4OX9K

Crystal structure of the aminoglycoside resistance methyltransferase npma bound to the 30s ribosomal subunit
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular recognition and modification of the 30S ribosome by the aminoglycoside-resistance methyltransferase NpmA.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 30
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2014-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4ox9K00
4DV3K 5A2QO 1XMQK 4K0KK 4LFCK 2UUCK 4JI6K 4DR6K 4DV5K 4DV2K 3OTOK 3T1YK 4DUYK 4B3TK 4LF5K 5BR8K 4B3RK 4DV6K 4LF4K 4JI5K 2UXBK 1N32K 4LFAK 4NXMK 1J5EK 3J80O 1XNQK 4AQYK 1HR0K 4JI0K 4LF8K 3J7AP 4DV4K 3J81O 4X65K 2VQFK 1I94K 4JI4K 2UU9K 4LF7K 4DV0K 5LL6Z 4V19S 4DR3K 1FJGK 4GKJK 5AJ3K 4CVNE 4JI1K 4JI3K 4LFBK 2HHHK 1N33K 4OX9K 3J7YP 4GKKK 2UUBK 5LMNK 4LF9K 2UXDK 1N34K 4LF6K 4YHHK 4DV1K 4JI7K 5IWAK 1XMOK 2UUAK 4JI8K 5IT9O 1IBLK 3T1HK 4KHPK 4B3MK 2VQEK 5FLXO 4DR2K 4CW7B 4YY3K 4DR4K 1N36K 4X66K 4X62K 2E5LK 3JAMO 1HNXK 4DR5K 4JYAK 1HNZK 2F4VK 1IBMK 5LMUK 2UXCK 4X64K 4JV5K 4DUZK 4DR7K 1IBKK 4DR1K 4NXNK 1XNRK 1HNWK 2ZM6K 4B3SK 4JI2K 4DV7K
chains in the Genus database with same CATH superfamily
4AHSA 1SL1A 5KGWA 1IJJA 3JXUA 4KI6A 1HYSA 2BE2A 3L8BA 3LM2A 3C7NB 3HTVA 1QQNA 3KK1A 3KKSA 4JRPA 4KHQA 3DOKA 1S1WA 2EX3A 4LFAK 4CK1A 1RTHA 2NRRA 1NM1A 1JLQA 2G8IA 3J7AP 3R1XA 3V9UA 1NGEA 2YNIA 2FBVA 1J54A 4V19S 3NVMA 3OYAA 3CCQN 3DRPA 2PFUA 1NK7A 3ZSQA 3HBTA 4CGIA 4BG8A 3ZSZA 3U4LA 3QFUA 3HP6A 3QEXA 3E01A 4JKBA 1SKRA 2ITMA 5M1KA 4FWQA 1N34K 4F2SA 4DG1A 3TANA 3OS0A 2O8FB 4JHDA 3F9MA 3O6WA 2HNDA 2ZGZA 3U8XA 5BPMA 1QQMA 3D2EA 4IBNA 3KLHA 3CC2N 3D2FB 4XH1A 3VOVA 3IFRA 2G8VA 3I56N 1Q18A 4H0PA 4M3WA 2P9KB 3WEEA 5EX5A 4YOYA 1EP4A 3O1WA 3J8AA 5CYQA 3DRRA 4KH6A 4AHUA 4KTZA 3O3GA 4I9QA 2NRVA 4DR5K 1W9HA 4W5OA 1WSIA 1YHQN 4AHTA 4LH4A 5C12A 2GWJA 2O8CB 1C0GA 1BI4B 3SUQA 3QMLA 3NMUA 3KK2A 3MX5A 4F4KA 1WLJA 3D2FA 4CZGA 3DWLA 1EXQA 3QNOA 2YHYA 1NU0A 3NH2A 3P1GA 2RN2A 3CCVN 2VYPA 2PBDA 3QEIA 4BC2A 1RFQA 4N76A 4DB3A 3FGUA 4CJRA 3VEVA 1NKCA 3I33A 4J2AA 1K8KA 4WYBA 4K0KK 1DEJA 5EOYA 3PO4A 4B9LA 4QAGA 2HHWA 3TABA 3TI0A 1HYZA 3TTCA 4DUYK 4DF8A 4FK2A 3DRSA 2QXFA 2P51A 1QHAA 5H1SQ 4PY5A 4N5SA 4FM2A 3OY9A 4E7LA 5AQWA 4K25A 5AQOA 1XNQK 4RWTA 4F3TA 1NK0A 3G10A 3Q7CA 2O8FA 4JD2B 1EX4A 3DI6A 3VQ4A 2F8TA 1NGJA 1NJIO 3CMEN 1FJGK 5JICA 3ZSVA 3ATVA 3VGLA 1Q82O 4LFBK 4XIUA 3E66A 3R9PA 3AA5X 1C1AA 4IWVA 1ASVA 4C8LA 4CE9A 2OANA 2YHXA 3CXCM 2HF4A 3GE1A 5C10A 5HRNA 2IOCA 3H08A 4JS5A 1NGIA 4PKIA 3AA2A 2D4WA 4YOUA 1VQ9N 1T44A 3ZETA 4Z4FA 3K5NA 3JSMA 4E89A 1VHXA 5DM6L 3C6AA 4ZHRA 3MMVA 2ITGA 3LZIA 3R6MA 5ADXA 3FR0A 4JKDA 4CBUA 4CJLA 1JXEA 1HNXK 5GADP 4GV3A 1DTTA 3KLIA 3RVCA 3CCMN 4EP5A 1KAYA 4KREA 4BE1A 1Z05A 3L4IA 2IVOA 3SPYA 2DY4A 1WBDA 1HQUA 2EHGA 2KTQA 4HTLA 2KW4A 3M8RA 4BR2A 2CH5A 4CHNA 4G1QA 2D0OA 4E1JA 2WBNA 5C0YA 3OHRA 4F8RA 1WOQA 2B5JA 3OYFA 4CGHA 1KVCA 1S1UA 1MWMA 4BE0A 1MDUB 4CCHA 3C6HA 3ZSYA 3VEWA 5LJWA 4HHTA 2NRTA 5BPLA 5HRSA 4RW9A 2HMPA 4YNQA 1BIUA 4CK3A 1XMQK 4BRCA 3EYZA 2VWJA 3BZCA 3B8AX 3VQEA 3P5JA 5GIPA 2B6AA 3VQBA 4B3TK 2XO7A 4IJAA 1W0HA 1NGBA 4CESA 2X78A 4JEPA 3P4IA 2Q0RA 4PA1A 5KTQA 1CLQA 4AQYK 5KGXA 3THYB 4KPYA 1N6QA 1EO1A 1RDBA 3H46O 4FJ5A 1QS4A 1IG8A 3NBPA 3WXKA 4C8KA 4DSJA 4CFAA 4BDZA 4N41A 4GKJK 1KC8O 2VGMA 4FVMA 4ELTA 1W97L 2XRIA 2XY5A 2KQ2A 5M1NA 1GLEG 3JS6A 2GEMA 3LM9A 3ZYYX 4M7XA 5J2MA 1UA1A 4J2EA 3V1OA 4OX9K 2E8AA 2YNGA 5LMNK 1GLJO 2D0AA 2YJFA 3P31A 1GOCA 1VQ8N 3SCXA 4U67L 4KBOA 3IDHA 4O44A 3MK6A 2O8DB 3PLAA 3S3NA 3O9QA 1D9FA 2FF3B 4CFBA 4CZEA 1YI2N 4YOVA 2V52B 2NRZA 3SPZA 4CW7B 1KAZA 2P9NB 5GAEP 3CETA 3GDQA 2Z1HA 1QZ6A 4I2QA 3THXB 2NRXA 4DQRA 1SAZA 4JNEA 5AFUH 2P9PB 5AQRA 4YOXA 5C15A 1U2VA 3WNEA 3U6FA 4B9MA 3HT3A 4Q5VA 4FLYA 4KTQA 1A5VA 1EQYA 5J2QA 3L3VA 1RILA 1SKWA 1S9GA 2P9KA 3TU5A 3WEEB 4W5RA 1U4BA 5BRHA 1VQKN 3CPEA 3K5OA 3PV8A 1RDWX 1SL2A 5HRPA 3FZLA 3QO9A 3L2UA 1LV5A 3K59A 1MA9B 4IG3A 2UUCK 1BI4A 3S9HA 3NCIA 4DR6K 4O0IA 2OPSA 3M8SA 4FO0A 3WNFA 5JS1A 3KD1E 1JCEA 3ZCMA 3ZT0A 4LF4K 3PX4A 3CHWA 1SV5A 3I8BA 4FWPA 4M3TA 4B9UA 4H0YB 2CH6A 4NYFA 5BPNA 1VRUA 5KPTA 4FWOA 3ZSOA 2KLAA 4B1ZA 3FZFA 3J81O 2DFHA 1I94K 1VQMN 3N4PA 1RTDA 3IG1A 4F3OA 4UQGA 4Z4EA 3SZ2A 3O9RA 4BROA 5HRRA 1TAUA 1WAJA 1HJOA 2VWBA 1QQOA 1JLEA 2AJQA 3D0PA 4DTOA 4PL8A 2WFBA 2OPRA 1J6ZA 2F8SA 1IV0A 4GKKK 4OLBA 3NH0A 5JS2A 4CFDA 2NRWA 4HCBA 4CHPA 1O1WA 5FPMA 3AARA 3CJ7A 3O4WA 4CF9A 3OYJA 3NF8A 1UA0A 1YIJN 5AQGA 3MWPA 5AZJB 3VEOA 3SAFA 1T05A 4E0DA 5IT9O 1S5JA 4DU1A 5JVHL 1HPMA 3QNNA 4M42A 4CJ4A 2QEXN 1Z26A 5D3GA 2HBMA 3CC7N 3K5LA 4BRIA 3QESA 4JYAK 3CC4N 1TAQA 4OJRA 4FJIA 4E7JA 3NGIA 2PY5A 1RT1A 3AAPA 4CJFA 1RT6A 1TL3A 1VQNN 2O8DA 4RCHA 3DLLL 4DUZK 4M41A 1W7AA 1JCFA 1U45A 1IKYA 1ZBUA 3OW2M 3ENBA 5CZ1A 4G9ZA 3VEXA 1KFSA 4BR4A 1Z25A 5GINA 2XHBA 5J2PA 5AQKA 3R3LA 1TKTA 3M5RA 2WOMA 2NUBA 5AQTA 3C0BA 3O9TA 2RHKA 2HNZA 3G0ZA 3HSTB 2VG5A 2ZJQL 4I6MB 3KZBA 2ETJA 3HRGA 4JI6K 3QDKA 3VF4A 4BRMA 4DV2K 1BA1A 3CQ8A 2AA4A 4AILC 1UOCA 3IRXA 1U48A 3QIOA 4MDBA 3CCRN 1J5EK 4C1NI 3S41A 1IG9A 4FJ8A 1NGHA 3N4QA 1XUPO 4DSKA 4CBWA 3QEPA 2AP1A 4ELUA 1JLCA 2KZZA 4I6MA 3SNNA 4BQLA 3CQXA 3LDLA 3H45C 4WF9L 3HPGA 4LY7A 1YJNN 5AQQA 5E41A 1K6YA 4DS5A 1IO2A 4CJ7A 5AQIA 3VENA 3WT0A 4GW6A 3NHGA 4E7HA 4BACA 4GV6A 5AR0A 4C8OA 4A57A 1VSLA 4DS4A 4H4OA 5CYMA 4IFYA 1XMOK 2A40A 1TKZA 2ZQBA 1BGXT 5AFUA 3DXMB 3E9PA 3PX0A 1HKBA 3VQCA 5CE3A 1OH6A 2VQEK 1J5OA 4JK7A 2JLEA 1Q86O 5BREA 3EE8A 2IGIA 1NGAA 4WFBL 3MN7A 3CFRA 1VQ6N 2E5LK 5AQNA 4QCLA 2QWNA 3L4QA 3OYCA 4ID1A 1FK9A 2F4VK 1Q81O 3CM6A 4CBXA 2E88A 2ZWHA 4ZTFA 1NJZA 5LMUK 3P83D 5M1OA 4IEIA 1GLCG 3NVKA 3CMAN 1BQMA 2A3ZA 4L8RB 1S1VA 3ZT3A 4FJHA 1DGKN 1RCHA 4ZTJA 1A5WA 4CJWA 4FCYA 2HF3A 4BWMA 5AQHA 5JLFA 3AVGA 2PYLA 4CF8A 3LP1A 3TARA 1XWLA 1YJ9N 2O8EB 1KAXA 3HPOA 3A0IX 3ZSXA 2P9SA 4Z4HA 3AGRA 4CEEA 4N47A 1FXXA 2QTDA 1YUWA 3O8MA 4H5NA 5FPNA 2IS3A 3CI5A 3MCPA 4BRQA 5C25A 1MU2A 1TYQA 3OYBA 4O5BA 1VQON 3B6PA 1UAXA 1NBWA 4DQQA 1HR0K 4MO5A 4X65K 3LDPA 3ASMA 5MLCQ 4LF7K 3SMSA 4CZMA 4NB4A 5FPEA 1BG3A 2Q0UA 2Q2RA 2P9LB 4CF0A 4EZ9A 4OGCA 3S3MA 4JI1K 3U3YA 4GY2B 4B8CA 2ZF5O 4DF4A 1CXQA 2W41A 3AVAA 4IG0A 4Z94A 1X3NA 4XH5A 4CF2A 4DTJA 2A1SA 3TAEA 3IS9A 4KHNA 1RT4A 3G71N 3CCJN 1X3MA 3E9OA 4FYDA 2GBZA 3KLGA 2ZJRL 4OGEA 2VCPA 1JJ2M 1TK8A 2G8WA 1FW6A 4B9QA 3VA0A 3V9ZA 2WTUA 3OYNA 2YKNA 4FJ9A 1Q8IA 1RBUA 5AZIA 5HP1A 3LDNA 1LWEA 1HNIA 1F21A 3RWUA 2E6MA 4E3SA 3HVRA 4C1NK 3ZT4A 3C65A 4CF1A 4DSIA 1HNZK 4QS8A 3HXMA 5JLHA 3UKUA 3OYEA 2DFFA 5F1XA 2PAVA 4EHUA 3C7NA 2HOEA 1NMDA 1TUYA 1VSEA 3AVMA 5F0XA 3HL8A 4LSLA 4KB0A 4CJ3A 4FK4A 5AQMA 3CG7A 1BWFO 2V51B 3NF6A 3EE9A 4NXNK 5AQUA 4CD3A 1BCOA 3RTVA 1Y97A 4FLVA 2HMIA 2XY8A 2OZSA 4CEAA 4C8MA 5EU7A 3E1YA 3VN5A 4BRAA 3TTFA 4QS7A 3RMDA 1JLAA 2BGGA 5AQPA 1VSFA 4JN4A 3LDOA 4KHWA 4NXMK 1RBRA 4GVMA 4FVUA 1HPZA 2VGNA 3RSEA 2P5OA 3DM2A 3CCUN 1NJXA 3PIOL 2G8UA 1HUXA 4DKWA 5T7BA 3WNHA 4JI4K 3CJ1A 4DV0K 4IOCL 3OS2A 3SBTA 4R5PA 2GWKA 5AQJA 1BL3A 4PKHA 3CJCA 4WFAL 3DXMA 4HCCA 3VESA 4BDPA 4MLHA 2FSNA 3THWB 4O8KA 4HTUA 4IO9L 3CJ9A 5BRFA 4Z4CA 3A8YA 2YHAA 5ELZA 4KO0A 1L5UA 3RSEB 3ULEB 4Z4GA 4MQ3A 3C6UA 2A41A 2E4LA 4KHSA 3AA4A 3KWGA 4M3ZA 3I8DA 1JLGA 1ASWA 4B3OA 4AM7A 3EZ5A 1GLLO 1D9DA 4IJNA 4J2BA 4IO8A 4JKEA 4BGAA 4WFNL 4FLUA 3ID6A 5I9EB 1NK9A 2BTFA 3Q7BA 4GMJB 1BOTO 4X66K 2NRHA 2Q1NA 4CEDA 3HOTA 4CHYA 3T19A 3SK3A 1P90A 5EXWA 3W3DA 1LWFA 4DLEA 3P39A 4AHVA 2VG7A 3BY5A 5B8HA 4B9SA 2FSKA 4JKGB 5EVZA 3VEYA 3MECA 4EAHD 2XY6A 1XHZA 4BC5A 3DLRA 3VMFB 1HRHA 4E1MA 1W2BM 3KKRA 3O08A 4OPKA 5KQDA 2WUSA 2QI2A 4AF1A 3SYZA 3NH1A 3SAGA 3BF3A 3TWHA 1EETA 4FSVA 4IEEA 2Q97A 2IIRA 1RDAA 2W42A 3D7EO 4BR5A 4RW8A 4ISEA 4H0TB 4CEQA 4E7KA 2HB5A 4JKHA 4OPAA 4CJQA 1HNVA 2JWKA 3MEEA 3M8PA 4F9OA 3VQ9A 4M7YA 2QXLA 1JCGA 4DTSA 3D2EB 3TTDA 3CERA 3MAQA 1KXPA 1ATSA 3R8EA 3VQ6A 1JL1A 1SQKA 3LALA 1ZBIA 1VSIA 1HMVA 3THXA 4WQ5C 3GOIA 2CGKA 3DOLA 2D0PA 4BRHA 5KPRA 1TGOA 2P9UB 3UE5A 1RBSA 3SBGA 4YDUA 5DM7L 2QA4N 4JI7K 3K9KA 3CCSN 1RT2A 3CM5A 3TPQA 3OYMA 1JKHA 1RGIA 1DLOA 5KQ8A 4CJTA 1NK6A 3RMCA 1T6CA 2KFNA 2V7YA 1C0TA 2Z1GA 3BUZB 1T6DA 1LW0A 1WN7A 3O3FA 1GLDG 3QIPA 1IBMK 5J2NA 1X9JA 3MDQA 1Z6RA 3MXJA 1VK0A 3HP9A 4JK8A 5TKYA 4DQIA 4OKEA 1IBKK 2G8FA 1YAGA 4BRKA 4JK9A 1G99A 3AO4A 3A5MC 1DTQA 2P1JA 2QWPA 4BRLA 4YFUA 5AQFA 1K8AO 3T1YK 4CGDA 3WQTA 5BR8K 4LF5K 2PYJA 1YITN 4B3RK 4DV6K 4M45A 1ZBSA 1QSLA 4KHUA 1E4FT 2FBYA 1VSMA 4DQPA 3J80O 3IUCA 4PQUA 1NKBA 3U9ZA 4WCEL 1SUQA 3O9SA 4FZXC 2HVIA 4KAZA 3QICA 3G4SN 2RKIA 2UU9K 3BEXA 4CZJA 1KRPA 2D0CA 4IDKA 4OPHA 4K8ZA 4CVNE 1BUPA 3LDSA 4AH9A 3CYMA 1HX1A 4FJLA 2HHHK 1WSFA 3HPHA 2JWLA 3S3OA 2OPQA 3FFKB 1XC3A 3NFAA 1X9MA 3J7YP 1OKJA 2Z1IA 4DU3A 5TKWA 4DQ8A 1B92A 3THYA 1IKVA 1RT7A 3LP0A 4FJKA 3GBTA 4CHZA 4PHTX 3KD5E 3DMJA 5K14A 4DU4A 4DSLA 3UKRB 3KJVA 5C24A 4JI8K 2QKKA 3EZWA 4FK0A 2OYQA 1EWQA 2QWQA 4JKGA 4FXDA 1TV6A 2YHBA 1YVUA 4CZIA 4O0JA 1QVFM 3CFOA 2E6LA 3AVBA 3RMBA 5J1EA 1GLFO 4BE2A 1T7PA 1O13A 1BU6O 3IKMA 3L6QA 3RR8A 4HVJA 3SI6A 2F7TA 3T7ZA 2UXCK 4BC4A 3UKRA 3OYHA 4M3YA 4O8UA 2E1YA 2F9TA 1KLMA 5AZIB 3U9DA 3NGZA 5FRMA 3OBYA 2O4IA 2ASPA 1NGCA 5FPDA 2HBJA 1IKXA 2DFEA 4JKCA 4B1WB 4BR9A 1C6VA 3DXKA 3CD6N 5A2QO 5AQSA 2Q36A 3O1BA 4KKOA 3ZX2A 3NE6A 4B9VA 4MLEA 3WXLA 3SAHA 2OTJN 1HQEA 1B9DA 3TSUA 4FM0A 1CXUA 1QVGM 1WAFA 3OYDA 3F73A 4EP4A 1ZBFA 3CCLN 1C1BA 3TAPA 3ITHA 3TSQA 2VQFK 3C94A 2E2NA 4W5QA 4OLAA 2A5XA 3RR7A 4H5TA 3CJBA 4JI3K 3V4IA 3VGMA 4Z0UA 4CERA 2HW3A 4H03B 3I0RA 1FKPA 2QKBA 4FJMA 2B4JA 4IKFA 4UY8O 3VTHA 4EIAA 1NK8A 3F2KA 4GVEA 1ILYA 5BR9A 1NMNA 3EN9A 1NJYA 4LF6K 5C2FA 4CIEA 5IWAK 4BC3A 3FE1A 5AQXA 1RTIA 4B3MK 4FLWA 1NG9A 3AGKA 4KI4A 4WQ4C 5BN9A 4IXCA 1N5YA 1N36K 4FPAA 2HHUA 1NLVA 3W0LA 1XI1A 1RDUA 4WQ4A 1K9MO 3DYAA 4FOIA 1S9EA 2D0BA 4E7IA 3V1RA 3EO3A 5BRDA 2O8EA 4NCAA 4A5AA 2CGJA 2IVPA 4Y1DA 1QHTA 2HHQA 5HLFA 1A5XA 2I7NA 2UYTA 5AQLA 2XY7A 4BQZA 1WB9A 1JLFA 3F9KA 3AO5A 4BVPA 1ZC6A 4CZKA 3SQ1A 1D4XA 3CJAA 3V9XA 1YXQA 3VQ5A 3CPWM 3VERA 4JI2K 4Q0BA 3QEVA 4NO7A 3THVA 3TAFA 2IAJA 4Z4IA 2YNHA 2Q3SA 3ENHA 3AO3A 1S6PA 2BANA 3K58A 1G15A 4DV5K 3K5MA 5HROA 1LW2A 3A2FA 4CGGA 2QM1A 1T03A 2Z1JA 5GAGP 4PWDA 1RNHA 1SKSA 2ATQA 3ZLJA 5GIOA 4YOWA 4JKAA 3FFIA 2FBTA 4FZYA 2BUPA 1VQ7N 1KVBA 2KZMA 1RDCA 3NF7A 1NNEA 1OH5A 3VF6A 3AVIA 1CZBA 4ICLA 2O4GA 4Y0WA 4NLBA 3H1QA 5CZ2A 3BZKA 4FOEA 1ATRA 1NK5A 3AVCA 1BDGA 4CZHA 3KK3A 3LAMA 4YDUC 1VQPN 4FWNA 4FM1A 5E26A 4FLTA 1SL0A 3O4QA 3PUFA 3T3FA 4H0XB 2UXDK 3HI0A 2BDPA 1VSDA 3AY9A 3BGRA 2GELA 4KB1A 4OVLA 4DV1K 3ZT2A 1NGFA 1U6ZA 4FWSA 4CGFA 5HBMA 1VQ4N 2QWRA 1REVA 3OS1A 5KI6A 3K9JA 3U3GA 2GUIA 1BHLA 4OKJA 4DTNA 1Q7YO 4FLXA 4FJXA 4FZZA 1VSKA 3CF5L 4ILJA 1R0AA 2RF2A 4B1XB 1QQCA 2IC3A 1LOTB 1P8ZA 1K8KB 1S1XA 2A6AA 3WXJA 4NYNA 4X64K 4RW4A 2E1ZA 4CJPA 2HBLA 4NCGA 4CEBA 1S3XA 5JMVA 1U47A 4H8KA 4J8FA 2WC9A 4A5BA 3DAWA 1MWKA 3A5OC 2HHTA 4BREA 2YKMA 4OKKA 4FW1A 3HOSA 5EY4A 2Y1JA 3IAYA 4PUOA 4DCHA 1EWRA 4JD2A 2VG6A 4FWRA 3A5NC 1HJRA 4FWKA 4LD0A 4LFCK 2O8BA 4OPJA 3AO2A 4PKGA 2NLXA 3M3ZA 5FDLA 1K73O 3QB0A 3A5LC 4DFKA 3M8QA 4DQSA 3MN9A 2UXBK 2IVNA 1CZ9A 3FZMA 4DTUA 4FJNA 3ID8A 4JI0K 3ULEA 2CGLA 4AHCA 3OJUA 4DV4K 3SJHA 4LC9B 1YJWN 3AVJA 3KLEA 3TAMA 1BO5O 2O8BB 1ZBLA 3OBWA 4BY9C 3NF9A 4DTRA 3EEQA 3G6EN 3L2VA 5M1FA 4CJKA 1NOYA 4A59A 4H4MA 3RMAA 4B8AB 4YORA 4I9LA 1RDDA 3L3UA 2Q31A 4EFHA 4RTFD 3CFPA 1NOZA 2I5JA 1WSHA 4CIGA 3V6DA 3BDPA 1I39A 1T8EA 2YV0X 1DKGD 4ILGB 5FLXO 4DR2K 4DSFA 5KPZA 1JL2A 3VQPA 3SUOA 4DTXA 3CCEN 1S22A 2W6KA 4GNIA 2KHOA 1RT5A 4CJVA 3BF1A 1NK4A 3QBWA 1U04A 3ZX3A 3SQ4A 3HVTA 2QWLA 2YI1A 3VQDA 1KCFA 4L3QA 4I7FA 1X9WA 1KFDA 4BRDA 4IOAL 4QS9A 3OVNA 4KH4A 2ZE2A 4DR1K 3DJCA 3V1QA 1D5AA 1ZBHA 1XNRK 3KTQA 5HOOA 1T3VA 2FSJA 1YTAA 4K42A 4EZ6A 1KVAA 3AVFA 1E4GT 1JLBA 3EY1A 3MEGA 4XEIA 1VQ5N 3K0SA 2P9LA 2YX6A 3WXMB 1FKOA 1BISA 3LL3A 4FJGA 4K8XA 2P9IA 4DSEA 4KH5A 4BWJA 2QK9A 3K57A 1C1CA 5F2RA 4CK2A 3J7ZO 1B9FA 4H0VB 2FBXA 2HBKA 2OA8A 2OCEA 5E84A 4FW2A 3PY8A 2HSTA 4JHDB 5C2DA 1V4TA 2RPIA 4DR3K 4ISGA 5AJ3K 2ASOA 1IKWA 2FF6A 3LANA 3AVKA 2P9IB 2H3GX 2OZMA 4W5TA 4M63C 1Q9YA 4QOZB 3V81A 3C95A 3SV4A 1D8YA 4CI6A 4KRFA 3ZSRA 1QE1A 3ULDA 3H6EA 1TVRA 3SLCA 2HHVA 5I42A 4DLGA 4DHYA 3T1AA 3PIPL 2PZSA 2GV9A 1U2VB 3O3HA 3DLHA 3VTIA 5CY4A 3T1HK 4ID5A 4HUEA 3O5BA 3TAGA 2GTDA 4H5RA 3MEDA 3VGKA 2G8KA 3THWA 3G25A 1KTQA 1N8RO 2W40A 4JLHA 3GG4A 3O4NA 4DR4K 5KRTA 1TL1A 5I3UA 3HK2A 3VEZA 1ATNA 4CJSA 3SJJA 4K41A 3LZJA 3M6GA 4DMNA 4MFBA 1YF5L 4HUFA 2QWMA 3KWIA 1BIZA 2P5GA 1VSJA 4JV5K 2YNFA 4W5NA 2EWSA 4RW7A 1C0FA 2HNYA 4RG8A 3SUPA 1L3UA 1WBBA 2ASMA 3AVLA 4NLCA 4O4GA 3LWMA 2P9NA 1VQLN 4AM6A 3NGYA 3SQ0A 3PSFA 2ZM6K 5AQVA 4H5VA 3TAQA 2WONA 2LSNA 4DV3K 1ASUA 4J2DA 2E2OA 3QFPA 4DWIA 5DK5A 3KLFA 5AQZA 5BN8A 3DLBA 1YT3A 3VQ7A 2W6LA 3T69A 3LAKA 4O5FA 4FL9A 1QTMA 3AAQA 2J4RA 1KD1O 3MN6A 4B9TA 4JI5K 1C0MA 3L2RA 1EKEA 4YOTA 2FXUA 2DTUA 1Y64A 1L3VA 4BRPA 3D6RA 3BP8A 1Q9XA 2ZD1A 2GX9A 4JS4A 2I7PA 5HL7L 1L3TA 4BR7A 1LAWA 3L2QA 3LDQA 3SV3A 4KHYA 2E20A 1SZ2A 5AZJA 1SS6A 1L3SA 1E3MA 4CEZA 3OYGA 1U49A 1N33K 1XC9A 5GAHP 4TSXA 3CQYA 4JRQA 5ADXH 1QSYA 4LF9K 3VPZA 4DTPA 2QWOA 3AO1A 1BA0A 4XH4A 4KFBA 4YHHK 4GV9A 1QSSA 1GLBG 4FPBA 4N56A 4IOXA 3CIPA 1HYVA 1C0UA 3EL2A 4IDHA 1M1KO 3VQAA 1LCUA 3VA3A 4CJ5A 3TSPA 3DLEA 4A62A 3EKUA 3TR8A 1X1PA 1RBTA 1LAVA 3MWTA 3AVHA 3ZX0A 3LWLA 1TKDA 1BCMA 5LY3A 1LWCA 4X62K 3KIOA 4NCBA 4DFMA 3FZKA 1CZAN 3IMXA 3UB5A 4B1YB 1HKGA 1WSJA 3I0SA 4A2AA 5KRSA 5M1QA 3DLKA 1TUUA 4FLZA 3JYTA 2BH1A 2X74A 5LJVA 3D45A 4CFCA 3K2PA 1S6QA 1OH7A 4CZLA 3VQ8A 2ZJPL 3VETA 1ITGA 4HWIA 3WNGA 1M90O 4CD1A 1HNWK 4B3SK 3WQUA 3MN5A 2F96A 2O8CA 2GUPA 1NGDA 3ENOA 3P38A 4C8NA 4O55A 3V9SA 1R59O 1JXBA 4WE1A 3MX2A 4BR0A 2ZGYA 5C42A 1OVQA 2D5RA 1TKXA 3SMPA 3HYFA 3LPUA 1S72N 3MCAB 1V4SA 5FRNA 1YVNA 3NAEA 4BRFA 2KFZA 4IZ9A 5LL6Z 2YCHA 1X9SA 2E2PA 3OYKA 3PX6A 4F2RA 4DFJA 1VAZA 3HZ6A 3KK7A 4CGJA 1QZ5A 2FLOA 2X6NA 4H5WA 4CJUA 1HLUA 4RW6A 3ZEUB 1GOBA 3V9WA 1UWBA 2VWKA 2F9WA 3HM8A 3FLCO 2UUBK 4WQ5A 4AHRA 5CHIA 3SUNA 3MXMA 1KLNA 4FJ7A 4BVOA 4I2PA 2A42A 2A1RA 1YTUA 2V7ZA 4CZFA 4BDYA 2Y1IA 5AQYA 3VQQA 3L0QA 2NZTA 1NJWA 3F5TA 4DFPA 2HHSA 1RTJA 1GLAG 4U7BA 4LSNA 4CIFA 4B1UB 1NKEA 4M3RA 3KVGA 3ZEUA 2JGUA 1XQSC 2OTLN 1HKCA 2IDOA 2NNWA 1WUAA 4MDAA 1KSPA 3RRGA 3I55N 4FJJA 3OJSA 1I3AA 2X6SA 2P9UA 3SQ2A 5FROA 5SZTA 3HM9A 1RBVA 2P9SB 3LP3A 4PL7A 1ZYQA 4MO4A 1OVYA 3ZT1A 1RT3A 4M3XA 1H1VA 1WSEA 4CHOA 2YJEA 4BGBA 3AV9A 4E19A 4CEOA 3O9UA 1J9AA 1S1TA 3OYIA 1BQNA 4K43A 3OA9A 3QETA 4B1VA 3AVNA 3HJFA 4A2BA 4OO1J 2P9PA 3OTOK 3C6TA 1ESVA 4IFEA 3ALYA 4M3UA 3PO5A 1N32K 5JVGL 3WXIA 1WNSA 3DLGA 3AA3A 4E1NA 4JAXA 4H0OA 4LF8K 3QEWA 4CJEA 1IH7A 3DXKB 3WUHA 1KQSM 4KTWA 4JKFA 2YHWA 3KHYA 2D1KA 3QERA 3ATUA 2OPPA 4CHQA 3ZETB 2HHXA 3H1VX 5DMRA 3RRHA 2RE2A 1XHXA 3NDKA 3MXIA 1TYQB 3ISNC 1J53A 4CEFA 2E2QA 3LPTA 1NWKA 2G8HA 4A61A 1DT9A 4EHTA 3UKUB 3HO1A 1GOAA 4CECA 2UUAK 4ELVA 2HVHA 4C23A 1IBLK 4KHPK 3B6OA 4BRGA 3PSIA 5CR4A 3L2WA 3M1FA 4LH5A 1TK0A 4DTMA 4ILHA 4YY3K 4FWLA 3FZHA 2R7YA 1WSGA 4BRNA 4ISFA 3E9LA 3GL1A 3QLHA 3JAMO 3O80A 4B08A 1ZXOA 2QW9A 4IFVA 3ZSWA 5M1PA 3EKSA 3QINA 3H3OB 1VSHA 4FWMA 1NGGA 4HUGA 3VF2A 4KV8A 3UIQA 3QBXA 4DR7K 4BG9A 1VRTA 3H3NO 2DPNA 3LP2A 5SWMA 3OYLA 3HSCA 4Y1CA 2FC0A 4R79A 4B9NA 1TK5A 1OH8A 4DV7K 2KKZA
chains in the Genus database with same CATH topology
4DV3K 5A2QO 1XMQK 4K0KK 4LFCK 2UUCK 4JI6K 4DR6K 4DV5K 4DV2K 3OTOK 3T1YK 4DUYK 4B3TK 4LF5K 5BR8K 4B3RK 4DV6K 4LF4K 4JI5K 2UXBK 1N32K 4LFAK 4NXMK 1J5EK 3J80O 1XNQK 4AQYK 1HR0K 4JI0K 4LF8K 3J7AP 4DV4K 3J81O 4X65K 2VQFK 1I94K 4JI4K 2UU9K 4LF7K 4DV0K 5LL6Z 4V19S 4DR3K 1FJGK 4GKJK 5AJ3K 4CVNE 4JI1K 4JI3K 4LFBK 2HHHK 1N33K 4OX9K 3J7YP 4GKKK 2UUBK 5LMNK 4LF9K 2UXDK 1N34K 4LF6K 4YHHK 4DV1K 4JI7K 5IWAK 1XMOK 2UUAK 4JI8K 5IT9O 1IBLK 3T1HK 4KHPK 4B3MK 2VQEK 5FLXO 4DR2K 4CW7B 4YY3K 4DR4K 1N36K 4X66K 4X62K 2E5LK 3JAMO 1HNXK 4DR5K 4JYAK 1HNZK 2F4VK 1IBMK 5LMUK 2UXCK 4X64K 4JV5K 4DUZK 4DR7K 1IBKK 4DR1K 4NXNK 1XNRK 1HNWK 2ZM6K 4B3SK 4JI2K 4DV7K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV3 K;  5A2Q O;  1XMQ K;  4K0K K;  4LFC K;  2UUC K;  4JI6 K;  4DR6 K;  4DV5 K;  4DV2 K;  3OTO K;  3T1Y K;  4DUY K;  4B3T K;  4LF5 K;  5BR8 K;  4B3R K;  4DV6 K;  4LF4 K;  4JI5 K;  2UXB K;  1N32 K;  4LFA K;  4NXM K;  1J5E K;  3J80 O;  1XNQ K;  4AQY K;  1HR0 K;  4JI0 K;  4LF8 K;  3J7A P;  4DV4 K;  3J81 O;  4X65 K;  2VQF K;  1I94 K;  4JI4 K;  2UU9 K;  4LF7 K;  4DV0 K;  5LL6 Z;  4V19 S;  4DR3 K;  1FJG K;  4GKJ K;  5AJ3 K;  4CVN E;  4JI1 K;  4JI3 K;  4LFB K;  2HHH K;  1N33 K;  4OX9 K;  3J7Y P;  4GKK K;  2UUB K;  5LMN K;  4LF9 K;  2UXD K;  1N34 K;  4LF6 K;  4YHH K;  4DV1 K;  4JI7 K;  5IWA K;  1XMO K;  2UUA K;  4JI8 K;  5IT9 O;  1IBL K;  3T1H K;  4KHP K;  4B3M K;  2VQE K;  5FLX O;  4DR2 K;  4CW7 B;  4YY3 K;  4DR4 K;  1N36 K;  4X66 K;  4X62 K;  2E5L K;  3JAM O;  1HNX K;  4DR5 K;  4JYA K;  1HNZ K;  2F4V K;  1IBM K;  5LMU K;  2UXC K;  4X64 K;  4JV5 K;  4DUZ K;  4DR7 K;  1IBK K;  4DR1 K;  4NXN K;  1XNR K;  1HNW K;  2ZM6 K;  4B3S K;  4JI2 K;  4DV7 K; 
#chains in the Genus database with same CATH topology
 4AHS A;  1SL1 A;  5KGW A;  1IJJ A;  3JXU A;  4KI6 A;  1HYS A;  2BE2 A;  3L8B A;  3LM2 A;  3C7N B;  3HTV A;  1QQN A;  3KK1 A;  3KKS A;  4JRP A;  4KHQ A;  3DOK A;  1S1W A;  2EX3 A;  4LFA K;  4CK1 A;  1RTH A;  2NRR A;  1NM1 A;  1JLQ A;  2G8I A;  3J7A P;  3R1X A;  3V9U A;  1NGE A;  2YNI A;  2FBV A;  1J54 A;  4V19 S;  3NVM A;  3OYA A;  3CCQ N;  3DRP A;  2PFU A;  1NK7 A;  3ZSQ A;  3HBT A;  4CGI A;  4BG8 A;  3ZSZ A;  3U4L A;  3QFU A;  3HP6 A;  3QEX A;  3E01 A;  4JKB A;  1SKR A;  2ITM A;  5M1K A;  4FWQ A;  1N34 K;  4F2S A;  4DG1 A;  3TAN A;  3OS0 A;  2O8F B;  4JHD A;  3F9M A;  3O6W A;  2HND A;  2ZGZ A;  3U8X A;  5BPM A;  1QQM A;  3D2E A;  4IBN A;  3KLH A;  3CC2 N;  3D2F B;  4XH1 A;  3VOV A;  3IFR A;  2G8V A;  3I56 N;  1Q18 A;  4H0P A;  4M3W A;  2P9K B;  3WEE A;  5EX5 A;  4YOY A;  1EP4 A;  3O1W A;  3J8A A;  5CYQ A;  3DRR A;  4KH6 A;  4AHU A;  4KTZ A;  3O3G A;  4I9Q A;  2NRV A;  4DR5 K;  1W9H A;  4W5O A;  1WSI A;  1YHQ N;  4AHT A;  4LH4 A;  5C12 A;  2GWJ A;  2O8C B;  1C0G A;  1BI4 B;  3SUQ A;  3QML A;  3NMU A;  3KK2 A;  3MX5 A;  4F4K A;  1WLJ A;  3D2F A;  4CZG A;  3DWL A;  1EXQ A;  3QNO A;  2YHY A;  1NU0 A;  3NH2 A;  3P1G A;  2RN2 A;  3CCV N;  2VYP A;  2PBD A;  3QEI A;  4BC2 A;  1RFQ A;  4N76 A;  4DB3 A;  3FGU A;  4CJR A;  3VEV A;  1NKC A;  3I33 A;  4J2A A;  1K8K A;  4WYB A;  4K0K K;  1DEJ A;  5EOY A;  3PO4 A;  4B9L A;  4QAG A;  2HHW A;  3TAB A;  3TI0 A;  1HYZ A;  3TTC A;  4DUY K;  4DF8 A;  4FK2 A;  3DRS A;  2QXF A;  2P51 A;  1QHA A;  5H1S Q;  4PY5 A;  4N5S A;  4FM2 A;  3OY9 A;  4E7L A;  5AQW A;  4K25 A;  5AQO A;  1XNQ K;  4RWT A;  4F3T A;  1NK0 A;  3G10 A;  3Q7C A;  2O8F A;  4JD2 B;  1EX4 A;  3DI6 A;  3VQ4 A;  2F8T A;  1NGJ A;  1NJI O;  3CME N;  1FJG K;  5JIC A;  3ZSV A;  3ATV A;  3VGL A;  1Q82 O;  4LFB K;  4XIU A;  3E66 A;  3R9P A;  3AA5 X;  1C1A A;  4IWV A;  1ASV A;  4C8L A;  4CE9 A;  2OAN A;  2YHX A;  3CXC M;  2HF4 A;  3GE1 A;  5C10 A;  5HRN A;  2IOC A;  3H08 A;  4JS5 A;  1NGI A;  4PKI A;  3AA2 A;  2D4W A;  4YOU A;  1VQ9 N;  1T44 A;  3ZET A;  4Z4F A;  3K5N A;  3JSM A;  4E89 A;  1VHX A;  5DM6 L;  3C6A A;  4ZHR A;  3MMV A;  2ITG A;  3LZI A;  3R6M A;  5ADX A;  3FR0 A;  4JKD A;  4CBU A;  4CJL A;  1JXE A;  1HNX K;  5GAD P;  4GV3 A;  1DTT A;  3KLI A;  3RVC A;  3CCM N;  4EP5 A;  1KAY A;  4KRE A;  4BE1 A;  1Z05 A;  3L4I A;  2IVO A;  3SPY A;  2DY4 A;  1WBD A;  1HQU A;  2EHG A;  2KTQ A;  4HTL A;  2KW4 A;  3M8R A;  4BR2 A;  2CH5 A;  4CHN A;  4G1Q A;  2D0O A;  4E1J A;  2WBN A;  5C0Y A;  3OHR A;  4F8R A;  1WOQ A;  2B5J A;  3OYF A;  4CGH A;  1KVC A;  1S1U A;  1MWM A;  4BE0 A;  1MDU B;  4CCH A;  3C6H A;  3ZSY A;  3VEW A;  5LJW A;  4HHT A;  2NRT A;  5BPL A;  5HRS A;  4RW9 A;  2HMP A;  4YNQ A;  1BIU A;  4CK3 A;  1XMQ K;  4BRC A;  3EYZ A;  2VWJ A;  3BZC A;  3B8A X;  3VQE A;  3P5J A;  5GIP A;  2B6A A;  3VQB A;  4B3T K;  2XO7 A;  4IJA A;  1W0H A;  1NGB A;  4CES A;  2X78 A;  4JEP A;  3P4I A;  2Q0R A;  4PA1 A;  5KTQ A;  1CLQ A;  4AQY K;  5KGX A;  3THY B;  4KPY A;  1N6Q A;  1EO1 A;  1RDB A;  3H46 O;  4FJ5 A;  1QS4 A;  1IG8 A;  3NBP A;  3WXK A;  4C8K A;  4DSJ A;  4CFA A;  4BDZ A;  4N41 A;  4GKJ K;  1KC8 O;  2VGM A;  4FVM A;  4ELT A;  1W97 L;  2XRI A;  2XY5 A;  2KQ2 A;  5M1N A;  1GLE G;  3JS6 A;  2GEM A;  3LM9 A;  3ZYY X;  4M7X A;  5J2M A;  1UA1 A;  4J2E A;  3V1O A;  4OX9 K;  2E8A A;  2YNG A;  5LMN K;  1GLJ O;  2D0A A;  2YJF A;  3P31 A;  1GOC A;  1VQ8 N;  3SCX A;  4U67 L;  4KBO A;  3IDH A;  4O44 A;  3MK6 A;  2O8D B;  3PLA A;  3S3N A;  3O9Q A;  1D9F A;  2FF3 B;  4CFB A;  4CZE A;  1YI2 N;  4YOV A;  2V52 B;  2NRZ A;  3SPZ A;  4CW7 B;  1KAZ A;  2P9N B;  5GAE P;  3CET A;  3GDQ A;  2Z1H A;  1QZ6 A;  4I2Q A;  3THX B;  2NRX A;  4DQR A;  1SAZ A;  4JNE A;  5AFU H;  2P9P B;  5AQR A;  4YOX A;  5C15 A;  1U2V A;  3WNE A;  3U6F A;  4B9M A;  3HT3 A;  4Q5V A;  4FLY A;  4KTQ A;  1A5V A;  1EQY A;  5J2Q A;  3L3V A;  1RIL A;  1SKW A;  1S9G A;  2P9K A;  3TU5 A;  3WEE B;  4W5R A;  1U4B A;  5BRH A;  1VQK N;  3CPE A;  3K5O A;  3PV8 A;  1RDW X;  1SL2 A;  5HRP A;  3FZL A;  3QO9 A;  3L2U A;  1LV5 A;  3K59 A;  1MA9 B;  4IG3 A;  2UUC K;  1BI4 A;  3S9H A;  3NCI A;  4DR6 K;  4O0I A;  2OPS A;  3M8S A;  4FO0 A;  3WNF A;  5JS1 A;  3KD1 E;  1JCE A;  3ZCM A;  3ZT0 A;  4LF4 K;  3PX4 A;  3CHW A;  1SV5 A;  3I8B A;  4FWP A;  4M3T A;  4B9U A;  4H0Y B;  2CH6 A;  4NYF A;  5BPN A;  1VRU A;  5KPT A;  4FWO A;  3ZSO A;  2KLA A;  4B1Z A;  3FZF A;  3J81 O;  2DFH A;  1I94 K;  1VQM N;  3N4P A;  1RTD A;  3IG1 A;  4F3O A;  4UQG A;  4Z4E A;  3SZ2 A;  3O9R A;  4BRO A;  5HRR A;  1TAU A;  1WAJ A;  1HJO A;  2VWB A;  1QQO A;  1JLE A;  2AJQ A;  3D0P A;  4DTO A;  4PL8 A;  2WFB A;  2OPR A;  1J6Z A;  2F8S A;  1IV0 A;  4GKK K;  4OLB A;  3NH0 A;  5JS2 A;  4CFD A;  2NRW A;  4HCB A;  4CHP A;  1O1W A;  5FPM A;  3AAR A;  3CJ7 A;  3O4W A;  4CF9 A;  3OYJ A;  3NF8 A;  1UA0 A;  1YIJ N;  5AQG A;  3MWP A;  5AZJ B;  3VEO A;  3SAF A;  1T05 A;  4E0D A;  5IT9 O;  1S5J A;  4DU1 A;  5JVH L;  1HPM A;  3QNN A;  4M42 A;  4CJ4 A;  2QEX N;  1Z26 A;  5D3G A;  2HBM A;  3CC7 N;  3K5L A;  4BRI A;  3QES A;  4JYA K;  3CC4 N;  1TAQ A;  4OJR A;  4FJI A;  4E7J A;  3NGI A;  2PY5 A;  1RT1 A;  3AAP A;  4CJF A;  1RT6 A;  1TL3 A;  1VQN N;  2O8D A;  4RCH A;  3DLL L;  4DUZ K;  4M41 A;  1W7A A;  1JCF A;  1U45 A;  1IKY A;  1ZBU A;  3OW2 M;  3ENB A;  5CZ1 A;  4G9Z A;  3VEX A;  1KFS A;  4BR4 A;  1Z25 A;  5GIN A;  2XHB A;  5J2P A;  5AQK A;  3R3L A;  1TKT A;  3M5R A;  2WOM A;  2NUB A;  5AQT A;  3C0B A;  3O9T A;  2RHK A;  2HNZ A;  3G0Z A;  3HST B;  2VG5 A;  2ZJQ L;  4I6M B;  3KZB A;  2ETJ A;  3HRG A;  4JI6 K;  3QDK A;  3VF4 A;  4BRM A;  4DV2 K;  1BA1 A;  3CQ8 A;  2AA4 A;  4AIL C;  1UOC A;  3IRX A;  1U48 A;  3QIO A;  4MDB A;  3CCR N;  1J5E K;  4C1N I;  3S41 A;  1IG9 A;  4FJ8 A;  1NGH A;  3N4Q A;  1XUP O;  4DSK A;  4CBW A;  3QEP A;  2AP1 A;  4ELU A;  1JLC A;  2KZZ A;  4I6M A;  3SNN A;  4BQL A;  3CQX A;  3LDL A;  3H45 C;  4WF9 L;  3HPG A;  4LY7 A;  1YJN N;  5AQQ A;  5E41 A;  1K6Y A;  4DS5 A;  1IO2 A;  4CJ7 A;  5AQI A;  3VEN A;  3WT0 A;  4GW6 A;  3NHG A;  4E7H A;  4BAC A;  4GV6 A;  5AR0 A;  4C8O A;  4A57 A;  1VSL A;  4DS4 A;  4H4O A;  5CYM A;  4IFY A;  1XMO K;  2A40 A;  1TKZ A;  2ZQB A;  1BGX T;  5AFU A;  3DXM B;  3E9P A;  3PX0 A;  1HKB A;  3VQC A;  5CE3 A;  1OH6 A;  2VQE K;  1J5O A;  4JK7 A;  2JLE A;  1Q86 O;  5BRE A;  3EE8 A;  2IGI A;  1NGA A;  4WFB L;  3MN7 A;  3CFR A;  1VQ6 N;  2E5L K;  5AQN A;  4QCL A;  2QWN A;  3L4Q A;  3OYC A;  4ID1 A;  1FK9 A;  2F4V K;  1Q81 O;  3CM6 A;  4CBX A;  2E88 A;  2ZWH A;  4ZTF A;  1NJZ A;  5LMU K;  3P83 D;  5M1O A;  4IEI A;  1GLC G;  3NVK A;  3CMA N;  1BQM A;  2A3Z A;  4L8R B;  1S1V A;  3ZT3 A;  4FJH A;  1DGK N;  1RCH A;  4ZTJ A;  1A5W A;  4CJW A;  4FCY A;  2HF3 A;  4BWM A;  5AQH A;  5JLF A;  3AVG A;  2PYL A;  4CF8 A;  3LP1 A;  3TAR A;  1XWL A;  1YJ9 N;  2O8E B;  1KAX A;  3HPO A;  3A0I X;  3ZSX A;  2P9S A;  4Z4H A;  3AGR A;  4CEE A;  4N47 A;  1FXX A;  2QTD A;  1YUW A;  3O8M A;  4H5N A;  5FPN A;  2IS3 A;  3CI5 A;  3MCP A;  4BRQ A;  5C25 A;  1MU2 A;  1TYQ A;  3OYB A;  4O5B A;  1VQO N;  3B6P A;  1UAX A;  1NBW A;  4DQQ A;  1HR0 K;  4MO5 A;  4X65 K;  3LDP A;  3ASM A;  5MLC Q;  4LF7 K;  3SMS A;  4CZM A;  4NB4 A;  5FPE A;  1BG3 A;  2Q0U A;  2Q2R A;  2P9L B;  4CF0 A;  4EZ9 A;  4OGC A;  3S3M A;  4JI1 K;  3U3Y A;  4GY2 B;  4B8C A;  2ZF5 O;  4DF4 A;  1CXQ A;  2W41 A;  3AVA A;  4IG0 A;  4Z94 A;  1X3N A;  4XH5 A;  4CF2 A;  4DTJ A;  2A1S A;  3TAE A;  3IS9 A;  4KHN A;  1RT4 A;  3G71 N;  3CCJ N;  1X3M A;  3E9O A;  4FYD A;  2GBZ A;  3KLG A;  2ZJR L;  4OGE A;  2VCP A;  1JJ2 M;  1TK8 A;  2G8W A;  1FW6 A;  4B9Q A;  3VA0 A;  3V9Z A;  2WTU A;  3OYN A;  2YKN A;  4FJ9 A;  1Q8I A;  1RBU A;  5AZI A;  5HP1 A;  3LDN A;  1LWE A;  1HNI A;  1F21 A;  3RWU A;  2E6M A;  4E3S A;  3HVR A;  4C1N K;  3ZT4 A;  3C65 A;  4CF1 A;  4DSI A;  1HNZ K;  4QS8 A;  3HXM A;  5JLH A;  3UKU A;  3OYE A;  2DFF A;  5F1X A;  2PAV A;  4EHU A;  3C7N A;  2HOE A;  1NMD A;  1TUY A;  1VSE A;  3AVM A;  5F0X A;  3HL8 A;  4LSL A;  4KB0 A;  4CJ3 A;  4FK4 A;  5AQM A;  3CG7 A;  1BWF O;  2V51 B;  3NF6 A;  3EE9 A;  4NXN K;  5AQU A;  4CD3 A;  1BCO A;  3RTV A;  1Y97 A;  4FLV A;  2HMI A;  2XY8 A;  2OZS A;  4CEA A;  4C8M A;  5EU7 A;  3E1Y A;  3VN5 A;  4BRA A;  3TTF A;  4QS7 A;  3RMD A;  1JLA A;  2BGG A;  5AQP A;  1VSF A;  4JN4 A;  3LDO A;  4KHW A;  4NXM K;  1RBR A;  4GVM A;  4FVU A;  1HPZ A;  2VGN A;  3RSE A;  2P5O A;  3DM2 A;  3CCU N;  1NJX A;  3PIO L;  2G8U A;  1HUX A;  4DKW A;  5T7B A;  3WNH A;  4JI4 K;  3CJ1 A;  4DV0 K;  4IOC L;  3OS2 A;  3SBT A;  4R5P A;  2GWK A;  5AQJ A;  1BL3 A;  4PKH A;  3CJC A;  4WFA L;  3DXM A;  4HCC A;  3VES A;  4BDP A;  4MLH A;  2FSN A;  3THW B;  4O8K A;  4HTU A;  4IO9 L;  3CJ9 A;  5BRF A;  4Z4C A;  3A8Y A;  2YHA A;  5ELZ A;  4KO0 A;  1L5U A;  3RSE B;  3ULE B;  4Z4G A;  4MQ3 A;  3C6U A;  2A41 A;  2E4L A;  4KHS A;  3AA4 A;  3KWG A;  4M3Z A;  3I8D A;  1JLG A;  1ASW A;  4B3O A;  4AM7 A;  3EZ5 A;  1GLL O;  1D9D A;  4IJN A;  4J2B A;  4IO8 A;  4JKE A;  4BGA A;  4WFN L;  4FLU A;  3ID6 A;  5I9E B;  1NK9 A;  2BTF A;  3Q7B A;  4GMJ B;  1BOT O;  4X66 K;  2NRH A;  2Q1N A;  4CED A;  3HOT A;  4CHY A;  3T19 A;  3SK3 A;  1P90 A;  5EXW A;  3W3D A;  1LWF A;  4DLE A;  3P39 A;  4AHV A;  2VG7 A;  3BY5 A;  5B8H A;  4B9S A;  2FSK A;  4JKG B;  5EVZ A;  3VEY A;  3MEC A;  4EAH D;  2XY6 A;  1XHZ A;  4BC5 A;  3DLR A;  3VMF B;  1HRH A;  4E1M A;  1W2B M;  3KKR A;  3O08 A;  4OPK A;  5KQD A;  2WUS A;  2QI2 A;  4AF1 A;  3SYZ A;  3NH1 A;  3SAG A;  3BF3 A;  3TWH A;  1EET A;  4FSV A;  4IEE A;  2Q97 A;  2IIR A;  1RDA A;  2W42 A;  3D7E O;  4BR5 A;  4RW8 A;  4ISE A;  4H0T B;  4CEQ A;  4E7K A;  2HB5 A;  4JKH A;  4OPA A;  4CJQ A;  1HNV A;  2JWK A;  3MEE A;  3M8P A;  4F9O A;  3VQ9 A;  4M7Y A;  2QXL A;  1JCG A;  4DTS A;  3D2E B;  3TTD A;  3CER A;  3MAQ A;  1KXP A;  1ATS A;  3R8E A;  3VQ6 A;  1JL1 A;  1SQK A;  3LAL A;  1ZBI A;  1VSI A;  1HMV A;  3THX A;  4WQ5 C;  3GOI A;  2CGK A;  3DOL A;  2D0P A;  4BRH A;  5KPR A;  1TGO A;  2P9U B;  3UE5 A;  1RBS A;  3SBG A;  4YDU A;  5DM7 L;  2QA4 N;  4JI7 K;  3K9K A;  3CCS N;  1RT2 A;  3CM5 A;  3TPQ A;  3OYM A;  1JKH A;  1RGI A;  1DLO A;  5KQ8 A;  4CJT A;  1NK6 A;  3RMC A;  1T6C A;  2KFN A;  2V7Y A;  1C0T A;  2Z1G A;  3BUZ B;  1T6D A;  1LW0 A;  1WN7 A;  3O3F A;  1GLD G;  3QIP A;  1IBM K;  5J2N A;  1X9J A;  3MDQ A;  1Z6R A;  3MXJ A;  1VK0 A;  3HP9 A;  4JK8 A;  5TKY A;  4DQI A;  4OKE A;  1IBK K;  2G8F A;  1YAG A;  4BRK A;  4JK9 A;  1G99 A;  3AO4 A;  3A5M C;  1DTQ A;  2P1J A;  2QWP A;  4BRL A;  4YFU A;  5AQF A;  1K8A O;  3T1Y K;  4CGD A;  3WQT A;  5BR8 K;  4LF5 K;  2PYJ A;  1YIT N;  4B3R K;  4DV6 K;  4M45 A;  1ZBS A;  1QSL A;  4KHU A;  1E4F T;  2FBY A;  1VSM A;  4DQP A;  3J80 O;  3IUC A;  4PQU A;  1NKB A;  3U9Z A;  4WCE L;  1SUQ A;  3O9S A;  4FZX C;  2HVI A;  4KAZ A;  3QIC A;  3G4S N;  2RKI A;  2UU9 K;  3BEX A;  4CZJ A;  1KRP A;  2D0C A;  4IDK A;  4OPH A;  4K8Z A;  4CVN E;  1BUP A;  3LDS A;  4AH9 A;  3CYM A;  1HX1 A;  4FJL A;  2HHH K;  1WSF A;  3HPH A;  2JWL A;  3S3O A;  2OPQ A;  3FFK B;  1XC3 A;  3NFA A;  1X9M A;  3J7Y P;  1OKJ A;  2Z1I A;  4DU3 A;  5TKW A;  4DQ8 A;  1B92 A;  3THY A;  1IKV A;  1RT7 A;  3LP0 A;  4FJK A;  3GBT A;  4CHZ A;  4PHT X;  3KD5 E;  3DMJ A;  5K14 A;  4DU4 A;  4DSL A;  3UKR B;  3KJV A;  5C24 A;  4JI8 K;  2QKK A;  3EZW A;  4FK0 A;  2OYQ A;  1EWQ A;  2QWQ A;  4JKG A;  4FXD A;  1TV6 A;  2YHB A;  1YVU A;  4CZI A;  4O0J A;  1QVF M;  3CFO A;  2E6L A;  3AVB A;  3RMB A;  5J1E A;  1GLF O;  4BE2 A;  1T7P A;  1O13 A;  1BU6 O;  3IKM A;  3L6Q A;  3RR8 A;  4HVJ A;  3SI6 A;  2F7T A;  3T7Z A;  2UXC K;  4BC4 A;  3UKR A;  3OYH A;  4M3Y A;  4O8U A;  2E1Y A;  2F9T A;  1KLM A;  5AZI B;  3U9D A;  3NGZ A;  5FRM A;  3OBY A;  2O4I A;  2ASP A;  1NGC A;  5FPD A;  2HBJ A;  1IKX A;  2DFE A;  4JKC A;  4B1W B;  4BR9 A;  1C6V A;  3DXK A;  3CD6 N;  5A2Q O;  5AQS A;  2Q36 A;  3O1B A;  4KKO A;  3ZX2 A;  3NE6 A;  4B9V A;  4MLE A;  3WXL A;  3SAH A;  2OTJ N;  1HQE A;  1B9D A;  3TSU A;  4FM0 A;  1CXU A;  1QVG M;  1WAF A;  3OYD A;  3F73 A;  4EP4 A;  1ZBF A;  3CCL N;  1C1B A;  3TAP A;  3ITH A;  3TSQ A;  2VQF K;  3C94 A;  2E2N A;  4W5Q A;  4OLA A;  2A5X A;  3RR7 A;  4H5T A;  3CJB A;  4JI3 K;  3V4I A;  3VGM A;  4Z0U A;  4CER A;  2HW3 A;  4H03 B;  3I0R A;  1FKP A;  2QKB A;  4FJM A;  2B4J A;  4IKF A;  4UY8 O;  3VTH A;  4EIA A;  1NK8 A;  3F2K A;  4GVE A;  1ILY A;  5BR9 A;  1NMN A;  3EN9 A;  1NJY A;  4LF6 K;  5C2F A;  4CIE A;  5IWA K;  4BC3 A;  3FE1 A;  5AQX A;  1RTI A;  4B3M K;  4FLW A;  1NG9 A;  3AGK A;  4KI4 A;  4WQ4 C;  5BN9 A;  4IXC A;  1N5Y A;  1N36 K;  4FPA A;  2HHU A;  1NLV A;  3W0L A;  1XI1 A;  1RDU A;  4WQ4 A;  1K9M O;  3DYA A;  4FOI A;  1S9E A;  2D0B A;  4E7I A;  3V1R A;  3EO3 A;  5BRD A;  2O8E A;  4NCA A;  4A5A A;  2CGJ A;  2IVP A;  4Y1D A;  1QHT A;  2HHQ A;  5HLF A;  1A5X A;  2I7N A;  2UYT A;  5AQL A;  2XY7 A;  4BQZ A;  1WB9 A;  1JLF A;  3F9K A;  3AO5 A;  4BVP A;  1ZC6 A;  4CZK A;  3SQ1 A;  1D4X A;  3CJA A;  3V9X A;  1YXQ A;  3VQ5 A;  3CPW M;  3VER A;  4JI2 K;  4Q0B A;  3QEV A;  4NO7 A;  3THV A;  3TAF A;  2IAJ A;  4Z4I A;  2YNH A;  2Q3S A;  3ENH A;  3AO3 A;  1S6P A;  2BAN A;  3K58 A;  1G15 A;  4DV5 K;  3K5M A;  5HRO A;  1LW2 A;  3A2F A;  4CGG A;  2QM1 A;  1T03 A;  2Z1J A;  5GAG P;  4PWD A;  1RNH A;  1SKS A;  2ATQ A;  3ZLJ A;  5GIO A;  4YOW A;  4JKA A;  3FFI A;  2FBT A;  4FZY A;  2BUP A;  1VQ7 N;  1KVB A;  2KZM A;  1RDC A;  3NF7 A;  1NNE A;  1OH5 A;  3VF6 A;  3AVI A;  1CZB A;  4ICL A;  2O4G A;  4Y0W A;  4NLB A;  3H1Q A;  5CZ2 A;  3BZK A;  4FOE A;  1ATR A;  1NK5 A;  3AVC A;  1BDG A;  4CZH A;  3KK3 A;  3LAM A;  4YDU C;  1VQP N;  4FWN A;  4FM1 A;  5E26 A;  4FLT A;  1SL0 A;  3O4Q A;  3PUF A;  3T3F A;  4H0X B;  2UXD K;  3HI0 A;  2BDP A;  1VSD A;  3AY9 A;  3BGR A;  2GEL A;  4KB1 A;  4OVL A;  4DV1 K;  3ZT2 A;  1NGF A;  1U6Z A;  4FWS A;  4CGF A;  5HBM A;  1VQ4 N;  2QWR A;  1REV A;  3OS1 A;  5KI6 A;  3K9J A;  3U3G A;  2GUI A;  1BHL A;  4OKJ A;  4DTN A;  1Q7Y O;  4FLX A;  4FJX A;  4FZZ A;  1VSK A;  3CF5 L;  4ILJ A;  1R0A A;  2RF2 A;  4B1X B;  1QQC A;  2IC3 A;  1LOT B;  1P8Z A;  1K8K B;  1S1X A;  2A6A A;  3WXJ A;  4NYN A;  4X64 K;  4RW4 A;  2E1Z A;  4CJP A;  2HBL A;  4NCG A;  4CEB A;  1S3X A;  5JMV A;  1U47 A;  4H8K A;  4J8F A;  2WC9 A;  4A5B A;  3DAW A;  1MWK A;  3A5O C;  2HHT A;  4BRE A;  2YKM A;  4OKK A;  4FW1 A;  3HOS A;  5EY4 A;  2Y1J A;  3IAY A;  4PUO A;  4DCH A;  1EWR A;  4JD2 A;  2VG6 A;  4FWR A;  3A5N C;  1HJR A;  4FWK A;  4LD0 A;  4LFC K;  2O8B A;  4OPJ A;  3AO2 A;  4PKG A;  2NLX A;  3M3Z A;  5FDL A;  1K73 O;  3QB0 A;  3A5L C;  4DFK A;  3M8Q A;  4DQS A;  3MN9 A;  2UXB K;  2IVN A;  1CZ9 A;  3FZM A;  4DTU A;  4FJN A;  3ID8 A;  4JI0 K;  3ULE A;  2CGL A;  4AHC A;  3OJU A;  4DV4 K;  3SJH A;  4LC9 B;  1YJW N;  3AVJ A;  3KLE A;  3TAM A;  1BO5 O;  2O8B B;  1ZBL A;  3OBW A;  4BY9 C;  3NF9 A;  4DTR A;  3EEQ A;  3G6E N;  3L2V A;  5M1F A;  4CJK A;  1NOY A;  4A59 A;  4H4M A;  3RMA A;  4B8A B;  4YOR A;  4I9L A;  1RDD A;  3L3U A;  2Q31 A;  4EFH A;  4RTF D;  3CFP A;  1NOZ A;  2I5J A;  1WSH A;  4CIG A;  3V6D A;  3BDP A;  1I39 A;  1T8E A;  2YV0 X;  1DKG D;  4ILG B;  5FLX O;  4DR2 K;  4DSF A;  5KPZ A;  1JL2 A;  3VQP A;  3SUO A;  4DTX A;  3CCE N;  1S22 A;  2W6K A;  4GNI A;  2KHO A;  1RT5 A;  4CJV A;  3BF1 A;  1NK4 A;  3QBW A;  1U04 A;  3ZX3 A;  3SQ4 A;  3HVT A;  2QWL A;  2YI1 A;  3VQD A;  1KCF A;  4L3Q A;  4I7F A;  1X9W A;  1KFD A;  4BRD A;  4IOA L;  4QS9 A;  3OVN A;  4KH4 A;  2ZE2 A;  4DR1 K;  3DJC A;  3V1Q A;  1D5A A;  1ZBH A;  1XNR K;  3KTQ A;  5HOO A;  1T3V A;  2FSJ A;  1YTA A;  4K42 A;  4EZ6 A;  1KVA A;  3AVF A;  1E4G T;  1JLB A;  3EY1 A;  3MEG A;  4XEI A;  1VQ5 N;  3K0S A;  2P9L A;  2YX6 A;  3WXM B;  1FKO A;  1BIS A;  3LL3 A;  4FJG A;  4K8X A;  2P9I A;  4DSE A;  4KH5 A;  4BWJ A;  2QK9 A;  3K57 A;  1C1C A;  5F2R A;  4CK2 A;  3J7Z O;  1B9F A;  4H0V B;  2FBX A;  2HBK A;  2OA8 A;  2OCE A;  5E84 A;  4FW2 A;  3PY8 A;  2HST A;  4JHD B;  5C2D A;  1V4T A;  2RPI A;  4DR3 K;  4ISG A;  5AJ3 K;  2ASO A;  1IKW A;  2FF6 A;  3LAN A;  3AVK A;  2P9I B;  2H3G X;  2OZM A;  4W5T A;  4M63 C;  1Q9Y A;  4QOZ B;  3V81 A;  3C95 A;  3SV4 A;  1D8Y A;  4CI6 A;  4KRF A;  3ZSR A;  1QE1 A;  3ULD A;  3H6E A;  1TVR A;  3SLC A;  2HHV A;  5I42 A;  4DLG A;  4DHY A;  3T1A A;  3PIP L;  2PZS A;  2GV9 A;  1U2V B;  3O3H A;  3DLH A;  3VTI A;  5CY4 A;  3T1H K;  4ID5 A;  4HUE A;  3O5B A;  3TAG A;  2GTD A;  4H5R A;  3MED A;  3VGK A;  2G8K A;  3THW A;  3G25 A;  1KTQ A;  1N8R O;  2W40 A;  4JLH A;  3GG4 A;  3O4N A;  4DR4 K;  5KRT A;  1TL1 A;  5I3U A;  3HK2 A;  3VEZ A;  1ATN A;  4CJS A;  3SJJ A;  4K41 A;  3LZJ A;  3M6G A;  4DMN A;  4MFB A;  1YF5 L;  4HUF A;  2QWM A;  3KWI A;  1BIZ A;  2P5G A;  1VSJ A;  4JV5 K;  2YNF A;  4W5N A;  2EWS A;  4RW7 A;  1C0F A;  2HNY A;  4RG8 A;  3SUP A;  1L3U A;  1WBB A;  2ASM A;  3AVL A;  4NLC A;  4O4G A;  3LWM A;  2P9N A;  1VQL N;  4AM6 A;  3NGY A;  3SQ0 A;  3PSF A;  2ZM6 K;  5AQV A;  4H5V A;  3TAQ A;  2WON A;  2LSN A;  4DV3 K;  1ASU A;  4J2D A;  2E2O A;  3QFP A;  4DWI A;  5DK5 A;  3KLF A;  5AQZ A;  5BN8 A;  3DLB A;  1YT3 A;  3VQ7 A;  2W6L A;  3T69 A;  3LAK A;  4O5F A;  4FL9 A;  1QTM A;  3AAQ A;  2J4R A;  1KD1 O;  3MN6 A;  4B9T A;  4JI5 K;  1C0M A;  3L2R A;  1EKE A;  4YOT A;  2FXU A;  2DTU A;  1Y64 A;  1L3V A;  4BRP A;  3D6R A;  3BP8 A;  1Q9X A;  2ZD1 A;  2GX9 A;  4JS4 A;  2I7P A;  5HL7 L;  1L3T A;  4BR7 A;  1LAW A;  3L2Q A;  3LDQ A;  3SV3 A;  4KHY A;  2E20 A;  1SZ2 A;  5AZJ A;  1SS6 A;  1L3S A;  1E3M A;  4CEZ A;  3OYG A;  1U49 A;  1N33 K;  1XC9 A;  5GAH P;  4TSX A;  3CQY A;  4JRQ A;  5ADX H;  1QSY A;  4LF9 K;  3VPZ A;  4DTP A;  2QWO A;  3AO1 A;  1BA0 A;  4XH4 A;  4KFB A;  4YHH K;  4GV9 A;  1QSS A;  1GLB G;  4FPB A;  4N56 A;  4IOX A;  3CIP A;  1HYV A;  1C0U A;  3EL2 A;  4IDH A;  1M1K O;  3VQA A;  1LCU A;  3VA3 A;  4CJ5 A;  3TSP A;  3DLE A;  4A62 A;  3EKU A;  3TR8 A;  1X1P A;  1RBT A;  1LAV A;  3MWT A;  3AVH A;  3ZX0 A;  3LWL A;  1TKD A;  1BCM A;  5LY3 A;  1LWC A;  4X62 K;  3KIO A;  4NCB A;  4DFM A;  3FZK A;  1CZA N;  3IMX A;  3UB5 A;  4B1Y B;  1HKG A;  1WSJ A;  3I0S A;  4A2A A;  5KRS A;  5M1Q A;  3DLK A;  1TUU A;  4FLZ A;  3JYT A;  2BH1 A;  2X74 A;  5LJV A;  3D45 A;  4CFC A;  3K2P A;  1S6Q A;  1OH7 A;  4CZL A;  3VQ8 A;  2ZJP L;  3VET A;  1ITG A;  4HWI A;  3WNG A;  1M90 O;  4CD1 A;  1HNW K;  4B3S K;  3WQU A;  3MN5 A;  2F96 A;  2O8C A;  2GUP A;  1NGD A;  3ENO A;  3P38 A;  4C8N A;  4O55 A;  3V9S A;  1R59 O;  1JXB A;  4WE1 A;  3MX2 A;  4BR0 A;  2ZGY A;  5C42 A;  1OVQ A;  2D5R A;  1TKX A;  3SMP A;  3HYF A;  3LPU A;  1S72 N;  3MCA B;  1V4S A;  5FRN A;  1YVN A;  3NAE A;  4BRF A;  2KFZ A;  4IZ9 A;  5LL6 Z;  2YCH A;  1X9S A;  2E2P A;  3OYK A;  3PX6 A;  4F2R A;  4DFJ A;  1VAZ A;  3HZ6 A;  3KK7 A;  4CGJ A;  1QZ5 A;  2FLO A;  2X6N A;  4H5W A;  4CJU A;  1HLU A;  4RW6 A;  3ZEU B;  1GOB A;  3V9W A;  1UWB A;  2VWK A;  2F9W A;  3HM8 A;  3FLC O;  2UUB K;  4WQ5 A;  4AHR A;  5CHI A;  3SUN A;  3MXM A;  1KLN A;  4FJ7 A;  4BVO A;  4I2P A;  2A42 A;  2A1R A;  1YTU A;  2V7Z A;  4CZF A;  4BDY A;  2Y1I A;  5AQY A;  3VQQ A;  3L0Q A;  2NZT A;  1NJW A;  3F5T A;  4DFP A;  2HHS A;  1RTJ A;  1GLA G;  4U7B A;  4LSN A;  4CIF A;  4B1U B;  1NKE A;  4M3R A;  3KVG A;  3ZEU A;  2JGU A;  1XQS C;  2OTL N;  1HKC A;  2IDO A;  2NNW A;  1WUA A;  4MDA A;  1KSP A;  3RRG A;  3I55 N;  4FJJ A;  3OJS A;  1I3A A;  2X6S A;  2P9U A;  3SQ2 A;  5FRO A;  5SZT A;  3HM9 A;  1RBV A;  2P9S B;  3LP3 A;  4PL7 A;  1ZYQ A;  4MO4 A;  1OVY A;  3ZT1 A;  1RT3 A;  4M3X A;  1H1V A;  1WSE A;  4CHO A;  2YJE A;  4BGB A;  3AV9 A;  4E19 A;  4CEO A;  3O9U A;  1J9A A;  1S1T A;  3OYI A;  1BQN A;  4K43 A;  3OA9 A;  3QET A;  4B1V A;  3AVN A;  3HJF A;  4A2B A;  4OO1 J;  2P9P A;  3OTO K;  3C6T A;  1ESV A;  4IFE A;  3ALY A;  4M3U A;  3PO5 A;  1N32 K;  5JVG L;  3WXI A;  1WNS A;  3DLG A;  3AA3 A;  4E1N A;  4JAX A;  4H0O A;  4LF8 K;  3QEW A;  4CJE A;  1IH7 A;  3DXK B;  3WUH A;  1KQS M;  4KTW A;  4JKF A;  2YHW A;  3KHY A;  2D1K A;  3QER A;  3ATU A;  2OPP A;  4CHQ A;  3ZET B;  2HHX A;  3H1V X;  5DMR A;  3RRH A;  2RE2 A;  1XHX A;  3NDK A;  3MXI A;  1TYQ B;  3ISN C;  1J53 A;  4CEF A;  2E2Q A;  3LPT A;  1NWK A;  2G8H A;  4A61 A;  1DT9 A;  4EHT A;  3UKU B;  3HO1 A;  1GOA A;  4CEC A;  2UUA K;  4ELV A;  2HVH A;  4C23 A;  1IBL K;  4KHP K;  3B6O A;  4BRG A;  3PSI A;  5CR4 A;  3L2W A;  3M1F A;  4LH5 A;  1TK0 A;  4DTM A;  4ILH A;  4YY3 K;  4FWL A;  3FZH A;  2R7Y A;  1WSG A;  4BRN A;  4ISF A;  3E9L A;  3GL1 A;  3QLH A;  3JAM O;  3O80 A;  4B08 A;  1ZXO A;  2QW9 A;  4IFV A;  3ZSW A;  5M1P A;  3EKS A;  3QIN A;  3H3O B;  1VSH A;  4FWM A;  1NGG A;  4HUG A;  3VF2 A;  4KV8 A;  3UIQ A;  3QBX A;  4DR7 K;  4BG9 A;  1VRT A;  3H3N O;  2DPN A;  3LP2 A;  5SWM A;  3OYL A;  3HSC A;  4Y1C A;  2FC0 A;  4R79 A;  4B9N A;  1TK5 A;  1OH8 A;  4DV7 K;  2KKZ A; 
#chains in the Genus database with same CATH homology
 4DV3 K;  5A2Q O;  1XMQ K;  4K0K K;  4LFC K;  2UUC K;  4JI6 K;  4DR6 K;  4DV5 K;  4DV2 K;  3OTO K;  3T1Y K;  4DUY K;  4B3T K;  4LF5 K;  5BR8 K;  4B3R K;  4DV6 K;  4LF4 K;  4JI5 K;  2UXB K;  1N32 K;  4LFA K;  4NXM K;  1J5E K;  3J80 O;  1XNQ K;  4AQY K;  1HR0 K;  4JI0 K;  4LF8 K;  3J7A P;  4DV4 K;  3J81 O;  4X65 K;  2VQF K;  1I94 K;  4JI4 K;  2UU9 K;  4LF7 K;  4DV0 K;  5LL6 Z;  4V19 S;  4DR3 K;  1FJG K;  4GKJ K;  5AJ3 K;  4CVN E;  4JI1 K;  4JI3 K;  4LFB K;  2HHH K;  1N33 K;  4OX9 K;  3J7Y P;  4GKK K;  2UUB K;  5LMN K;  4LF9 K;  2UXD K;  1N34 K;  4LF6 K;  4YHH K;  4DV1 K;  4JI7 K;  5IWA K;  1XMO K;  2UUA K;  4JI8 K;  5IT9 O;  1IBL K;  3T1H K;  4KHP K;  4B3M K;  2VQE K;  5FLX O;  4DR2 K;  4CW7 B;  4YY3 K;  4DR4 K;  1N36 K;  4X66 K;  4X62 K;  2E5L K;  3JAM O;  1HNX K;  4DR5 K;  4JYA K;  1HNZ K;  2F4V K;  1IBM K;  5LMU K;  2UXC K;  4X64 K;  4JV5 K;  4DUZ K;  4DR7 K;  1IBK K;  4DR1 K;  4NXN K;  1XNR K;  1HNW K;  2ZM6 K;  4B3S K;  4JI2 K;  4DV7 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...