M41A 3VGMA 3PO4A 2DFHA 1EQYA 3LPTA 4FJ8A 3CC4N 3ZT4A 4H03B 3HPOA 3SJHA 1EP4A 2VG7A 1NGCA 4J2BA 2Q3SA 2HSTA 4CGGA 4FOIA 2HBJA 1GLDG 2P9NA 4IO8A 4M3YA 3ULDA 5BN9A 4YDUC 4EIAA 3G4SN 1S6PA 4K8ZA 4DS4A 1UOCA 3TAEA 2ZJQL 5J2NA 4BE1A 1Z6RA 3TAPA 2P9NB 4LF7K 4LFBK 4GY2B 2IVPA 1MU2A 3SCXA 3T1AA 4FJIA 4CZHA 1OH8A 1BGXT 2GWJA 4CJEA 3C7NB 5K14A 5I9EB 3O9RA 5AQFA 3VQEA 3MN5A 3BDPA 3VEZA 1V4TA 4CJLA 1C0GA 4GW6A 2QWQA 4DHYA 2DPNA 4E89A 5E41A 4B9NA 4B9UA 4FLUA 4HUEA 4OKJA 3P1GA 4BQZA 1OKJA 1MA9B 3EKUA 2P51A 4DKWA 2RE2A 3L2WA 2EX3A 3MXMA 3CJ7A 4DG1A 1W9HA 2RN2A 5AZJA 1ZBHA 3T19A 1W2BM 4MDAA 1QQCA 3ZLJA 1B9DA 5H1SQ 2YCHA 4CF0A 4FOEA 4CJWA 2I7NA 2UUBK 2Q97A 1TYQA 2D4WA 5AZJB 3ZT3A 4PWDA 4N56A 2P9UA 3TU5A 5C2FA 4A5BA 3NH1A 1VQ4N 4LF9K 2HHQA 3S3NA 3D7EO 3LL3A 1ZYQA 2X6SA 4DTRA 1WOQA 4CIFA 1C0FA 1DKGD 1TYQB 4O5FA 2Z1HA 3VQ4A 3S3OA 2YNHA 1LW0A 2E20A 3OW2M 4B3TK 2GV9A 2P9UB 3VESA 1E4FT 3E9LA 4LFCK 5E84A 3PX0A 1VSFA 1K73O 3O5BA 5GAHP 1VQ5N 5AQSA 3LP3A 3QEIA 3OYGA 4AHCA 3EL2A 1RNHA 3MMVA 3J7ZO 3V9UA 3VQQA 4FJHA 4DQIA 3CM6A 1JLFA 1IV0A 1RDBA 3VEOA 4FM0A 3CF5L 2O8EA 1BA1A 3MWTA 4BG9A 3L2RA 3I0RA 1SKRA 2WBNA 2HHUA 3TAFA 2KFNA 3UKUA 1WSEA 3OA9A 4CIEA 1HYVA 2O8EB 1TUYA 1SAZA 1O1WA 3TSPA 5C42A 4WQ4C 1KRPA 4GNIA 1Z05A 3UE5A 3UKUB 2HOEA 1Q86O 1HRHA 4E7KA 1V4SA 5CZ2A 3V1QA 5CR4A 3I33A 3VQ9A 3SMPA 3C94A 1NJZA 4CZGA 4DTSA 3VTIA 1SKWA 1KC8O 3WXIA 4RG8A 4B1ZA 3VMFB 1W97L 4FK4A 3F73A 4OLBA 3G10A 2W42A 3VA0A 4CJ7A 2Z1JA 4M42A 4CZKA 1H1VA 4KH4A 4GVMA 4YOWA 4AHUA 2ZM6K 4KTZA 1WN7A 1JCGA 2UYTA 1N32K 4DFPA 4DTUA 2G8KA 4O0IA 3TTCA 1HPZA 3WNFA 3EZWA 1N5YA 4FLVA 2YNIA 3WT0A 5DM7L 4H0PA 1D8YA 5AQVA 3C65A 3MXIA 2KKZA 1RT4A 4JAXA 3CJBA 5FDLA 4W5TA 2H3GX 3ID6A 4KAZA 5GINA 3WQTA 4QAGA 3G0ZA 4DSFA 2HF4A 5CHIA 1REVA 2QA4N 5EY4A 4BE0A 3C0BA 4EFHA 1N34K 3OS2A 2PYJA 3HSTB 4PL8A 5AQKA 3RR8A 2FSKA 2LSNA 2EHGA 5KPRA 3OS1A 1UWBA 4FXDA 3U4LA 4N41A 4B3SK 3DXKA 4DR6K 2QI2A 4IEEA 3D6RA 2B6AA 4DSLA 1TK5A 4BRKA 4YOTA 3SI6A 4BR0A 4DU3A 5HLFA 1U47A 4AQYK 3V81A 3LP2A 3ULEA 4PL7A 3DXKB 4HUFA 4RW9A 3AVAA 2YHYA 1QVGM 1HJRA 3KLIA 4RW4A 1S9EA 3ULEB 1WSIA 4IOAL 5HP1A 3OYAA 3RVCA 2OPRA 3M1FA 2Q2RA 1NK5A 3ZX3A 3MK6A 3U8XA 2E88A 4JRQA 3S41A 4ELUA 1BDGA 4KREA 5AQJA 1FK9A 5SWMA 2P9KA 4KV8A 1NG9A 4MLEA 4DWIA 4QS9A 2FLOA 5AQXA 1BHLA 5C10A 3SAGA 2P9KB 1JLGA 4B1YB 2P5OA 4B9LA 3O3GA 4JKAA 3NCIA 4ZHRA 1K8KB 4BC3A 1RT3A 1C6VA 3DXMA 4CF1A 4KI6A 4CJKA 2DFFA 3M8PA 1S9GA 1U04A 4BDZA 3PV8A 1ASUA 1K8AO 3L4IA 3DXMB 3L3VA 5AQWA 1BQNA 1HKBA 4WE1A 5M1QA 1VQPN 2YI1A 3DRRA 3K0SA 4GKKK 5FROA 3CQYA 3LDPA 3VQPA 3VN5A 3FE1A 4E19A 2PZSA 1S22A 4BRFA 3ZT2A 4AM6A 3FFKB 2ITGA 5FRNA 4PHTX 4BC2A 4IFVA 1L3VA 4LD0A 1ATSA 3SMSA 5HRPA 1TK8A 4FYDA 4IXCA 3NF6A 5JVHL 3EZ5A 3AA3A 5IT9O 4AHRA 4H5RA 2WTUA 4DFKA 1ATNA 3P83D 2XY5A 4K25A 1VSEA 1HQUA 5JS2A 3CERA 4FL9A 3WNEA 4YY3K 4O8UA 4YDUA 5FPNA 4FVUA 2P9PA 1NWKA 4ID5A 1MDUB 1CLQA 3U3GA 3VOVA 2F96A 3ZSXA 1BCOA 3AVHA 5KQ8A 2E6LA 1VRUA 4FLXA 3A5MC 3NAEA 2UXDK 4LH4A 4CJUA 3IKMA 2P9PB 3VENA 1HKGA 2AP1A 4ILJA 3QLHA 3QEVA 3DRPA 1L3TA 4DU1A 2IVOA 4H0YB 4E1MA 1J5OA 3C95A 1VQON 4IJNA 3SBGA 2ZWHA 5HRRA 1KVBA 1ZBSA 2W40A 4DR3K 3TI0A 3QETA 3C6HA 3HL8A 4A57A 3F9KA 4TSXA 2G8HA 4IKFA 1NLVA 4KH5A 3RSEA 3VQ8A 3M8SA 4JKGB 5BREA 1Q9YA 4HVJA 4B1VA 4NXNK 4B3RK 3EY1A 3E9PA 4JI8K 2HNYA 1LAVA 3OYEA 1UA0A 2IGIA 1C0UA 1N6QA 2X74A 4JI3K 4DSKA 3MWPA 3IG1A 5J1EA 1LAWA 1YIJN 1X9WA 4RWTA 4DV0K 1RTHA 1ZBLA 3NBPA 4DTOA 3OJUA 1W7AA 4FWMA 5AQGA 3Q7BA 1YITN 4XH4A 2CGKA 3THXA 3DJCA 3C6AA 1Q9XA 4CEFA 2WOMA 1B9FA 1VQMN 3LDOA 3G25A 3PIOL 1CZAN 1HNIA 2OA8A 1EKEA 4JRPA 3THXB 4B3MK 2Q0RA 2A3ZA 4JI1K 3H1QA 3V9SA 3KWGA 4CGDA 4WQ4A 3KVGA 4DQRA 2ZE2A 4ELTA 4YOUA 3HOSA 3FZMA 2IDOA 3QDKA 2HMIA 4CJRA 3MEEA 4DV7K 2GUIA 5HROA 3P4IA 2HVIA 4H5TA 2V51B 5KRSA 4FPBA 5AZIA 1C1AA 3Q7CA 4OJRA 3AVMA 2OZMA 1S6QA 2YKNA 5AQTA 4CHOA 3H6EA 4OPHA 1HNWK 1RILA 3TABA 2KW4A 3VQAA 1L5UA 1J9AA 4CEDA 5EX5A 5ADXA 2O8FA 4CJTA 1FKOA 5C2DA 1CXUA 3O9TA 3ZYYX 1BOTO 1WSFA 3B8AX 1QS4A 3O1BA 3AAPA 2PAVA 5BPNA 1T05A 3NGZA 4LSNA 4M3TA 3AA4A 3U9ZA 2O8CA 5AQLA 3L3UA 4UQGA 4FW1A 1KAZA 3H08A 4O55A 2ZJRL 1JXBA 4PKGA 2AJQA 3HM9A 1GLEG 3IUCA 5JMVA 4LSLA 1D9DA 1R59O 5M1KA 3RMDA 2D5RA 2BTFA 3MCAB 5GADP 2EWSA 3CC7N 1U6ZA 3MECA 4F4KA 2ZQBA 3CMEN 4JKCA 2BDPA 4NYFA 4IO9L 4DTPA 1SV5A 3A0IX 4ISGA 4WFAL 1T3VA 1JLQA 3HZ6A 5C15A 4OVLA 3VF6A 2ITMA 1RT1A 3CIPA 3NH2A 3O80A 4FJ7A 2D0OA 2UXCK 1WSHA 4RCHA 1Z25A 3SLCA 4DQSA 4IDKA 1NMNA 1C0TA 1JL1A 4B8AB 3THYA 2E1YA 1XHZA 2PY5A 1WB9A 2RHKA 2KFZA 4HCBA 5AQMA 4B8CA 3LAMA 3HO1A 3EKSA 3K9KA 3VA3A 1RBUA 3THYB 3VQBA 5J2QA 5I42A 4CD3A 3TAQA 2IVNA 2YHBA 1NJYA 1E3MA 3AO2A 1ATRA 3AA5X 4DB3A 2HB5A 1M90O 2KHOA 1T6CA 4CEZA 3SYZA 5CE3A 3LWLA 5LMUK 4V19S 3M5RA 4AILC 5KI6A 2HW3A 4W5NA 4LF8K 3E9OA 4JKEA 4NCBA 3PIPL 2QM1A
chains in the Genus database with same CATH topology
1HNXK 4JYAK 2ZM6K 2UUCK 5IWAK 1HNZK 1N32K 4LFAK 2UU9K 4JI7K 4JI6K 4YHHK 4NXNK 4B3RK 4JI8K 3T1YK 4DR1K 4JI5K 4OX9K 4LF9K 4DV3K 2UUAK 4GKKK 4JI2K 1N36K 4B3TK 4JI4K 1XNRK 1HR0K 4JI3K 4GKJK 1FJGK 5LMNK 5FLXO 3J7AP 4LFCK 4LF6K 4DV0K 1IBLK 4JV5K 4JI0K 2UXBK 1N34K 1I94K 5BR8K 4KHPK 2UXCK 5A2QO 4X66K 4DV4K 1J5EK 1XMOK 4K0KK 3J7YP 5IT9O 2HHHK 4B3SK 4DR6K 4B3MK 1XMQK 5LL6Z 4DUZK 4JI1K 4LF5K 2E5LK 2F4VK 4AQYK 4YY3K 1XNQK 2VQEK 4DV1K 4DV7K 1IBMK 3JAMO 5AJ3K 4CVNE 2UXDK 4X62K 4LF4K 4X65K 2VQFK 4DV5K 4DR5K 4DR7K 4LF7K 4LFBK 3OTOK 4DR2K 1N33K 1HNWK 1IBKK 4DR4K 5LMUK 4V19S 4DV6K 4DV2K 4X64K 3T1HK 4DUYK 4LF8K 4CW7B 2UUBK 4DR3K 3J81O 4NXMK 3J80O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HNX K;  4JYA K;  2ZM6 K;  2UUC K;  5IWA K;  1HNZ K;  1N32 K;  4LFA K;  2UU9 K;  4JI7 K;  4JI6 K;  4YHH K;  4NXN K;  4B3R K;  4JI8 K;  3T1Y K;  4DR1 K;  4JI5 K;  4OX9 K;  4LF9 K;  4DV3 K;  2UUA K;  4GKK K;  4JI2 K;  1N36 K;  4B3T K;  4JI4 K;  1XNR K;  1HR0 K;  4JI3 K;  4GKJ K;  1FJG K;  5LMN K;  5FLX O;  3J7A P;  4LFC K;  4LF6 K;  4DV0 K;  1IBL K;  4JV5 K;  4JI0 K;  2UXB K;  1N34 K;  1I94 K;  5BR8 K;  4KHP K;  2UXC K;  5A2Q O;  4X66 K;  4DV4 K;  1J5E K;  1XMO K;  4K0K K;  3J7Y P;  5IT9 O;  2HHH K;  4B3S K;  4DR6 K;  4B3M K;  1XMQ K;  5LL6 Z;  4DUZ K;  4JI1 K;  4LF5 K;  2E5L K;  2F4V K;  4AQY K;  4YY3 K;  1XNQ K;  2VQE K;  4DV1 K;  4DV7 K;  1IBM K;  3JAM O;  5AJ3 K;  4CVN E;  2UXD K;  4X62 K;  4LF4 K;  4X65 K;  2VQF K;  4DV5 K;  4DR5 K;  4DR7 K;  4LF7 K;  4LFB K;  3OTO K;  4DR2 K;  1N33 K;  1HNW K;  1IBK K;  4DR4 K;  5LMU K;  4V19 S;  4DV6 K;  4DV2 K;  4X64 K;  3T1H K;  4DUY K;  4LF8 K;  4CW7 B;  2UUB K;  4DR3 K;  3J81 O;  4NXM K;  3J80 O; 
#chains in the Genus database with same CATH topology
 3M3Z A;  3CM5 A;  5C0Y A;  1EXQ A;  4CZF A;  3C7N A;  2Z1G A;  1EX4 A;  4EP5 A;  3ZSQ A;  4Z4E A;  5T7B A;  1NGD A;  1NGB A;  3VQD A;  3NMU A;  2HNZ A;  1X9M A;  3A2F A;  4FSV A;  3TR8 A;  2VGN A;  2IOC A;  3AA2 A;  4IG0 A;  3CET A;  2NZT A;  5DM6 L;  1NJI O;  1TKX A;  3ZSW A;  3FGU A;  4HUG A;  4OX9 K;  4DV3 K;  3O9S A;  4BRN A;  4JI2 K;  3LZJ A;  3JXU A;  4QS8 A;  3LDL A;  3TSU A;  1NK0 A;  3RMB A;  5FLX O;  3ZCM A;  2A40 A;  4F8R A;  2CH6 A;  2HHS A;  3GL1 A;  1NGF A;  4BWJ A;  5EXW A;  2HHT A;  4I6M A;  3O4Q A;  1SUQ A;  3MDQ A;  4KO0 A;  4CHQ A;  2G8I A;  2F8S A;  1XWL A;  1I94 K;  3QER A;  1D9F A;  1UA1 A;  3DLB A;  2E4L A;  3ZSZ A;  3WXJ A;  4NCG A;  4I6M B;  2HHW A;  1GLA G;  4M45 A;  4ILG B;  4CFB A;  4M3X A;  3AO4 A;  3HPG A;  3ZSR A;  4LC9 B;  1XMQ K;  2QWL A;  4M3R A;  2OPS A;  4DUZ K;  2WC9 A;  3ENB A;  4M3U A;  1EWQ A;  3HI0 A;  2HBM A;  1QSY A;  4CF2 A;  4QCL A;  3CCV N;  4CJ3 A;  3DLH A;  2P9S A;  3ZSY A;  2HHX A;  1NJX A;  4CD1 A;  1KTQ A;  2QKB A;  2FBT A;  2W6L A;  2OTJ N;  2NRX A;  1KFD A;  1YT3 A;  2QWM A;  1K6Y A;  1NGH A;  2P9S B;  3KK7 A;  3TPQ A;  1VQ8 N;  4FJ9 A;  1JLB A;  3GG4 A;  4B1X B;  4FWQ A;  2FBY A;  1NGG A;  4FJM A;  4ISE A;  3AGK A;  2F9T A;  3IS9 A;  1IKV A;  2YNG A;  4K8X A;  3F2K A;  1KLM A;  3HSC A;  3BF1 A;  5F1X A;  3DYA A;  4HTL A;  5M1N A;  3O3H A;  3FZF A;  4F2R A;  3AVF A;  5KQD A;  3MAQ A;  5IWA K;  2P9I B;  2QXL A;  4IOX A;  4GV9 A;  1S1U A;  3HJF A;  4FLT A;  1GOB A;  2E6M A;  2HND A;  3R9P A;  3ZX0 A;  4AH9 A;  4BRG A;  1VSK A;  2KZM A;  3L8B A;  4CJ5 A;  2BE2 A;  5CY4 A;  1O13 A;  4M63 C;  3ISN C;  1NK6 A;  3PO5 A;  2UUA K;  1JCF A;  1BIU A;  3I55 N;  2JWL A;  3UB5 A;  4IWV A;  4BY9 C;  3O1W A;  3C6U A;  2GTD A;  4BRD A;  4H5N A;  3RTV A;  1DEJ A;  4DTJ A;  2J4R A;  3QO9 A;  1VQ7 N;  4CJS A;  4FZZ A;  3J7A P;  2OZS A;  3BZC A;  4BR9 A;  4MQ3 A;  4J2A A;  5F2R A;  3HXM A;  1TV6 A;  2QWR A;  4C8N A;  4O4G A;  3MN9 A;  3A5O C;  4J2D A;  3OYB A;  1WBD A;  1WSJ A;  3KWI A;  1VQL N;  4CF8 A;  4NCA A;  4DS5 A;  4KTQ A;  5FPE A;  5BPL A;  1SKS A;  3K57 A;  1BL3 A;  3RWU A;  3IMX A;  1RDA A;  3CFO A;  5BRD A;  4JEP A;  1G99 A;  3KKS A;  5TKY A;  2JLE A;  4KFB A;  1U49 A;  3CCM N;  1WAF A;  3NGI A;  3QIC A;  1JCE A;  1XNQ K;  1HYS A;  4JK7 A;  1GLC G;  2QTD A;  3K58 A;  3NHG A;  4CJV A;  1HKC A;  1ZBU A;  3SV3 A;  3RMA A;  5AJ3 K;  4BRQ A;  1Y97 A;  3MX2 A;  5BN8 A;  4OPJ A;  4DTX A;  2VWJ A;  4AHV A;  5HRN A;  2CGJ A;  2A5X A;  4W5O A;  1HPM A;  5DK5 A;  1TVR A;  4B9Q A;  4CBX A;  3OTO K;  3TTF A;  4MLH A;  3V6D A;  1VQK N;  4AM7 A;  1SS6 A;  4C23 A;  1XC3 A;  3LM2 A;  2Q36 A;  3BUZ B;  2WON A;  3O8M A;  3H45 C;  2HBL A;  3N4Q A;  4ZTF A;  4DSE A;  1VHX A;  3D2E A;  1ESV A;  4KHQ A;  3RR7 A;  4DTM A;  4WQ5 C;  3M8Q A;  2VYP A;  2FSN A;  3D2E B;  4IJA A;  2YKM A;  3FFI A;  5AQQ A;  4MO5 A;  1IJJ A;  4GV3 A;  3ENO A;  4JKF A;  1VSD A;  1OH5 A;  3ZSO A;  4Z4H A;  3VQC A;  3LDN A;  5AQN A;  2F9W A;  4BQL A;  1TL3 A;  4ISF A;  1DT9 A;  1K8K A;  1NU0 A;  4CIG A;  1ASW A;  3CMA N;  1NKE A;  3DLG A;  4M3Z A;  4JS5 A;  1ITG A;  4CI6 A;  3MXJ A;  3AVG A;  3I8B A;  1SL2 A;  3CCL N;  4GKJ K;  2NLX A;  1RBT A;  3KK3 A;  1IG8 A;  1QZ5 A;  2HF3 A;  4H8K A;  3SQ2 A;  1RBR A;  1T8E A;  1W0H A;  3AVK A;  2A1S A;  2YHA A;  2HBK A;  1YI2 N;  4E1N A;  5BR8 K;  4LH5 A;  2V52 B;  3ZEU B;  4YOR A;  4BRP A;  3M6G A;  1U4B A;  4R79 A;  3QES A;  3G71 N;  4YOX A;  1CZ9 A;  4CJF A;  1BI4 A;  3OYC A;  3KTQ A;  4WYB A;  3K5N A;  4BRE A;  3RRG A;  2XY8 A;  3FR0 A;  3VF4 A;  3WXM B;  3DLK A;  4KH6 A;  4FWR A;  4IG3 A;  3R3L A;  1QQO A;  3HM8 A;  3WEE A;  1BI4 B;  1VSM A;  4GMJ B;  3S3M A;  2VQE K;  4DV1 K;  1QE1 A;  4E1J A;  4PKH A;  3DLE A;  3JAM O;  2XHB A;  3KD1 E;  4R5P A;  3WEE B;  1C1C A;  4X65 K;  4I9Q A;  1YTU A;  1NK9 A;  4DV5 K;  4L8R B;  4BR2 A;  2Y1I A;  4NO7 A;  4B3O A;  4JNE A;  1ZC6 A;  4H5W A;  2FBV A;  3OVN A;  1NK7 A;  1XUP O;  3ATU A;  4IEI A;  4HHT A;  1LW2 A;  2ASO A;  5GIP A;  4KI4 A;  4CW7 B;  5AQR A;  1GLL O;  3QIO A;  4EZ9 A;  3RRH A;  3DOK A;  3SBT A;  1HNX K;  3UKR B;  1KD1 O;  4BVO A;  2AA4 A;  2X6N A;  3NF7 A;  2RPI A;  2YJE A;  4OLA A;  1LCU A;  2YV0 X;  3NF9 A;  1TAQ A;  3HVR A;  2UU9 K;  3SV4 A;  5EU7 A;  2HMP A;  1XQS C;  1RFQ A;  5GAE P;  3SQ4 A;  3OYH A;  3N4P A;  1YHQ N;  4JKD A;  5KPT A;  4MDB A;  5CYQ A;  4DR1 K;  4FVM A;  3SUQ A;  4ICL A;  3LDS A;  2OYQ A;  3B6O A;  3OYN A;  1QTM A;  5AQU A;  4JKG A;  3W0L A;  3CJA A;  4PA1 A;  4UY8 O;  1FJG K;  3K5L A;  3V4I A;  1OH7 A;  3IFR A;  3NDK A;  3PSI A;  4JI0 K;  1NGA A;  3QIN A;  4H0T B;  4KB1 A;  2E8A A;  3E01 A;  2ZGY A;  3ENH A;  1BO5 O;  2E1Z A;  4JHD A;  5AFU A;  3SK3 A;  1BIZ A;  5CYM A;  4CER A;  5JVG L;  4EAH D;  4N5S A;  4K42 A;  4FLY A;  4JHD B;  2P9L A;  4LF5 K;  3OS0 A;  3O4W A;  1QSS A;  4BR4 A;  4B9V A;  1KVC A;  2QKK A;  3VEX A;  2OTL N;  4JKH A;  1CXQ A;  5SZT A;  2GEM A;  4CCH A;  4G9Z A;  3VEW A;  2NRZ A;  2P9L B;  4M7X A;  1QVF M;  4I2P A;  3O3F A;  3OYD A;  3LAN A;  4F3T A;  4CFD A;  1VQN N;  2W6K A;  4NYN A;  4X62 K;  4LF4 K;  1QQN A;  2VQF K;  3KJV A;  3NE6 A;  4L3Q A;  4XEI A;  1Q81 O;  3FLC O;  5KRT A;  4DFM A;  3SNN A;  4DR4 K;  4C1N I;  4E3S A;  1NKC A;  1TL1 A;  3AO5 A;  1YVU A;  5EVZ A;  3IDH A;  4YNQ A;  3NFA A;  1KLN A;  4CEB A;  1P90 A;  4NXM K;  2NRT A;  3WXL A;  2Q31 A;  1RT5 A;  1HLU A;  3ID8 A;  4Z4G A;  1S72 N;  3SPZ A;  3GBT A;  3PSF A;  1RBS A;  2P5G A;  3HT3 A;  3DMJ A;  1T03 A;  4IBN A;  1DLO A;  4FWO A;  4C1N K;  4FPA A;  4Y1C A;  1NOY A;  1YXQ A;  3DI6 A;  4M3W A;  1IH7 A;  4FJX A;  1A5V A;  1E4G T;  5ADX H;  1JXE A;  1BG3 A;  2WUS A;  1VSH A;  3AV9 A;  3W3D A;  3QB0 A;  4AHS A;  1NGE A;  1RT6 A;  2QW9 A;  1QZ6 A;  1IBL K;  1B92 A;  4O5B A;  4FLW A;  4CGH A;  1Q8I A;  1C0M A;  4Z4F A;  5AQZ A;  4GVE A;  1FKP A;  4CFA A;  4DFJ A;  5M1P A;  3ZT1 A;  4KHN A;  3AVJ A;  2RF2 A;  2B5J A;  3VPZ A;  3D2F A;  4C8M A;  4BE2 A;  1JJ2 M;  4O44 A;  3WQU A;  3ZET A;  1D4X A;  1J6Z A;  3CHW A;  4BRI A;  4CK1 A;  4H0V B;  3QFP A;  1EWR A;  4OGE A;  3D2F B;  2P1J A;  2QWN A;  3THV A;  4A5A A;  3ZET B;  3AVL A;  3TAM A;  3CI5 A;  4EHT A;  4Z94 A;  1J54 A;  4H0O A;  3WNG A;  4HCC A;  3BP8 A;  2WFB A;  3PUF A;  3BY5 A;  4B9S A;  4DR5 K;  2O4G A;  2Q1N A;  2QEX N;  4CZE A;  5JIC A;  2GX9 A;  2VCP A;  4DLG A;  3KKR A;  4OPA A;  4ZTJ A;  2D0B A;  3SAH A;  1KFS A;  4M7Y A;  4FJK A;  1VAZ A;  4WQ5 A;  4CK3 A;  2FF3 B;  3S9H A;  3O9U A;  5MLC Q;  3J80 O;  4Z4I A;  2PBD A;  3AVI A;  4C8O A;  2FBX A;  4BDP A;  4WF9 L;  1HQE A;  3R6M A;  1Q7Y O;  1HNZ K;  1L3S A;  3DAW A;  3P31 A;  1U45 A;  3K5O A;  3NVK A;  4OO1 J;  1T7P A;  4JI7 K;  3KLG A;  1YAG A;  2XY7 A;  2D0A A;  2YX6 A;  4BRO A;  3T1Y K;  3AAQ A;  4U7B A;  4NB4 A;  1HMV A;  3C6T A;  3CCE N;  4FZY A;  1KQS M;  5BRF A;  1GOA A;  4JI4 K;  3CCJ N;  1T6D A;  4O0J A;  4KHY A;  4NLB A;  4MO4 A;  3DM2 A;  4A59 A;  3PX4 A;  3RMC A;  1G15 A;  5LJV A;  4JS4 A;  3K9J A;  5HL7 L;  4Y1D A;  3CQX A;  4LY7 A;  3CD6 N;  2QWP A;  3D0P A;  1YJN N;  4YOV A;  4I9L A;  1VSI A;  4BGA A;  3TWH A;  1OVQ A;  3KLH A;  3LWM A;  2D1K A;  3P38 A;  4HWI A;  2ZJP L;  1XMO K;  4ELV A;  3J7Y P;  2ASM A;  4C8K A;  3TSQ A;  2XO7 A;  4KRF A;  3CQ8 A;  3OY9 A;  4FZX C;  2O8D A;  3GOI A;  3ZSV A;  4CBU A;  4FWL A;  5JLH A;  1M1K O;  1TK0 A;  3K5M A;  2ASP A;  4EZ6 A;  3LP1 A;  1U2V A;  1QQM A;  2PFU A;  5E26 A;  2O8D B;  3JS6 A;  3VEY A;  4OKE A;  3HRG A;  5EOY A;  3DWL A;  1RDD A;  1U2V B;  4KPY A;  2G8U A;  1YVN A;  1GOC A;  3QBX A;  1RGI A;  2FSJ A;  1IKY A;  1TKD A;  4E0D A;  2E2Q A;  2OCE A;  5AQY A;  1YJW N;  3VET A;  4XIU A;  4CEE A;  4KBO A;  4CHP A;  2F8T A;  4CJ4 A;  3KLF A;  1LWF A;  2FF6 A;  3OYK A;  4KHW A;  3KLE A;  3LPU A;  4DQQ A;  1JLC A;  4CFC A;  1WNS A;  1JLE A;  2CGL A;  3KD5 E;  1X1P A;  2NRW A;  2XRI A;  3AVN A;  1QSL A;  4CGI A;  3T7Z A;  3SUP A;  3AGR A;  1I39 A;  1XI1 A;  1RTJ A;  3JSM A;  3SUO A;  2A41 A;  2V7Y A;  4C8L A;  4F3O A;  2NUB A;  3QNO A;  3U9D A;  3CPW M;  3J8A A;  2Y1J A;  1NGI A;  4YHH K;  2JWK A;  1VSJ A;  4OGC A;  5CZ1 A;  4CEC A;  1UAX A;  4FJL A;  1S5J A;  4GV6 A;  4EHU A;  2GEL A;  3KHY A;  2P9I A;  1NOZ A;  1BUP A;  3LM9 A;  3SAF A;  4Z0U A;  3TAN A;  4FJ5 A;  1SL1 A;  3R1X A;  2D0P A;  3JYT A;  4RW6 A;  4CZJ A;  5M1O A;  3K59 A;  3I8D A;  3SZ2 A;  1FW6 A;  1X3N A;  1BA0 A;  5F0X A;  5LJW A;  4JV5 K;  4CZL A;  4A2A A;  5AQI A;  3GE1 A;  1J53 A;  2XY6 A;  4DV4 K;  3HVT A;  3H46 O;  1NNE A;  3MX5 A;  3VQ6 A;  3O08 A;  4IZ9 A;  2JGU A;  1K9M O;  1KVA A;  4DQP A;  5LL6 Z;  1BU6 O;  3E1Y A;  4CJQ A;  4ILH A;  1F21 A;  3V9X A;  2ATQ A;  1LV5 A;  3VER A;  4DSI A;  4FWK A;  5I3U A;  3ITH A;  5JS1 A;  2VG5 A;  2OAN A;  1CZB A;  5TKW A;  3R8E A;  3CCS N;  4K43 A;  1WUA A;  2ZF5 O;  3CJC A;  5BPM A;  1N33 K;  3HBT A;  2KQ2 A;  1IBK K;  5D3G A;  5J2P A;  2KTQ A;  3HK2 A;  4ID1 A;  1S1V A;  4DV6 K;  5JLF A;  3T1H K;  1L3U A;  4DUY K;  1D5A A;  3A8Y A;  4U67 L;  3IAY A;  3DRS A;  4HTU A;  3I56 N;  3H3N O;  2ZGZ A;  1NKB A;  5FRM A;  4PY5 A;  4FW2 A;  2PYL A;  3DLL L;  1DTQ A;  3CYM A;  4A62 A;  1RDW X;  3ALY A;  3CCQ N;  1ZBF A;  5FPD A;  3V1R A;  3EYZ A;  1S1X A;  1P8Z A;  1GLF O;  1VQ9 N;  3L2Q A;  1VRT A;  1SZ2 A;  2E2P A;  1S3X A;  1TAU A;  3IRX A;  4YFU A;  4OKK A;  2KLA A;  2VG6 A;  4CF9 A;  3AVC A;  2G8W A;  3DLR A;  1LWC A;  4FWS A;  1X9S A;  1HR0 K;  1T44 A;  1SL0 A;  1NBW A;  2DFE A;  5LMN K;  3WUH A;  4N76 A;  4F9O A;  1Q18 A;  4BR7 A;  1ZBI A;  4CZM A;  1WBB A;  1HX1 A;  4LF6 K;  4JK8 A;  2UXB K;  2D0C A;  1RT7 A;  4G1Q A;  1BQM A;  4CGF A;  3ZX2 A;  3NVM A;  5KPZ A;  2G8V A;  5A2Q O;  3OYM A;  4DCH A;  5BR9 A;  5BRH A;  4FO0 A;  1TKT A;  4BG8 A;  4K0K K;  1ILY A;  1QHT A;  4JK9 A;  3K2P A;  1A5W A;  3T69 A;  1N8R O;  4FK0 A;  1TUU A;  4IOC L;  2E5L K;  1JLA A;  3ZEU A;  5GIO A;  1Y64 A;  4DU4 A;  1I3A A;  1IG9 A;  2YNF A;  1IBM K;  4BRL A;  4CVN E;  2QXF A;  3L2V A;  2QWO A;  3KK1 A;  4E7H A;  5AQH A;  1OH6 A;  5AQP A;  1YTA A;  5HOO A;  3A5N C;  2DTU A;  1BWF O;  2G8F A;  3PLA A;  1YF5 L;  2VGM A;  4KKO A;  4PQU A;  3ZT0 A;  1ASV A;  4DLE A;  3OYI A;  1NMD A;  4CES A;  4CGJ A;  4X64 K;  3OJS A;  4CE9 A;  1X9J A;  3V1O A;  4K41 A;  5HRS A;  3BF3 A;  3SPY A;  4BRH A;  4EP4 A;  4QOZ B;  4E7J A;  2R7Y A;  2KZZ A;  2GUP A;  5C24 A;  3MN6 A;  2BH1 A;  4DMN A;  4CEQ A;  3VGK A;  3QEW A;  4WCE L;  1NK8 A;  3OBY A;  3F5T A;  3VEV A;  4PKI A;  4W5R A;  1RBV A;  3A5L C;  4JI6 K;  1JKH A;  1SQK A;  2NRV A;  4CBW A;  3UKR A;  3V9Z A;  5FPM A;  2FXU A;  3O4N A;  3BGR A;  3WXK A;  4JI5 K;  3QFU A;  3O9Q A;  5AR0 A;  5KTQ A;  3VQ5 A;  4FM1 A;  1KAY A;  3TAG A;  1NJW A;  1N36 K;  3U3Y A;  3OHR A;  4YOY A;  4AF1 A;  3MEG A;  2IS3 A;  2NRR A;  1RTD A;  3D45 A;  3H3O B;  3AAR A;  2YJF A;  1X3M A;  5J2M A;  4BC4 A;  2ETJ A;  4H4M A;  3HP6 A;  1GLJ O;  3VTH A;  4DF8 A;  3CCU N;  4FLZ A;  1NK4 A;  4BR5 A;  1C1B A;  4H5V A;  2V7Z A;  1S1W A;  3LAK A;  4Q0B A;  3PY8 A;  4CEA A;  3WNH A;  2F4V K;  3KK2 A;  4N47 A;  1WAJ A;  4WFB L;  3QML A;  3LDQ A;  4B9M A;  4Y0W A;  4DF4 A;  1LOT B;  4B08 A;  4OPK A;  1Z26 A;  3OYF A;  3AVB A;  4KHU A;  4I7F A;  1IKX A;  3AO1 A;  2A6A A;  2CH5 A;  2VWK A;  1DTT A;  4BRA A;  4DR7 K;  4J2E A;  2OPP A;  4KB0 A;  4IFY A;  5AFU H;  2FC0 A;  5KGX A;  4Q5V A;  4DR2 K;  1GLB G;  2BAN A;  1OVY A;  4DV2 K;  2I7P A;  1MWK A;  3RSE B;  3SQ0 A;  1NM1 A;  4F2S A;  3L0Q A;  4XH5 A;  3J81 O;  4E7I A;  2B4J A;  4NLC A;  3FZL A;  3EE8 A;  1RDU A;  4Z4C A;  1A5X A;  1HUX A;  4JN4 A;  4B1W B;  4FK2 A;  1MWM A;  2BUP A;  4JYA K;  3E66 A;  2UUC K;  2DY4 A;  3U6F A;  3B6P A;  4AHT A;  3CJ1 A;  4QS7 A;  2ZD1 A;  4LFA K;  2Z1I A;  5DMR A;  3QNN A;  4RW7 A;  4CK2 A;  4O8K A;  3V9W A;  3MN7 A;  1HYZ A;  3TAR A;  3M8R A;  3EN9 A;  3QIP A;  2F7T A;  2GWK A;  3FZH A;  1HJO A;  2IIR A;  5C25 A;  3PX6 A;  3NH0 A;  1ZXO A;  4DQ8 A;  1RT2 A;  3SJJ A;  1VSL A;  1XC9 A;  1NGJ A;  1XNR K;  2W41 A;  2IAJ A;  3P5J A;  1KXP A;  3UIQ A;  4B9T A;  4KTW A;  4FJJ A;  3LP0 A;  3QEP A;  1QHA A;  4BWM A;  1HNV A;  2VWB A;  3G6E N;  3HP9 A;  1KAX A;  3CCR N;  3QBW A;  4X66 K;  4CHZ A;  2E2O A;  4BAC A;  4FJG A;  2GBZ A;  4H0X B;  2HHV A;  1KCF A;  2A1R A;  4B1U B;  2HHH K;  2YHW A;  3CPE A;  2NRH A;  4J8F A;  3LZI A;  3VF2 A;  4BGB A;  3OYL A;  5AZI B;  4I2Q A;  2HVH A;  1RDC A;  4FWP A;  3KZB A;  1RCH A;  2OPQ A;  3OYJ A;  3HOT A;  4RW8 A;  1IO2 A;  1WSG A;  4WFN L;  3MCP A;  1FXX A;  1EET A;  3EE9 A;  3GDQ A;  4H4O A;  4BRM A;  4DTN A;  3NGY A;  2O8F B;  3EEQ A;  3VQ7 A;  2O4I A;  3CG7 A;  1LWE A;  4FM2 A;  1R0A A;  4FJN A;  2I5J A;  2Q0U A;  3I0S A;  3FZK A;  2QK9 A;  3EO3 A;  3L4Q A;  1S1T A;  5C12 A;  2BGG A;  3O6W A;  2O8C B;  4FCY A;  1BCM A;  4KHS A;  4BRC A;  3BEX A;  4A2B A;  3CFR A;  2IC3 A;  1TGO A;  1U48 A;  5KGW A;  3SQ1 A;  4CEO A;  3KIO A;  3CJ9 A;  4BDY A;  4JLH A;  4FWN A;  1Q82 O;  3TTD A;  1VQ6 N;  1KSP A;  3P39 A;  4XH1 A;  2O8B A;  3OBW A;  3CC2 N;  3L6Q A;  4MFB A;  1XHX A;  3HTV A;  2NNW A;  5GAG P;  4PUO A;  5M1F A;  4JD2 A;  4JKB A;  2O8B B;  3ASM A;  3CFP A;  4W5Q A;  1BIS A;  4CHY A;  3AY9 A;  5AQO A;  3THW A;  5HBM A;  4IFE A;  4JD2 B;  1EO1 A;  4A61 A;  4BVP A;  1YUW A;  3DOL A;  2YHX A;  2E2N A;  2A42 A;  4E7L A;  3THW B;  3H1V X;  4RTF D;  3HYF A;  3LAL A;  1JL2 A;  1IKW A;  5ELZ A;  1DGK N;  5B8H A;  1WLJ A;  3VGL A;  4BC5 A;  3F9M A;  2RKI A;  4KHP K;  3BZK A;  1YJ9 N;  3HPH A;  1VK0 A;  4CZI A;  3QEX A;  1RTI A;  1J5E K;  5LY3 A;  1TKZ A;  4DSJ A;  3AO3 A;  3NF8 A;  3MED A;  4CHN A;  3CXC M;  3L2U A;  3ATV A;  2X78 A;  4CJP A;  3T3F A;  3SUN A;  4IDH A;  4M41 A;  3VGM A;  3PO4 A;  2DFH A;  1EQY A;  3LPT A;  4FJ8 A;  3CC4 N;  3ZT4 A;  4H03 B;  3HPO A;  3SJH A;  1EP4 A;  2VG7 A;  1NGC A;  4J2B A;  2Q3S A;  2HST A;  4CGG A;  4FOI A;  2HBJ A;  1GLD G;  2P9N A;  4IO8 A;  4M3Y A;  3ULD A;  5BN9 A;  4YDU C;  4EIA A;  3G4S N;  1S6P A;  4K8Z A;  4DS4 A;  1UOC A;  3TAE A;  2ZJQ L;  5J2N A;  4BE1 A;  1Z6R A;  3TAP A;  2P9N B;  4LF7 K;  4LFB K;  4GY2 B;  2IVP A;  1MU2 A;  3SCX A;  3T1A A;  4FJI A;  4CZH A;  1OH8 A;  1BGX T;  2GWJ A;  4CJE A;  3C7N B;  5K14 A;  5I9E B;  3O9R A;  5AQF A;  3VQE A;  3MN5 A;  3BDP A;  3VEZ A;  1V4T A;  4CJL A;  1C0G A;  4GW6 A;  2QWQ A;  4DHY A;  2DPN A;  4E89 A;  5E41 A;  4B9N A;  4B9U A;  4FLU A;  4HUE A;  4OKJ A;  3P1G A;  4BQZ A;  1OKJ A;  1MA9 B;  3EKU A;  2P51 A;  4DKW A;  2RE2 A;  3L2W A;  2EX3 A;  3MXM A;  3CJ7 A;  4DG1 A;  1W9H A;  2RN2 A;  5AZJ A;  1ZBH A;  3T19 A;  1W2B M;  4MDA A;  1QQC A;  3ZLJ A;  1B9D A;  5H1S Q;  2YCH A;  4CF0 A;  4FOE A;  4CJW A;  2I7N A;  2UUB K;  2Q97 A;  1TYQ A;  2D4W A;  5AZJ B;  3ZT3 A;  4PWD A;  4N56 A;  2P9U A;  3TU5 A;  5C2F A;  4A5B A;  3NH1 A;  1VQ4 N;  4LF9 K;  2HHQ A;  3S3N A;  3D7E O;  3LL3 A;  1ZYQ A;  2X6S A;  4DTR A;  1WOQ A;  4CIF A;  1C0F A;  1DKG D;  1TYQ B;  4O5F A;  2Z1H A;  3VQ4 A;  3S3O A;  2YNH A;  1LW0 A;  2E20 A;  3OW2 M;  4B3T K;  2GV9 A;  2P9U B;  3VES A;  1E4F T;  3E9L A;  4LFC K;  5E84 A;  3PX0 A;  1VSF A;  1K73 O;  3O5B A;  5GAH P;  1VQ5 N;  5AQS A;  3LP3 A;  3QEI A;  3OYG A;  4AHC A;  3EL2 A;  1RNH A;  3MMV A;  3J7Z O;  3V9U A;  3VQQ A;  4FJH A;  4DQI A;  3CM6 A;  1JLF A;  1IV0 A;  1RDB A;  3VEO A;  4FM0 A;  3CF5 L;  2O8E A;  1BA1 A;  3MWT A;  4BG9 A;  3L2R A;  3I0R A;  1SKR A;  2WBN A;  2HHU A;  3TAF A;  2KFN A;  3UKU A;  1WSE A;  3OA9 A;  4CIE A;  1HYV A;  2O8E B;  1TUY A;  1SAZ A;  1O1W A;  3TSP A;  5C42 A;  4WQ4 C;  1KRP A;  4GNI A;  1Z05 A;  3UE5 A;  3UKU B;  2HOE A;  1Q86 O;  1HRH A;  4E7K A;  1V4S A;  5CZ2 A;  3V1Q A;  5CR4 A;  3I33 A;  3VQ9 A;  3SMP A;  3C94 A;  1NJZ A;  4CZG A;  4DTS A;  3VTI A;  1SKW A;  1KC8 O;  3WXI A;  4RG8 A;  4B1Z A;  3VMF B;  1W97 L;  4FK4 A;  3F73 A;  4OLB A;  3G10 A;  2W42 A;  3VA0 A;  4CJ7 A;  2Z1J A;  4M42 A;  4CZK A;  1H1V A;  4KH4 A;  4GVM A;  4YOW A;  4AHU A;  2ZM6 K;  4KTZ A;  1WN7 A;  1JCG A;  2UYT A;  1N32 K;  4DFP A;  4DTU A;  2G8K A;  4O0I A;  3TTC A;  1HPZ A;  3WNF A;  3EZW A;  1N5Y A;  4FLV A;  2YNI A;  3WT0 A;  5DM7 L;  4H0P A;  1D8Y A;  5AQV A;  3C65 A;  3MXI A;  2KKZ A;  1RT4 A;  4JAX A;  3CJB A;  5FDL A;  4W5T A;  2H3G X;  3ID6 A;  4KAZ A;  5GIN A;  3WQT A;  4QAG A;  3G0Z A;  4DSF A;  2HF4 A;  5CHI A;  1REV A;  2QA4 N;  5EY4 A;  4BE0 A;  3C0B A;  4EFH A;  1N34 K;  3OS2 A;  2PYJ A;  3HST B;  4PL8 A;  5AQK A;  3RR8 A;  2FSK A;  2LSN A;  2EHG A;  5KPR A;  3OS1 A;  1UWB A;  4FXD A;  3U4L A;  4N41 A;  4B3S K;  3DXK A;  4DR6 K;  2QI2 A;  4IEE A;  3D6R A;  2B6A A;  4DSL A;  1TK5 A;  4BRK A;  4YOT A;  3SI6 A;  4BR0 A;  4DU3 A;  5HLF A;  1U47 A;  4AQY K;  3V81 A;  3LP2 A;  3ULE A;  4PL7 A;  3DXK B;  4HUF A;  4RW9 A;  3AVA A;  2YHY A;  1QVG M;  1HJR A;  3KLI A;  4RW4 A;  1S9E A;  3ULE B;  1WSI A;  4IOA L;  5HP1 A;  3OYA A;  3RVC A;  2OPR A;  3M1F A;  2Q2R A;  1NK5 A;  3ZX3 A;  3MK6 A;  3U8X A;  2E88 A;  4JRQ A;  3S41 A;  4ELU A;  1BDG A;  4KRE A;  5AQJ A;  1FK9 A;  5SWM A;  2P9K A;  4KV8 A;  1NG9 A;  4MLE A;  4DWI A;  4QS9 A;  2FLO A;  5AQX A;  1BHL A;  5C10 A;  3SAG A;  2P9K B;  1JLG A;  4B1Y B;  2P5O A;  4B9L A;  3O3G A;  4JKA A;  3NCI A;  4ZHR A;  1K8K B;  4BC3 A;  1RT3 A;  1C6V A;  3DXM A;  4CF1 A;  4KI6 A;  4CJK A;  2DFF A;  3M8P A;  1S9G A;  1U04 A;  4BDZ A;  3PV8 A;  1ASU A;  1K8A O;  3L4I A;  3DXM B;  3L3V A;  5AQW A;  1BQN A;  1HKB A;  4WE1 A;  5M1Q A;  1VQP N;  2YI1 A;  3DRR A;  3K0S A;  4GKK K;  5FRO A;  3CQY A;  3LDP A;  3VQP A;  3VN5 A;  3FE1 A;  4E19 A;  2PZS A;  1S22 A;  4BRF A;  3ZT2 A;  4AM6 A;  3FFK B;  2ITG A;  5FRN A;  4PHT X;  4BC2 A;  4IFV A;  1L3V A;  4LD0 A;  1ATS A;  3SMS A;  5HRP A;  1TK8 A;  4FYD A;  4IXC A;  3NF6 A;  5JVH L;  3EZ5 A;  3AA3 A;  5IT9 O;  4AHR A;  4H5R A;  2WTU A;  4DFK A;  1ATN A;  3P83 D;  2XY5 A;  4K25 A;  1VSE A;  1HQU A;  5JS2 A;  3CER A;  4FL9 A;  3WNE A;  4YY3 K;  4O8U A;  4YDU A;  5FPN A;  4FVU A;  2P9P A;  1NWK A;  4ID5 A;  1MDU B;  1CLQ A;  3U3G A;  3VOV A;  2F96 A;  3ZSX A;  1BCO A;  3AVH A;  5KQ8 A;  2E6L A;  1VRU A;  4FLX A;  3A5M C;  3NAE A;  2UXD K;  4LH4 A;  4CJU A;  3IKM A;  2P9P B;  3VEN A;  1HKG A;  2AP1 A;  4ILJ A;  3QLH A;  3QEV A;  3DRP A;  1L3T A;  4DU1 A;  2IVO A;  4H0Y B;  4E1M A;  1J5O A;  3C95 A;  1VQO N;  4IJN A;  3SBG A;  2ZWH A;  5HRR A;  1KVB A;  1ZBS A;  2W40 A;  4DR3 K;  3TI0 A;  3QET A;  3C6H A;  3HL8 A;  4A57 A;  3F9K A;  4TSX A;  2G8H A;  4IKF A;  1NLV A;  4KH5 A;  3RSE A;  3VQ8 A;  3M8S A;  4JKG B;  5BRE A;  1Q9Y A;  4HVJ A;  4B1V A;  4NXN K;  4B3R K;  3EY1 A;  3E9P A;  4JI8 K;  2HNY A;  1LAV A;  3OYE A;  1UA0 A;  2IGI A;  1C0U A;  1N6Q A;  2X74 A;  4JI3 K;  4DSK A;  3MWP A;  3IG1 A;  5J1E A;  1LAW A;  1YIJ N;  1X9W A;  4RWT A;  4DV0 K;  1RTH A;  1ZBL A;  3NBP A;  4DTO A;  3OJU A;  1W7A A;  4FWM A;  5AQG A;  3Q7B A;  1YIT N;  4XH4 A;  2CGK A;  3THX A;  3DJC A;  3C6A A;  1Q9X A;  4CEF A;  2WOM A;  1B9F A;  1VQM N;  3LDO A;  3G25 A;  3PIO L;  1CZA N;  1HNI A;  2OA8 A;  1EKE A;  4JRP A;  3THX B;  4B3M K;  2Q0R A;  2A3Z A;  4JI1 K;  3H1Q A;  3V9S A;  3KWG A;  4CGD A;  4WQ4 A;  3KVG A;  4DQR A;  2ZE2 A;  4ELT A;  4YOU A;  3HOS A;  3FZM A;  2IDO A;  3QDK A;  2HMI A;  4CJR A;  3MEE A;  4DV7 K;  2GUI A;  5HRO A;  3P4I A;  2HVI A;  4H5T A;  2V51 B;  5KRS A;  4FPB A;  5AZI A;  1C1A A;  3Q7C A;  4OJR A;  3AVM A;  2OZM A;  1S6Q A;  2YKN A;  5AQT A;  4CHO A;  3H6E A;  4OPH A;  1HNW K;  1RIL A;  3TAB A;  2KW4 A;  3VQA A;  1L5U A;  1J9A A;  4CED A;  5EX5 A;  5ADX A;  2O8F A;  4CJT A;  1FKO A;  5C2D A;  1CXU A;  3O9T A;  3ZYY X;  1BOT O;  1WSF A;  3B8A X;  1QS4 A;  3O1B A;  3AAP A;  2PAV A;  5BPN A;  1T05 A;  3NGZ A;  4LSN A;  4M3T A;  3AA4 A;  3U9Z A;  2O8C A;  5AQL A;  3L3U A;  4UQG A;  4FW1 A;  1KAZ A;  3H08 A;  4O55 A;  2ZJR L;  1JXB A;  4PKG A;  2AJQ A;  3HM9 A;  1GLE G;  3IUC A;  5JMV A;  4LSL A;  1D9D A;  1R59 O;  5M1K A;  3RMD A;  2D5R A;  2BTF A;  3MCA B;  5GAD P;  2EWS A;  3CC7 N;  1U6Z A;  3MEC A;  4F4K A;  2ZQB A;  3CME N;  4JKC A;  2BDP A;  4NYF A;  4IO9 L;  4DTP A;  1SV5 A;  3A0I X;  4ISG A;  4WFA L;  1T3V A;  1JLQ A;  3HZ6 A;  5C15 A;  4OVL A;  3VF6 A;  2ITM A;  1RT1 A;  3CIP A;  3NH2 A;  3O80 A;  4FJ7 A;  2D0O A;  2UXC K;  1WSH A;  4RCH A;  1Z25 A;  3SLC A;  4DQS A;  4IDK A;  1NMN A;  1C0T A;  1JL1 A;  4B8A B;  3THY A;  2E1Y A;  1XHZ A;  2PY5 A;  1WB9 A;  2RHK A;  2KFZ A;  4HCB A;  5AQM A;  4B8C A;  3LAM A;  3HO1 A;  3EKS A;  3K9K A;  3VA3 A;  1RBU A;  3THY B;  3VQB A;  5J2Q A;  5I42 A;  4CD3 A;  3TAQ A;  2IVN A;  2YHB A;  1NJY A;  1E3M A;  3AO2 A;  1ATR A;  3AA5 X;  4DB3 A;  2HB5 A;  1M90 O;  2KHO A;  1T6C A;  4CEZ A;  3SYZ A;  5CE3 A;  3LWL A;  5LMU K;  4V19 S;  3M5R A;  4AIL C;  5KI6 A;  2HW3 A;  4W5N A;  4LF8 K;  3E9O A;  4JKE A;  4NCB A;  3PIP L;  2QM1 A; 
#chains in the Genus database with same CATH homology
 1HNX K;  4JYA K;  2ZM6 K;  2UUC K;  5IWA K;  1HNZ K;  1N32 K;  4LFA K;  2UU9 K;  4JI7 K;  4JI6 K;  4YHH K;  4NXN K;  4B3R K;  4JI8 K;  3T1Y K;  4DR1 K;  4JI5 K;  4OX9 K;  4LF9 K;  4DV3 K;  2UUA K;  4GKK K;  4JI2 K;  1N36 K;  4B3T K;  4JI4 K;  1XNR K;  1HR0 K;  4JI3 K;  4GKJ K;  1FJG K;  5LMN K;  5FLX O;  3J7A P;  4LFC K;  4LF6 K;  4DV0 K;  1IBL K;  4JV5 K;  4JI0 K;  2UXB K;  1N34 K;  1I94 K;  5BR8 K;  4KHP K;  2UXC K;  5A2Q O;  4X66 K;  4DV4 K;  1J5E K;  1XMO K;  4K0K K;  3J7Y P;  5IT9 O;  2HHH K;  4B3S K;  4DR6 K;  4B3M K;  1XMQ K;  5LL6 Z;  4DUZ K;  4JI1 K;  4LF5 K;  2E5L K;  2F4V K;  4AQY K;  4YY3 K;  1XNQ K;  2VQE K;  4DV1 K;  4DV7 K;  1IBM K;  3JAM O;  5AJ3 K;  4CVN E;  2UXD K;  4X62 K;  4LF4 K;  4X65 K;  2VQF K;  4DV5 K;  4DR5 K;  4DR7 K;  4LF7 K;  4LFB K;  3OTO K;  4DR2 K;  1N33 K;  1HNW K;  1IBK K;  4DR4 K;  5LMU K;  4V19 S;  4DV6 K;  4DV2 K;  4X64 K;  3T1H K;  4DUY K;  4LF8 K;  4CW7 B;  2UUB K;  4DR3 K;  3J81 O;  4NXM K;  3J80 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...