4OX9K

Crystal structure of the aminoglycoside resistance methyltransferase npma bound to the 30s ribosomal subunit
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular recognition and modification of the 30S ribosome by the aminoglycoside-resistance methyltransferase NpmA.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 30
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2014-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4ox9K00
2UU9K 4JI0K 4B3MK 2UUCK 4AQYK 4GKKK 4DR4K 1IBKK 4DV7K 3J7YP 1IBLK 4V19S 4X62K 4X65K 5LMNK 4LF6K 2UXCK 4JI7K 4JI2K 5LL6Z 1N36K 4X66K 3T1YK 3JAMO 2VQEK 4JI1K 3J81O 1N32K 2E5LK 4JYAK 4K0KK 4DR6K 1HR0K 1XMQK 1FJGK 2VQFK 4DV2K 4DV4K 3J7AP 4DUYK 4DR3K 2UUAK 5A2QO 4DV0K 5BR8K 1I94K 4JI8K 4LFAK 4LFCK 4LF9K 4DV3K 2ZM6K 4DUZK 4DR5K 1XNRK 4X64K 4GKJK 4KHPK 4JI6K 4LF8K 3J80O 4B3SK 4DR1K 3OTOK 2UXBK 4JI5K 5FLXO 1HNWK 4YHHK 4B3RK 1J5EK 5IT9O 4LFBK 1IBMK 2UUBK 4LF7K 4OX9K 4NXNK 3T1HK 5IWAK 4DR2K 5LMUK 4CVNE 1HNZK 4B3TK 4DV5K 4DV6K 4JI3K 4JV5K 4DR7K 4DV1K 1XMOK 4NXMK 4LF4K 4JI4K 4YY3K 1XNQK 1N34K 2UXDK 5AJ3K 4CW7B 1N33K 2HHHK 4LF5K 2F4VK 1HNXK
chains in the Genus database with same CATH superfamily
1S5JA 3CQXA 4CJRA 4CF0A 2O8EA 1RTJA 1T44A 5FRMA 3SK3A 1TV6A 1D8YA 3FZKA 1IBLK 2ETJA 2A41A 2DFFA 4CF2A 4X62K 3PV8A 4CHPA 4CF8A 5GIPA 3LDNA 1VQNN 1IJJA 4CHYA 4GV3A 2V7ZA 4CZFA 1NGHA 3OJUA 1JJ2M 4ELTA 4B3OA 1NGBA 1X9MA 4BRGA 1NU0A 3CJ7A 4B1ZA 4BGAA 1W2BM 2CH6A 3CHWA 3IRXA 1O1WA 2HHQA 2ZJPL 2E5LK 3C6HA 2A3ZA 3O9UA 1REVA 3AGKA 3I56N 1QTMA 4B8AB 3KVGA 4H5RA 3DJCA 4J2BA 4IOXA 1Q18A 2VG5A 3U9ZA 4FW1A 3L2QA 1BA1A 3NF6A 1UWBA 4MO4A 1NKEA 3ZYYX 2GUPA 1P8ZA 4MDAA 3ZSXA 1NMDA 1SV5A 4CEQA 3BZKA 2FSKA 3IUCA 3R6MA 5AQKA 2EX3A 3CJ1A 4DMNA 3ISNC 4HUGA 2P9KA 2PYLA 1IG8A 1YXQA 4FPBA 5AQIA 5I3UA 2FBYA 4BDZA 1SL2A 3ZETA 4E1MA 1YVUA 5AQXA 1M1KO 1EKEA 1J5EK 4LFBK 4M7XA 1KSPA 5FROA 1RTIA 3BGRA 5IWAK 3AGRA 4NB4A 3THXA 3SV3A 4G9ZA 1S9GA 5HROA 4BR9A 4DCHA 2A42A 1YVNA 3VQBA 3M3ZA 1XMOK 1VSKA 3FE1A 1ZXOA 4NO7A 3VGLA 4KB0A 3DWLA 3U8XA 1RBUA 3VOVA 3I33A 3VA3A 1QZ6A 4E1JA 1XUPO 5AQQA 3V1OA 3DLLL 1TVRA 1YT3A 4NLCA 3H6EA 3A8YA 4IZ9A 3OS1A 4E7HA 3U9DA 2HBLA 4N47A 1KAYA 2NRTA 1XHZA 2XHBA 4M63C 4GKKK 4CEBA 4BWJA 1U04A 2X6SA 2NNWA 3PUFA 1RGIA 4QAGA 3TAEA 3EE8A 4C8KA 2RKIA 5AQWA 2LSNA 1D9FA 1YTUA 2A6AA 1H1VA 1NK4A 4KFBA 5BN9A 2Q0UA 2VWBA 3AA2A 4BDYA 3TSPA 3T1YK 4EHTA 3ZETB 1OVYA 1TL1A 3CCVN 4W5OA 2HSTA 1NGCA 4RCHA 4EZ6A 1ZYQA 3QO9A 3A5LC 3M8QA 4BRKA 2OTLN 4BR0A 3PX6A 3KLHA 3G71N 1HLUA 3AVAA 5AFUH 4FPAA 1KC8O 4AHCA 4CF1A 1WSJA 3SQ2A 3KK7A 3NGZA 3VESA 2P1JA 3VQ7A 1BG3A 3OS0A 2OANA 3W3DA 2G8IA 3MDQA 3O1BA 2E1YA 1X9WA 4DTNA 3DXKA 3J80O 3L2RA 3TI0A 4F3TA 4KI4A 3UIQA 4Q5VA 3THVA 3CMEN 5AQHA 1QZ5A 1SL1A 4O4GA 3HOTA 3E66A 3RMBA 1J53A 2HF4A 3SBGA 1C6VA 2NLXA 4DR2K 4ID5A 1RBRA 1RDBA 1HKGA 5J1EA 3O9RA 4DF4A 2E2NA 4JI3K 3GDQA 3CCRN 3QNNA 3NDKA 1ATNA 3V1RA 4N41A 3QFPA 3R1XA 4YNQA 3AA3A 4YOYA 4FJLA 4DQIA 4CK3A 2YNIA 1K8AO 5EXWA 1RBTA 5C24A 4B9LA 2IVPA 1SL0A 1N33K 3VA0A 5C10A 3MMVA 2QW9A 1NK5A 4E19A 3RSEA 2YV0X 2Q2RA 3AAPA 3QESA 2P9PB 4O5BA 2V7YA 3KIOA 3SQ4A 4H0VB 1WSFA 1J54A 4DS4A 1X1PA 5FPMA 1WLJA 3L2WA 3WEEA 3O6WA 2FSNA 3HPOA 4CK1A 4DFKA 3MEEA 1JCFA 3SZ2A 1N36K 4CHZA 2HNYA 1N8RO 5AR0A 1A5VA 4RWTA 3KLFA 4TSXA 2G8WA 3G0ZA 4EP5A 2P9LB 2HBJA 4H0PA 4KTQA 3T19A 4H0YB 3M8SA 2E4LA 2GWKA 4FOEA 3DOLA 2R7YA 2YHXA 5HOOA 3ENOA 4FJ8A 3N4QA 3HL8A 1Z25A 5KQ8A 3AO5A 3SYZA 5EX5A 1HKCA 2KQ2A 3DLKA 2VWJA 1NOZA 1Y64A 4BRAA 5KTQA 4XH4A 3OBYA 3QEIA 5FPEA 3FGUA 5AQLA 4CECA 4IKFA 3M1FA 3VQ6A 2Y1IA 5EVZA 5JVGL 2F7TA 3NAEA 3NHGA 4F4KA 4R5PA 3PY8A 4U7BA 4CJKA 3G10A 3DXMA 4RW7A 1UOCA 2A1RA 1HNWK 3EKUA 5AQNA 1QSLA 3O9QA 4FM1A 2DFHA 3VETA 4ISEA 1JLGA 1E4GT 1VSIA 4K25A 5T7BA 3T1HK 4NXNK 3MX2A 1SZ2A 1C0GA 3LM9A 4B3TK 4CJVA 2JWKA 1L5UA 1K9MO 2Z1IA 1MWKA 5GAHP 1FW6A 3P4IA 1OH5A 4B1YB 3CI5A 4E1NA 3TAQA 4NXMK 4KKOA 1QQOA 2GBZA 1C0FA 3SUNA 5KGXA 1N34K 2AA4A 3KHYA 4WCEL 3MCAB 1BL3A 3BY5A 2IOCA 1TKDA 4CW7B 4CJ5A 5AQUA 4JI0K 1TK5A 5FPNA 1TUYA 1DLOA 1DKGD 3LP3A 3UKUA 1ZBIA 3O8MA 4F3OA 4MDBA 3FZMA 4IO8A 3SPZA 5CHIA 3VQCA 4L3QA 2W6KA 2D4WA 5J2NA 1HMVA 4LSNA 4W5RA 4FO0A 1NJYA 3K5MA 4M41A 3CJCA 1CXQA 3MWPA 3MWTA 1KXPA 1JLAA 3P83D 3TABA 3NF8A 2RN2A 4FWNA 3LWMA 4Q0BA 2HVHA 1GOBA 1MWMA 3I55N 3T69A 2NRZA 5HRNA 5LJWA 1TK0A 4C8NA 4EAHD 3ZEUB 4LFCK 3I8DA 3O4WA 3VGKA 3LALA 2YCHA 3ZLJA 1G15A 1X9SA 3EYZA 3ZT1A 5AQPA 2Z1JA 4DKWA 4HWIA 3QIOA 5FPDA 4PQUA 3UKUB 4BR5A 3GOIA 4DQ8A 4FZZA 2YKMA 1R59O 1U47A 2FSJA 1S1WA 2Q36A 4M45A 4RW6A 3OHRA 1BCOA 1QVGM 1LAVA 3H46O 4DU3A 1HNZK 3TSUA 3L2VA 4AF1A 1WNSA 1RILA 4BRLA 3PSFA 4JV5K 2WC9A 3G25A 1KAZA 3MCPA 1S1XA 1BUPA 2PAVA 4HTUA 3AVBA 1IV0A 3PIPL 5MLCQ 4I9LA 4BREA 2HHWA 1SAZA 3O3FA 3SMSA 4N56A 3SPYA 2HNZA 1ASUA 2RPIA 5HLFA 2WONA 4JD2B 2OA8A 1WSIA 1T7PA 4DLEA 4EHUA 4OO1J 2B5JA 2ITMA 2UUCK 4WE1A 2O8FB 4CZEA 3C6TA 4AQYK 1RDUA 3OYFA 4CBWA 3CC4N 5M1OA 2UXCK 1BIZA 3SAFA 3KK2A 4DSFA 1Q7YO 1B9FA 5GAEP 3HO1A 3MN9A 4BDPA 1N5YA 3L0QA 3DLEA 4FJNA 3JAMO 1Q9XA 4O44A 2G8UA 3IDHA 1HNVA 3K2PA 3TTFA 3LP1A 2HB5A 3OYDA 1N6QA 3SI6A 2KZMA 3J7AP 3NMUA 4AHUA 4DUYK 4DU1A 4M42A 4FLUA 2NUBA 2DPNA 2F96A 3RRHA 3VQQA 1I39A 5AZIA 3QEWA 4BRMA 2EWSA 4IEIA 4JEPA 4LF9K 4BE1A 3E9PA 4CEOA 4R79A 1EWRA 1VSFA 1TAQA 3HP9A 1JLQA 3ID8A 3NCIA 2VGMA 2FF3B 1NJIO 3AO3A 3ENBA 4DTRA 4ELVA 1GLDG 3IMXA 3SJHA 1W97L 3VQEA 3R8EA 4CI6A 4JI5K 4IDHA 5JLHA 2BH1A 1OVQA 1TYQB 5M1QA 3CCSN 1YJ9N 3K5LA 3HVTA 2O4GA 3S3NA 3L4QA 4PY5A 2JWLA 4CJPA 1OH7A 4L8RB 1KFDA 3DLHA 2PYJA 3NGIA 1FXXA 2JGUA 4JKFA 1RT5A 5C0YA 4Y1DA 1IKXA 4B9UA 5H1SQ 5AZJB 1B92A 3KK1A 2O8FA 5F2RA 1Q86O 4ZTFA 4HTLA 1WBDA 2BTFA 4M3UA 2NRRA 3TAFA 4BRPA 3AY9A 2GWJA 4JHDB 3BF3A 3EN9A 4BGBA 4LF5K 5BPNA 1BGXT 1TYQA 4BRFA 5FDLA 5SWMA 4EIAA 4DQQA 3VEOA 5C25A 4BG8A 2G8HA 5M1KA 3DXKB 5KRTA 1TKTA 1CZAN 3I0SA 3VQPA 4DG1A 4FVMA 2XY8A 3SNNA 4MO5A 1DEJA 3O3HA 1JKHA 4FK4A 1NK6A 1GLAG 3NH2A 3ZX3A 4AHRA 4M3WA 3J81O 4JYAK 1HNIA 3M5RA 4K0KK 4KHWA 3HM9A 1S9EA 2P9KB 2QKKA 3G6EN 4DV4K 1DTTA 2XRIA 3VMFB 4IOAL 4FJMA 1JLBA 5C2FA 3RVCA 1W0HA 3L3UA 1T3VA 3LPTA 3CIPA 4BVPA 2P9NA 2ZM6K 3MN6A 4A62A 4DR5K 2NRVA 3OYAA 3VF2A 5J2QA 2IVNA 3KLIA 2G8FA 4BRDA 4BE0A 4DTUA 2QKBA 4PHTX 4DTJA 4CERA 2YHAA 5KQDA 3CPWM 4FJ9A 5DMRA 4N76A 3NE6A 1GLEG 3OJSA 4Z0UA 1NMNA 3VQ8A 3HVRA 2HHUA 4CGDA 1M90O 5F1XA 1U6ZA 3AA5X 4JKAA 3UE5A 3VEYA 4A2AA 3D45A 4CVNE 3QNOA 4FM2A 4M3TA 4K8XA 2ASOA 3OY9A 4IG0A 1I3AA 1U2VA 1RT3A 4LF4K 2X6NA 1HYZA 2P9IB 4A2BA 5LJVA 4YOVA 4K43A 1NGIA 1RT4A 5AJ3K 1VQMN 2A40A 1QE1A 3CD6N 1CZBA 1SKRA 4CHOA 3QICA 3D6RA 2QWNA 3CPEA 5TKYA 4Y1CA 1WN7A 2E2QA 3GBTA 2RE2A 1BWFO 2KFZA 1KTQA 3JXUA 3SBTA 4CJLA 4FM0A 4FW2A 4AM7A 5GIOA 3VEVA 4W5TA 5GAGP 4HUFA 3CMAN 2W6LA 1Q82O 4GV9A 3CJBA 4GVMA 3ZX0A 2XY5A 3V4IA 1Y97A 4E0DA 4DTXA 4CEFA 2WOMA 1N32K 3OW2M 3UKRB 3LP2A 4DSLA 2VYPA 4ICLA 1BQNA 4NCBA 4CZKA 3MN5A 1NGGA 3A5MC 5BR9A 4DR3K 1NBWA 4FK0A 4BY9C 4EP4A 2OPSA 5AQYA 1S72N 2NRHA 4DV0K 4YOWA 3V9UA 2D0BA 1G99A 4WFBL 1YIJN 1T05A 5K14A 1Q81O 3LDLA 5AQJA 3HPGA 4DTPA 4JAXA 1UA0A 4KH6A 3LZJA 4X64K 4KHPK 4NCGA 4HUEA 1JCEA 1UA1A 2D0AA 4Z4FA 4CCHA 4O5FA 3VQAA 1XWLA 4YHHK 1S6QA 4CZJA 4FWPA 2FBXA 3H1VX 4LF7K 2I7PA 4ILHA 1TGOA 4CJWA 3LL3A 1HJOA 1HQEA 1RNHA 3PX4A 5KPZA 4DR7K 4OGEA 3O5BA 3VERA 3VPZA 4C8MA 1S1UA 2PBDA 2Z1GA 3VQ4A 4FLYA 4DU4A 4KO0A 4IWVA 2E2OA 3T7ZA 3QERA 4FJJA 3D2FA 3ULDA 4BC4A 1XC9A 1JXEA 4FWRA 3QETA 1U2VB 4CFAA 3ZT3A 3E9LA 4BC3A 3MN7A 1EX4A 4B1UB 1NM1A 2BUPA 3PO4A 5J2PA 4C8LA 1TUUA 4GY2B 5HRSA 4WFNL 5E41A 2P5GA 3V1QA 3WXLA 1NGFA 4YFUA 4CGGA 4B9MA 2CGLA 1HPZA 3CG7A 4QCLA 4CFCA 2D0CA 4JI7K 2BGGA 3KJVA 3ZSRA 2HHXA 4WFAL 3S3OA 1RFQA 2E20A 4I6MA 4WF9L 1D9DA 3C0BA 1Z05A 4C1NI 3IKMA 4NYNA 4FJ5A 4BRIA 2XO7A 5CYQA 2HNDA 3BF1A 1BHLA 2ATQA 4J2AA 1EP4A 3HSCA 2VG7A 5ADXH 3OYEA 4DV2K 1KLNA 2YJEA 3M6GA 1X3MA 3KLGA 2O8DB 5BR8K 3SUOA 3U3YA 3K57A 4F9OA 1NGDA 2RF2A 1S1TA 4JS4A 4BRNA 3LDPA 2XY7A 5J2MA 3FFKB 4KH5A 4A57A 2OCEA 1VQ9N 3BEXA 3OTOK 2DTUA 1S1VA 1HYVA 2ASMA 2OPPA 1K8KA 3NH1A 4J2DA 1QHTA 2FF6A 3I0RA 3V9XA 4B1XB 3AVIA 4CEAA 4KH4A 3OYIA 4ELUA 4ILGB 4JKEA 4LY7A 3NGYA 4DFMA 1IH7A 3V9WA 1HQUA 3D2EA 4FWKA 3QLHA 3JSMA 1FKOA 2V52B 4FJIA 1HPMA 3KWGA 5AZJA 3IG1A 1NK8A 4CGFA 5HRPA 1R0AA 3HTVA 3OVNA 1K73O 1GOCA 2F9TA 3WNGA 5LY3A 1YI2N 4JD2A 2IAJA 1HX1A 1QVFM 3D7EO 4CJUA 4JRPA 1TK8A 4KHQA 2J4RA 3EY1A 3AVKA 4PA1A 4DSIA 1ATSA 1K8KB 4FL9A 2ZWHA 1IBKK 2I5JA 5AZIB 1A5WA 3B6OA 2FLOA 5AQZA 1JLFA 4OKKA 1NJWA 3CM5A 5LL6Z 4B08A 3JYTA 4DWIA 4CFDA 3RTVA 5KI6A 4DQRA 2IC3A 2HHTA 3PIOL 3DAWA 3EZ5A 4M3XA 2GELA 4JKGA 4B8CA 3GE1A 2E8AA 1L3UA 5FRNA 1KFSA 2QWOA 4BC2A 1HR0K 4M3RA 2HVIA 3HOSA 4N5SA 3C6AA 1K6YA 3C65A 5AQMA 3TSQA 1GLFO 3P38A 1LWEA 2QWLA 3CCMN 2ZGZA 3FLCO 4LFAK 2RHKA 3HBTA 3CC2N 3NF9A 2P9SA 3S3MA 2P9UB 4JRQA 1IG9A 1TKZA 5M1PA 4GVEA 1NJZA 3O4NA 3Q7BA 4OPJA 2KKZA 3F2KA 3CFRA 4I6MB 1EO1A 3CFOA 4GKJK 2F9WA 1HUXA 4BC5A 1KD1O 4B3SK 1NKCA 4RW8A 3WNFA 3I8BA 2UXBK 4K42A 1LOTB 1UAXA 3CETA 4J8FA 1KLMA 3QDKA 2VCPA 1C1CA 3SLCA 4FK2A 4W5NA 3FZLA 5IT9O 2E1ZA 4YOUA 3SAGA 2UUBK 3A2FA 4CHNA 1J9AA 3D2EB 4KREA 4A5BA 4CHQA 4AM6A 1BIUA 4JKHA 3CCJN 3A0IX 3VGMA 4CD1A 4H5NA 1VHXA 3SAHA 3O80A 4WQ5A 1S6PA 3ZSOA 2Y1JA 3P5JA 1KVBA 1NK0A 4OVLA 2ZD1A 2O8CB 1FK9A 1NKBA 1C0UA 4FJ7A 2F4VK 1DT9A 4CBXA 4PUOA 4O8KA 4ISGA 3MAQA 3F9MA 3OBWA 2IVOA 2OPRA 1VSLA 3A5NC 3KD1E 3NF7A 2IS3A 4Z94A 1ESVA 2KLAA 3LDQA 1GLJO 1MU2A 4ZHRA 4CJEA 4CK2A 1VQKN 3KK3A 2XY6A 4CJ7A 2FBTA 2ZJRL 3WXKA 1NWKA 1LAWA 3CQYA 3N4PA 1SS6A 3K5NA 2KW4A 1YAGA 1BI4A 4JI1K 2P5OA 3LAMA 1NNEA 2D0PA 4B9SA 4CIEA 4UY8O 1L3SA 2EHGA 4AH9A 3ZSYA 3LANA 2QK9A 4H0XB 4JK8A 4LSLA 5AQGA 3AVCA 4FVUA 3EKSA 2YJFA 3SV4A 2P9LA 1IKYA 4JKDA 2GUIA 4CGIA 1WSEA 2YHYA 5D3GA 5KPRA 1XNRK 5JMVA 3ZSQA 4IJAA 1P90A 1QSYA 4LF8K 4FXDA 1RTHA 3THYB 3SCXA 1VSMA 5BRHA 4KTZA 4JKGB 4AHTA 1BI4B 1OH6A 4B9TA 3DRPA 1YTAA 5JS2A 5ELZA 4B3RK 3H3OB 3AO1A 2P9PA 3LDSA 2CH5A 2QM1A 4IBNA 4C8OA 2UYTA 4H4OA 3C95A 3CCLN 5CY4A 1C1AA 4U67L 4CEEA 4BR2A 3BDPA 1ZBHA 5AQOA 2YX6A 4KV8A 4DLGA 1HKBA 1QQCA 3HSTB 4KHSA 4WYBA 1RBVA 2HW3A 4BRHA 5GADP 4DSEA 4CJQA 3SUPA 3THYA 5C42A 4OPAA 4M3YA 4RW9A 4EZ9A 1ILYA 4PKGA 2YNGA 3CCQN 3E1YA 3VTIA 3P39A 2JLEA 3EEQA 4MFBA 3LZIA 2Q0RA 5EY4A 3DMJA 3DXMB 2ZQBA 4IO9L 5JS1A 4OGCA 3ZT0A 3CC7N 4IEEA 3A5OC 4F2RA 4RTFD 4CIFA 4BACA 4CEDA 3CCEN 1Z6RA 3NH0A 3AVGA 3ULEB 2G8VA 5CZ2A 1NGEA 2P9SB 2CGJA 2ZF5O 3V9ZA 2Q1NA 1QSSA 2VQEK 1E4FT 4FLXA 3ITHA 3AVNA 4HHTA 1C0TA 4DR6K 2YHBA 1RDAA 4OKEA 1FJGK 3ENHA 3NVKA 4KAZA 4A59A 2Q3SA 2FXUA 1LCUA 4FWQA 5M1NA 4BQZA 2P9NB 4FJHA 4CFBA 3ZX2A 1WB9A 1X9JA 4OKJA 2E6MA 1KVCA 3RWUA 4F8RA 1U45A 4Z4IA 3F9KA 1YITN 4WQ5C 1E3MA 4FLWA 3QFUA 3J8AA 2D1KA 3B6PA 3WNHA 4FSVA 3OYJA 1EWQA 4GNIA 4KTWA 5FLXO 3SJJA 1DGKN 4DB3A 3RR8A 4OLBA 3MX5A 4KRFA 4B9NA 2I7NA 4JHDA 4LC9B 2HF3A 1SUQA 4I7FA 3WQUA 5ADXA 3TAMA 3W0LA 1JLEA 3QEVA 3OYNA 5HBMA 5BRDA 4DV1K 3RMAA 4IOCL 4YY3K 3OYBA 4KHUA 4B9QA 4UQGA 3RMCA 1JL1A 3OYMA 4CE9A 3L3VA 1OH8A 2ZGYA 3VQ9A 5C15A 3C7NA 1SKSA 3CFPA 3SUQA 4DSJA 4IJNA 4CZMA 3K9KA 1RTDA 3OYLA 4IG3A 4WQ4A 3ZSZA 3K59A 1VQLN 1ZBFA 5E26A 1TL3A 5CR4A 2DY4A 2FBVA 4DV7K 4BE2A 1T03A 4FZXC 4FWSA 1JCGA 2HHVA 4H5WA 4A61A 1RDDA 4O0JA 4ZTJA 1KCFA 4IDKA 3CYMA 5TKWA 4X66K 4YORA 3O1WA 4CJSA 2OTJN 3LWLA 4MLEA 2W42A 3VQDA 1XMQK 2O4IA 4MLHA 3EL2A 3RR7A 3HI0A 5AQTA 1L3TA 4CZHA 1KRPA 5F0XA 1RDWX 3LPUA 3V81A 3MEGA 3K9JA 2O8BB 1V4TA 4IFVA 1VQ8N 3E9OA 3QB0A 4FLZA 5BPMA 3GL1A 4QS8A 4BRQA 2KFNA 1BCMA 3ULEA 4C23A 3RMDA 1YJWN 3TARA 2YNFA 4G1QA 4E7LA 1BISA 1XI1A 4PL7A 3D2FB 2AJQA 3BZCA 4YDUA 4CJTA 1BU6O 3HJFA 2FC0A 1QQNA 4FLTA 1EQYA 3LM2A 3TWHA 1O13A 4E7JA 5C2DA 1IO2A 4NCAA 4DV6K 4JKCA 1WOQA 2HMPA 1XHXA 2E6LA 4WQ4C 3ALYA 2YKNA 2OYQA 4I9QA 2UXDK 1F21A 4DF8A 2IIRA 1JL2A 4MQ3A 1QHAA 2ZE2A 3L4IA 3TAGA 1WAJA 1S22A 4HCCA 1KAXA 2GV9A 3VEWA 4H5VA 4BQLA 4KPYA 1C0MA 5SZTA 4AILC 3AVLA 1EETA 2QEXN 5AQFA 5AFUA 1U48A 4DR4K 4BRCA 1RT1A 3AVMA 1C1BA 3QIPA 3VF6A 4LF6K 3FZFA 2HMIA 1VK0A 3AO2A 3WXMB 1Q9YA 1CZ9A 5I42A 3ZEUA 3SMPA 4CGJA 4ID1A 4GV6A 1VQON 1HJRA 3NBPA 5AQVA 1VSHA 4QS9A 1GLLO 2QA4N 4KBOA 5AQRA 1XC3A 1SKWA 3Q7CA 3VEXA 3DLBA 4E3SA 5JICA 3H08A 3CERA 3HP6A 2IDOA 2BE2A 3C6UA 1ITGA 3JS6A 1T6CA 4XH5A 2P9UA 4JI8K 3PLAA 3CXCM 1YHQN 5BRFA 1BA0A 1JXBA 2YHWA 3TU5A 4DV3K 1D4XA 3CCUN 3VF4A 4XH1A 3AO4A 1WSGA 1ZC6A 2WFBA 1TAUA 3AARA 4IFYA 3TAPA 3DRRA 1LW2A 3MXJA 2Q97A 4BR4A 4OX9K 3AVHA 3LAKA 3G4SN 4DFPA 1QS4A 1LW0A 2O8CA 1BOTO 2AP1A 4CBUA 3LDOA 1HRHA 1ASWA 3WT0A 3EO3A 3KKRA 4H8KA 1VQ7N 4FOIA 4Z4EA 3VQ5A 1RDCA 3WXJA 3PX0A 4JK9A 1VQ6N 4C1NK 2VWKA 4DTSA 1XNQK 4FLVA 4OPHA 4Z4HA 4Z4CA 2KTQA 4JS5A 3AA4A 3ZT2A 1W9HA 3K0SA 2B6AA 4NYFA 3THWA 1NOYA 4NLBA 3ATUA 4H5TA 2HBMA 1J6ZA 2ASPA 3S9HA 1NGAA 3ASMA 1HNXK 1U49A 3O9SA 4A5AA 4BWMA 2P9IA 4XIUA 4K8ZA 1ZBUA 4FCYA 3CM6A 4RG8A 3J7YP 1WSHA 3ZSVA 4PKIA 4HVJA 3UKRA 5JVHL 3MXIA 4CIGA 4FWLA 1BO5O 5GINA 3VN5A 2ITGA 2HHSA 2B4JA 3AVFA 2OPQA 3QINA 4E89A 1L3VA 4J2EA 3AV9A 1IKWA 2KHOA 1VQ4N 4H03B 4YDUC 4XEIA 4E7KA 4DTOA 2G8KA 2VGNA 2QTDA 3SQ0A 4M3ZA 3L6QA 1LWFA 2A1SA 3R3LA 1T8EA 2X78A 4KHYA 4LH4A 1I94K 4CESA 1VSJA 4DS5A 4FYDA 3U4LA 4AHSA 3OYCA 4DUZK 1VQPN 1NK9A 3K58A 3MEDA 2Z1HA 4QS7A 2QWQA 2GTDA 1VAZA 4IXCA 4KB1A 1BQMA 4O55A 3WEEB 2PY5A 5CYMA 4Z4GA 4LH5A 1T6DA 3MXMA 2A5XA 2QXFA 1W7AA 3WNEA 1WUAA 3P1GA 3IS9A 3HYFA 5CZ1A 2Q31A 5DM6L 1GLCG 4BROA 5LMUK 3ATVA 1NG9A 3AVJA 1YUWA 3GG4A 3FZHA 4OLAA 3WXIA 3C7NB 3H3NO 1RCHA 4DV5K 4GMJB 3FR0A 5CE3A 3OS2A 3ID6A 3MK6A 4JI4K 3KLEA 3ZCMA 2PZSA 5BN8A 3KKSA 2GX9A 4O8UA 4DQPA 5E84A 3O9TA 3H1QA 2P51A 4ISFA 5KRSA 4LD0A 2UU9K 1VRUA 4PL8A 4Y0WA 3LP0A 3F73A 3J7ZO 4B1VA 4BR7A 5I9EB 4JN4A 3T1AA 3V6DA 4PWDA 2W41A 3UB5A 4I2QA 5LMNK 3TANA 4JI2K 1DTQA 2QI2A 1MA9B 1LWCA 1V4SA 3VTHA 5DK5A 1BDGA 4YOXA 4DTMA 2O8BA 4JKBA 3OYHA 5EOYA 2OZSA 4QOZB 4W5QA 4JK7A 4PKHA 4CD3A 3M8RA 3VEZA 5M1FA 3DLGA 2KZZA 3TTCA 1B9DA 4BG9A 5A2QO 2BANA 3BP8A 2NRXA 3PO5A 4FWMA 4O0IA 4DHYA 3T3FA 1WBBA 2HBKA 2O8DA 1A5XA 1KVAA 2QXLA 1NK7A 1ZBSA 1Z26A 3DYAA 4BVOA 3O08A 3KTQA 3QEXA 3OYGA 3EE9A 1D5AA 3SQ1A 1HYSA 4DR1K 4FWOA 2E2PA 3DRSA 1SQKA 2HOEA 3U6FA 4DFJA 1OKJA 4CZLA 5DM7L 2D5RA 2W40A 2VG6A 1NLVA 2YI1A 2E88A 2QWPA 1RT6A 1JLCA 3MECA 1YF5L 3HPHA 1VQ5N 1ATRA 4CEZA 2H3GX 3NVMA 3THXB 1GLBG 4OPKA 5KGWA 3IAYA 2NZTA 5EU7A 5BREA 3KZBA 2F8TA 1RT7A 3K5OA 5AQSA 1KQSM 3WUHA 4CJ3A 4OJRA 3S41A 3KD5E 4H4MA 3O4QA 4RW4A 3ZT4A 1WAFA 3RRGA 4K41A 2D0OA 3V9SA 3C94A 3EZWA 1CXUA 3ZSWA 3O3GA 1YJNN 4KHNA 3BUZB 3HXMA 3QEPA 2HHHK 4FJXA 2X74A 4H0TB 4I2PA 1NJXA 4B3MK 1RBSA 2QWRA 3HM8A 4CGHA 3R9PA 4ILJA 2DFEA 4CJ4A 1U4BA 4V19S 3NFAA 3U3GA 4X65K 2QWMA 3IFRA 3KWIA 1MDUB 2YNHA 4JNEA 1XQSC 4FZYA 3L8BA 3HK2A 3VENA 1QQMA 4B9VA 2WUSA 3B8AX 3TPQA 1S3XA 3OA9A 4FJGA 5JLFA 4F2SA 1NGJA 2CGKA 2BDPA 2VQFK 1LV5A 3FFIA 4B1WB 1Q8IA 3P31A 2WBNA 4JLHA 2UUAK 2OZMA 3L2UA 4IFEA 3CJ9A 3QBXA 3DM2A 1CLQA 3TR8A 4CZIA 4H0OA 1VRTA 4DSKA 1FKPA 3PSIA 4KI6A 3H45C 2ZJQL 3CJAA 3QMLA 3HRGA 3E01A 2V51B 4JI6K 3AAQA 3HT3A 3HZ6A 4E7IA 4FJKA 2GEMA 1IKVA 5HRRA 4EFHA 2O8EB 4CF9A 1IBMK 4HCBA 3D0PA 5HP1A 1VSDA 4CZGA 3DI6A 3M8PA 4CJFA 4DQSA 3THWB 2IGIA 3WQTA 3TTDA 5HL7L 3OYKA 3CQ8A 2WTUA 4GW6A 1EXQA 4YOTA 5C12A 1GOAA 3DLRA 1TKXA 1ZBLA 3DOKA 5BPLA 3RSEB 1VSEA 2F8SA 1J5OA 4M7YA 4AHVA 3F5TA 3QBWA 2NRWA 1ASVA 5KPTA 5B8HA 3CF5L 1RT2A 2PFUA 1X3NA
chains in the Genus database with same CATH topology
2UU9K 4JI0K 4B3MK 2UUCK 4AQYK 4GKKK 4DR4K 1IBKK 4DV7K 3J7YP 1IBLK 4V19S 4X62K 4X65K 5LMNK 4LF6K 2UXCK 4JI7K 4JI2K 5LL6Z 1N36K 4X66K 3T1YK 3JAMO 2VQEK 4JI1K 3J81O 1N32K 2E5LK 4JYAK 4K0KK 4DR6K 1HR0K 1XMQK 1FJGK 2VQFK 4DV2K 4DV4K 3J7AP 4DUYK 4DR3K 2UUAK 5A2QO 4DV0K 5BR8K 1I94K 4JI8K 4LFAK 4LFCK 4LF9K 4DV3K 2ZM6K 4DUZK 4DR5K 1XNRK 4X64K 4GKJK 4KHPK 4JI6K 4LF8K 3J80O 4B3SK 4DR1K 3OTOK 2UXBK 4JI5K 5FLXO 1HNWK 4YHHK 4B3RK 1J5EK 5IT9O 4LFBK 1IBMK 2UUBK 4LF7K 4OX9K 4NXNK 3T1HK 5IWAK 4DR2K 5LMUK 4CVNE 1HNZK 4B3TK 4DV5K 4DV6K 4JI3K 4JV5K 4DR7K 4DV1K 1XMOK 4NXMK 4LF4K 4JI4K 4YY3K 1XNQK 1N34K 2UXDK 5AJ3K 4CW7B 1N33K 2HHHK 4LF5K 2F4VK 1HNXK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UU9 K;  4JI0 K;  4B3M K;  2UUC K;  4AQY K;  4GKK K;  4DR4 K;  1IBK K;  4DV7 K;  3J7Y P;  1IBL K;  4V19 S;  4X62 K;  4X65 K;  5LMN K;  4LF6 K;  2UXC K;  4JI7 K;  4JI2 K;  5LL6 Z;  1N36 K;  4X66 K;  3T1Y K;  3JAM O;  2VQE K;  4JI1 K;  3J81 O;  1N32 K;  2E5L K;  4JYA K;  4K0K K;  4DR6 K;  1HR0 K;  1XMQ K;  1FJG K;  2VQF K;  4DV2 K;  4DV4 K;  3J7A P;  4DUY K;  4DR3 K;  2UUA K;  5A2Q O;  4DV0 K;  5BR8 K;  1I94 K;  4JI8 K;  4LFA K;  4LFC K;  4LF9 K;  4DV3 K;  2ZM6 K;  4DUZ K;  4DR5 K;  1XNR K;  4X64 K;  4GKJ K;  4KHP K;  4JI6 K;  4LF8 K;  3J80 O;  4B3S K;  4DR1 K;  3OTO K;  2UXB K;  4JI5 K;  5FLX O;  1HNW K;  4YHH K;  4B3R K;  1J5E K;  5IT9 O;  4LFB K;  1IBM K;  2UUB K;  4LF7 K;  4OX9 K;  4NXN K;  3T1H K;  5IWA K;  4DR2 K;  5LMU K;  4CVN E;  1HNZ K;  4B3T K;  4DV5 K;  4DV6 K;  4JI3 K;  4JV5 K;  4DR7 K;  4DV1 K;  1XMO K;  4NXM K;  4LF4 K;  4JI4 K;  4YY3 K;  1XNQ K;  1N34 K;  2UXD K;  5AJ3 K;  4CW7 B;  1N33 K;  2HHH K;  4LF5 K;  2F4V K;  1HNX K; 
#chains in the Genus database with same CATH topology
 1S5J A;  3CQX A;  4CJR A;  4CF0 A;  2O8E A;  1RTJ A;  1T44 A;  5FRM A;  3SK3 A;  1TV6 A;  1D8Y A;  3FZK A;  1IBL K;  2ETJ A;  2A41 A;  2DFF A;  4CF2 A;  4X62 K;  3PV8 A;  4CHP A;  4CF8 A;  5GIP A;  3LDN A;  1VQN N;  1IJJ A;  4CHY A;  4GV3 A;  2V7Z A;  4CZF A;  1NGH A;  3OJU A;  1JJ2 M;  4ELT A;  4B3O A;  1NGB A;  1X9M A;  4BRG A;  1NU0 A;  3CJ7 A;  4B1Z A;  4BGA A;  1W2B M;  2CH6 A;  3CHW A;  3IRX A;  1O1W A;  2HHQ A;  2ZJP L;  2E5L K;  3C6H A;  2A3Z A;  3O9U A;  1REV A;  3AGK A;  3I56 N;  1QTM A;  4B8A B;  3KVG A;  4H5R A;  3DJC A;  4J2B A;  4IOX A;  1Q18 A;  2VG5 A;  3U9Z A;  4FW1 A;  3L2Q A;  1BA1 A;  3NF6 A;  1UWB A;  4MO4 A;  1NKE A;  3ZYY X;  2GUP A;  1P8Z A;  4MDA A;  3ZSX A;  1NMD A;  1SV5 A;  4CEQ A;  3BZK A;  2FSK A;  3IUC A;  3R6M A;  5AQK A;  2EX3 A;  3CJ1 A;  4DMN A;  3ISN C;  4HUG A;  2P9K A;  2PYL A;  1IG8 A;  1YXQ A;  4FPB A;  5AQI A;  5I3U A;  2FBY A;  4BDZ A;  1SL2 A;  3ZET A;  4E1M A;  1YVU A;  5AQX A;  1M1K O;  1EKE A;  1J5E K;  4LFB K;  4M7X A;  1KSP A;  5FRO A;  1RTI A;  3BGR A;  5IWA K;  3AGR A;  4NB4 A;  3THX A;  3SV3 A;  4G9Z A;  1S9G A;  5HRO A;  4BR9 A;  4DCH A;  2A42 A;  1YVN A;  3VQB A;  3M3Z A;  1XMO K;  1VSK A;  3FE1 A;  1ZXO A;  4NO7 A;  3VGL A;  4KB0 A;  3DWL A;  3U8X A;  1RBU A;  3VOV A;  3I33 A;  3VA3 A;  1QZ6 A;  4E1J A;  1XUP O;  5AQQ A;  3V1O A;  3DLL L;  1TVR A;  1YT3 A;  4NLC A;  3H6E A;  3A8Y A;  4IZ9 A;  3OS1 A;  4E7H A;  3U9D A;  2HBL A;  4N47 A;  1KAY A;  2NRT A;  1XHZ A;  2XHB A;  4M63 C;  4GKK K;  4CEB A;  4BWJ A;  1U04 A;  2X6S A;  2NNW A;  3PUF A;  1RGI A;  4QAG A;  3TAE A;  3EE8 A;  4C8K A;  2RKI A;  5AQW A;  2LSN A;  1D9F A;  1YTU A;  2A6A A;  1H1V A;  1NK4 A;  4KFB A;  5BN9 A;  2Q0U A;  2VWB A;  3AA2 A;  4BDY A;  3TSP A;  3T1Y K;  4EHT A;  3ZET B;  1OVY A;  1TL1 A;  3CCV N;  4W5O A;  2HST A;  1NGC A;  4RCH A;  4EZ6 A;  1ZYQ A;  3QO9 A;  3A5L C;  3M8Q A;  4BRK A;  2OTL N;  4BR0 A;  3PX6 A;  3KLH A;  3G71 N;  1HLU A;  3AVA A;  5AFU H;  4FPA A;  1KC8 O;  4AHC A;  4CF1 A;  1WSJ A;  3SQ2 A;  3KK7 A;  3NGZ A;  3VES A;  2P1J A;  3VQ7 A;  1BG3 A;  3OS0 A;  2OAN A;  3W3D A;  2G8I A;  3MDQ A;  3O1B A;  2E1Y A;  1X9W A;  4DTN A;  3DXK A;  3J80 O;  3L2R A;  3TI0 A;  4F3T A;  4KI4 A;  3UIQ A;  4Q5V A;  3THV A;  3CME N;  5AQH A;  1QZ5 A;  1SL1 A;  4O4G A;  3HOT A;  3E66 A;  3RMB A;  1J53 A;  2HF4 A;  3SBG A;  1C6V A;  2NLX A;  4DR2 K;  4ID5 A;  1RBR A;  1RDB A;  1HKG A;  5J1E A;  3O9R A;  4DF4 A;  2E2N A;  4JI3 K;  3GDQ A;  3CCR N;  3QNN A;  3NDK A;  1ATN A;  3V1R A;  4N41 A;  3QFP A;  3R1X A;  4YNQ A;  3AA3 A;  4YOY A;  4FJL A;  4DQI A;  4CK3 A;  2YNI A;  1K8A O;  5EXW A;  1RBT A;  5C24 A;  4B9L A;  2IVP A;  1SL0 A;  1N33 K;  3VA0 A;  5C10 A;  3MMV A;  2QW9 A;  1NK5 A;  4E19 A;  3RSE A;  2YV0 X;  2Q2R A;  3AAP A;  3QES A;  2P9P B;  4O5B A;  2V7Y A;  3KIO A;  3SQ4 A;  4H0V B;  1WSF A;  1J54 A;  4DS4 A;  1X1P A;  5FPM A;  1WLJ A;  3L2W A;  3WEE A;  3O6W A;  2FSN A;  3HPO A;  4CK1 A;  4DFK A;  3MEE A;  1JCF A;  3SZ2 A;  1N36 K;  4CHZ A;  2HNY A;  1N8R O;  5AR0 A;  1A5V A;  4RWT A;  3KLF A;  4TSX A;  2G8W A;  3G0Z A;  4EP5 A;  2P9L B;  2HBJ A;  4H0P A;  4KTQ A;  3T19 A;  4H0Y B;  3M8S A;  2E4L A;  2GWK A;  4FOE A;  3DOL A;  2R7Y A;  2YHX A;  5HOO A;  3ENO A;  4FJ8 A;  3N4Q A;  3HL8 A;  1Z25 A;  5KQ8 A;  3AO5 A;  3SYZ A;  5EX5 A;  1HKC A;  2KQ2 A;  3DLK A;  2VWJ A;  1NOZ A;  1Y64 A;  4BRA A;  5KTQ A;  4XH4 A;  3OBY A;  3QEI A;  5FPE A;  3FGU A;  5AQL A;  4CEC A;  4IKF A;  3M1F A;  3VQ6 A;  2Y1I A;  5EVZ A;  5JVG L;  2F7T A;  3NAE A;  3NHG A;  4F4K A;  4R5P A;  3PY8 A;  4U7B A;  4CJK A;  3G10 A;  3DXM A;  4RW7 A;  1UOC A;  2A1R A;  1HNW K;  3EKU A;  5AQN A;  1QSL A;  3O9Q A;  4FM1 A;  2DFH A;  3VET A;  4ISE A;  1JLG A;  1E4G T;  1VSI A;  4K25 A;  5T7B A;  3T1H K;  4NXN K;  3MX2 A;  1SZ2 A;  1C0G A;  3LM9 A;  4B3T K;  4CJV A;  2JWK A;  1L5U A;  1K9M O;  2Z1I A;  1MWK A;  5GAH P;  1FW6 A;  3P4I A;  1OH5 A;  4B1Y B;  3CI5 A;  4E1N A;  3TAQ A;  4NXM K;  4KKO A;  1QQO A;  2GBZ A;  1C0F A;  3SUN A;  5KGX A;  1N34 K;  2AA4 A;  3KHY A;  4WCE L;  3MCA B;  1BL3 A;  3BY5 A;  2IOC A;  1TKD A;  4CW7 B;  4CJ5 A;  5AQU A;  4JI0 K;  1TK5 A;  5FPN A;  1TUY A;  1DLO A;  1DKG D;  3LP3 A;  3UKU A;  1ZBI A;  3O8M A;  4F3O A;  4MDB A;  3FZM A;  4IO8 A;  3SPZ A;  5CHI A;  3VQC A;  4L3Q A;  2W6K A;  2D4W A;  5J2N A;  1HMV A;  4LSN A;  4W5R A;  4FO0 A;  1NJY A;  3K5M A;  4M41 A;  3CJC A;  1CXQ A;  3MWP A;  3MWT A;  1KXP A;  1JLA A;  3P83 D;  3TAB A;  3NF8 A;  2RN2 A;  4FWN A;  3LWM A;  4Q0B A;  2HVH A;  1GOB A;  1MWM A;  3I55 N;  3T69 A;  2NRZ A;  5HRN A;  5LJW A;  1TK0 A;  4C8N A;  4EAH D;  3ZEU B;  4LFC K;  3I8D A;  3O4W A;  3VGK A;  3LAL A;  2YCH A;  3ZLJ A;  1G15 A;  1X9S A;  3EYZ A;  3ZT1 A;  5AQP A;  2Z1J A;  4DKW A;  4HWI A;  3QIO A;  5FPD A;  4PQU A;  3UKU B;  4BR5 A;  3GOI A;  4DQ8 A;  4FZZ A;  2YKM A;  1R59 O;  1U47 A;  2FSJ A;  1S1W A;  2Q36 A;  4M45 A;  4RW6 A;  3OHR A;  1BCO A;  1QVG M;  1LAV A;  3H46 O;  4DU3 A;  1HNZ K;  3TSU A;  3L2V A;  4AF1 A;  1WNS A;  1RIL A;  4BRL A;  3PSF A;  4JV5 K;  2WC9 A;  3G25 A;  1KAZ A;  3MCP A;  1S1X A;  1BUP A;  2PAV A;  4HTU A;  3AVB A;  1IV0 A;  3PIP L;  5MLC Q;  4I9L A;  4BRE A;  2HHW A;  1SAZ A;  3O3F A;  3SMS A;  4N56 A;  3SPY A;  2HNZ A;  1ASU A;  2RPI A;  5HLF A;  2WON A;  4JD2 B;  2OA8 A;  1WSI A;  1T7P A;  4DLE A;  4EHU A;  4OO1 J;  2B5J A;  2ITM A;  2UUC K;  4WE1 A;  2O8F B;  4CZE A;  3C6T A;  4AQY K;  1RDU A;  3OYF A;  4CBW A;  3CC4 N;  5M1O A;  2UXC K;  1BIZ A;  3SAF A;  3KK2 A;  4DSF A;  1Q7Y O;  1B9F A;  5GAE P;  3HO1 A;  3MN9 A;  4BDP A;  1N5Y A;  3L0Q A;  3DLE A;  4FJN A;  3JAM O;  1Q9X A;  4O44 A;  2G8U A;  3IDH A;  1HNV A;  3K2P A;  3TTF A;  3LP1 A;  2HB5 A;  3OYD A;  1N6Q A;  3SI6 A;  2KZM A;  3J7A P;  3NMU A;  4AHU A;  4DUY K;  4DU1 A;  4M42 A;  4FLU A;  2NUB A;  2DPN A;  2F96 A;  3RRH A;  3VQQ A;  1I39 A;  5AZI A;  3QEW A;  4BRM A;  2EWS A;  4IEI A;  4JEP A;  4LF9 K;  4BE1 A;  3E9P A;  4CEO A;  4R79 A;  1EWR A;  1VSF A;  1TAQ A;  3HP9 A;  1JLQ A;  3ID8 A;  3NCI A;  2VGM A;  2FF3 B;  1NJI O;  3AO3 A;  3ENB A;  4DTR A;  4ELV A;  1GLD G;  3IMX A;  3SJH A;  1W97 L;  3VQE A;  3R8E A;  4CI6 A;  4JI5 K;  4IDH A;  5JLH A;  2BH1 A;  1OVQ A;  1TYQ B;  5M1Q A;  3CCS N;  1YJ9 N;  3K5L A;  3HVT A;  2O4G A;  3S3N A;  3L4Q A;  4PY5 A;  2JWL A;  4CJP A;  1OH7 A;  4L8R B;  1KFD A;  3DLH A;  2PYJ A;  3NGI A;  1FXX A;  2JGU A;  4JKF A;  1RT5 A;  5C0Y A;  4Y1D A;  1IKX A;  4B9U A;  5H1S Q;  5AZJ B;  1B92 A;  3KK1 A;  2O8F A;  5F2R A;  1Q86 O;  4ZTF A;  4HTL A;  1WBD A;  2BTF A;  4M3U A;  2NRR A;  3TAF A;  4BRP A;  3AY9 A;  2GWJ A;  4JHD B;  3BF3 A;  3EN9 A;  4BGB A;  4LF5 K;  5BPN A;  1BGX T;  1TYQ A;  4BRF A;  5FDL A;  5SWM A;  4EIA A;  4DQQ A;  3VEO A;  5C25 A;  4BG8 A;  2G8H A;  5M1K A;  3DXK B;  5KRT A;  1TKT A;  1CZA N;  3I0S A;  3VQP A;  4DG1 A;  4FVM A;  2XY8 A;  3SNN A;  4MO5 A;  1DEJ A;  3O3H A;  1JKH A;  4FK4 A;  1NK6 A;  1GLA G;  3NH2 A;  3ZX3 A;  4AHR A;  4M3W A;  3J81 O;  4JYA K;  1HNI A;  3M5R A;  4K0K K;  4KHW A;  3HM9 A;  1S9E A;  2P9K B;  2QKK A;  3G6E N;  4DV4 K;  1DTT A;  2XRI A;  3VMF B;  4IOA L;  4FJM A;  1JLB A;  5C2F A;  3RVC A;  1W0H A;  3L3U A;  1T3V A;  3LPT A;  3CIP A;  4BVP A;  2P9N A;  2ZM6 K;  3MN6 A;  4A62 A;  4DR5 K;  2NRV A;  3OYA A;  3VF2 A;  5J2Q A;  2IVN A;  3KLI A;  2G8F A;  4BRD A;  4BE0 A;  4DTU A;  2QKB A;  4PHT X;  4DTJ A;  4CER A;  2YHA A;  5KQD A;  3CPW M;  4FJ9 A;  5DMR A;  4N76 A;  3NE6 A;  1GLE G;  3OJS A;  4Z0U A;  1NMN A;  3VQ8 A;  3HVR A;  2HHU A;  4CGD A;  1M90 O;  5F1X A;  1U6Z A;  3AA5 X;  4JKA A;  3UE5 A;  3VEY A;  4A2A A;  3D45 A;  4CVN E;  3QNO A;  4FM2 A;  4M3T A;  4K8X A;  2ASO A;  3OY9 A;  4IG0 A;  1I3A A;  1U2V A;  1RT3 A;  4LF4 K;  2X6N A;  1HYZ A;  2P9I B;  4A2B A;  5LJV A;  4YOV A;  4K43 A;  1NGI A;  1RT4 A;  5AJ3 K;  1VQM N;  2A40 A;  1QE1 A;  3CD6 N;  1CZB A;  1SKR A;  4CHO A;  3QIC A;  3D6R A;  2QWN A;  3CPE A;  5TKY A;  4Y1C A;  1WN7 A;  2E2Q A;  3GBT A;  2RE2 A;  1BWF O;  2KFZ A;  1KTQ A;  3JXU A;  3SBT A;  4CJL A;  4FM0 A;  4FW2 A;  4AM7 A;  5GIO A;  3VEV A;  4W5T A;  5GAG P;  4HUF A;  3CMA N;  2W6L A;  1Q82 O;  4GV9 A;  3CJB A;  4GVM A;  3ZX0 A;  2XY5 A;  3V4I A;  1Y97 A;  4E0D A;  4DTX A;  4CEF A;  2WOM A;  1N32 K;  3OW2 M;  3UKR B;  3LP2 A;  4DSL A;  2VYP A;  4ICL A;  1BQN A;  4NCB A;  4CZK A;  3MN5 A;  1NGG A;  3A5M C;  5BR9 A;  4DR3 K;  1NBW A;  4FK0 A;  4BY9 C;  4EP4 A;  2OPS A;  5AQY A;  1S72 N;  2NRH A;  4DV0 K;  4YOW A;  3V9U A;  2D0B A;  1G99 A;  4WFB L;  1YIJ N;  1T05 A;  5K14 A;  1Q81 O;  3LDL A;  5AQJ A;  3HPG A;  4DTP A;  4JAX A;  1UA0 A;  4KH6 A;  3LZJ A;  4X64 K;  4KHP K;  4NCG A;  4HUE A;  1JCE A;  1UA1 A;  2D0A A;  4Z4F A;  4CCH A;  4O5F A;  3VQA A;  1XWL A;  4YHH K;  1S6Q A;  4CZJ A;  4FWP A;  2FBX A;  3H1V X;  4LF7 K;  2I7P A;  4ILH A;  1TGO A;  4CJW A;  3LL3 A;  1HJO A;  1HQE A;  1RNH A;  3PX4 A;  5KPZ A;  4DR7 K;  4OGE A;  3O5B A;  3VER A;  3VPZ A;  4C8M A;  1S1U A;  2PBD A;  2Z1G A;  3VQ4 A;  4FLY A;  4DU4 A;  4KO0 A;  4IWV A;  2E2O A;  3T7Z A;  3QER A;  4FJJ A;  3D2F A;  3ULD A;  4BC4 A;  1XC9 A;  1JXE A;  4FWR A;  3QET A;  1U2V B;  4CFA A;  3ZT3 A;  3E9L A;  4BC3 A;  3MN7 A;  1EX4 A;  4B1U B;  1NM1 A;  2BUP A;  3PO4 A;  5J2P A;  4C8L A;  1TUU A;  4GY2 B;  5HRS A;  4WFN L;  5E41 A;  2P5G A;  3V1Q A;  3WXL A;  1NGF A;  4YFU A;  4CGG A;  4B9M A;  2CGL A;  1HPZ A;  3CG7 A;  4QCL A;  4CFC A;  2D0C A;  4JI7 K;  2BGG A;  3KJV A;  3ZSR A;  2HHX A;  4WFA L;  3S3O A;  1RFQ A;  2E20 A;  4I6M A;  4WF9 L;  1D9D A;  3C0B A;  1Z05 A;  4C1N I;  3IKM A;  4NYN A;  4FJ5 A;  4BRI A;  2XO7 A;  5CYQ A;  2HND A;  3BF1 A;  1BHL A;  2ATQ A;  4J2A A;  1EP4 A;  3HSC A;  2VG7 A;  5ADX H;  3OYE A;  4DV2 K;  1KLN A;  2YJE A;  3M6G A;  1X3M A;  3KLG A;  2O8D B;  5BR8 K;  3SUO A;  3U3Y A;  3K57 A;  4F9O A;  1NGD A;  2RF2 A;  1S1T A;  4JS4 A;  4BRN A;  3LDP A;  2XY7 A;  5J2M A;  3FFK B;  4KH5 A;  4A57 A;  2OCE A;  1VQ9 N;  3BEX A;  3OTO K;  2DTU A;  1S1V A;  1HYV A;  2ASM A;  2OPP A;  1K8K A;  3NH1 A;  4J2D A;  1QHT A;  2FF6 A;  3I0R A;  3V9X A;  4B1X B;  3AVI A;  4CEA A;  4KH4 A;  3OYI A;  4ELU A;  4ILG B;  4JKE A;  4LY7 A;  3NGY A;  4DFM A;  1IH7 A;  3V9W A;  1HQU A;  3D2E A;  4FWK A;  3QLH A;  3JSM A;  1FKO A;  2V52 B;  4FJI A;  1HPM A;  3KWG A;  5AZJ A;  3IG1 A;  1NK8 A;  4CGF A;  5HRP A;  1R0A A;  3HTV A;  3OVN A;  1K73 O;  1GOC A;  2F9T A;  3WNG A;  5LY3 A;  1YI2 N;  4JD2 A;  2IAJ A;  1HX1 A;  1QVF M;  3D7E O;  4CJU A;  4JRP A;  1TK8 A;  4KHQ A;  2J4R A;  3EY1 A;  3AVK A;  4PA1 A;  4DSI A;  1ATS A;  1K8K B;  4FL9 A;  2ZWH A;  1IBK K;  2I5J A;  5AZI B;  1A5W A;  3B6O A;  2FLO A;  5AQZ A;  1JLF A;  4OKK A;  1NJW A;  3CM5 A;  5LL6 Z;  4B08 A;  3JYT A;  4DWI A;  4CFD A;  3RTV A;  5KI6 A;  4DQR A;  2IC3 A;  2HHT A;  3PIO L;  3DAW A;  3EZ5 A;  4M3X A;  2GEL A;  4JKG A;  4B8C A;  3GE1 A;  2E8A A;  1L3U A;  5FRN A;  1KFS A;  2QWO A;  4BC2 A;  1HR0 K;  4M3R A;  2HVI A;  3HOS A;  4N5S A;  3C6A A;  1K6Y A;  3C65 A;  5AQM A;  3TSQ A;  1GLF O;  3P38 A;  1LWE A;  2QWL A;  3CCM N;  2ZGZ A;  3FLC O;  4LFA K;  2RHK A;  3HBT A;  3CC2 N;  3NF9 A;  2P9S A;  3S3M A;  2P9U B;  4JRQ A;  1IG9 A;  1TKZ A;  5M1P A;  4GVE A;  1NJZ A;  3O4N A;  3Q7B A;  4OPJ A;  2KKZ A;  3F2K A;  3CFR A;  4I6M B;  1EO1 A;  3CFO A;  4GKJ K;  2F9W A;  1HUX A;  4BC5 A;  1KD1 O;  4B3S K;  1NKC A;  4RW8 A;  3WNF A;  3I8B A;  2UXB K;  4K42 A;  1LOT B;  1UAX A;  3CET A;  4J8F A;  1KLM A;  3QDK A;  2VCP A;  1C1C A;  3SLC A;  4FK2 A;  4W5N A;  3FZL A;  5IT9 O;  2E1Z A;  4YOU A;  3SAG A;  2UUB K;  3A2F A;  4CHN A;  1J9A A;  3D2E B;  4KRE A;  4A5B A;  4CHQ A;  4AM6 A;  1BIU A;  4JKH A;  3CCJ N;  3A0I X;  3VGM A;  4CD1 A;  4H5N A;  1VHX A;  3SAH A;  3O80 A;  4WQ5 A;  1S6P A;  3ZSO A;  2Y1J A;  3P5J A;  1KVB A;  1NK0 A;  4OVL A;  2ZD1 A;  2O8C B;  1FK9 A;  1NKB A;  1C0U A;  4FJ7 A;  2F4V K;  1DT9 A;  4CBX A;  4PUO A;  4O8K A;  4ISG A;  3MAQ A;  3F9M A;  3OBW A;  2IVO A;  2OPR A;  1VSL A;  3A5N C;  3KD1 E;  3NF7 A;  2IS3 A;  4Z94 A;  1ESV A;  2KLA A;  3LDQ A;  1GLJ O;  1MU2 A;  4ZHR A;  4CJE A;  4CK2 A;  1VQK N;  3KK3 A;  2XY6 A;  4CJ7 A;  2FBT A;  2ZJR L;  3WXK A;  1NWK A;  1LAW A;  3CQY A;  3N4P A;  1SS6 A;  3K5N A;  2KW4 A;  1YAG A;  1BI4 A;  4JI1 K;  2P5O A;  3LAM A;  1NNE A;  2D0P A;  4B9S A;  4CIE A;  4UY8 O;  1L3S A;  2EHG A;  4AH9 A;  3ZSY A;  3LAN A;  2QK9 A;  4H0X B;  4JK8 A;  4LSL A;  5AQG A;  3AVC A;  4FVU A;  3EKS A;  2YJF A;  3SV4 A;  2P9L A;  1IKY A;  4JKD A;  2GUI A;  4CGI A;  1WSE A;  2YHY A;  5D3G A;  5KPR A;  1XNR K;  5JMV A;  3ZSQ A;  4IJA A;  1P90 A;  1QSY A;  4LF8 K;  4FXD A;  1RTH A;  3THY B;  3SCX A;  1VSM A;  5BRH A;  4KTZ A;  4JKG B;  4AHT A;  1BI4 B;  1OH6 A;  4B9T A;  3DRP A;  1YTA A;  5JS2 A;  5ELZ A;  4B3R K;  3H3O B;  3AO1 A;  2P9P A;  3LDS A;  2CH5 A;  2QM1 A;  4IBN A;  4C8O A;  2UYT A;  4H4O A;  3C95 A;  3CCL N;  5CY4 A;  1C1A A;  4U67 L;  4CEE A;  4BR2 A;  3BDP A;  1ZBH A;  5AQO A;  2YX6 A;  4KV8 A;  4DLG A;  1HKB A;  1QQC A;  3HST B;  4KHS A;  4WYB A;  1RBV A;  2HW3 A;  4BRH A;  5GAD P;  4DSE A;  4CJQ A;  3SUP A;  3THY A;  5C42 A;  4OPA A;  4M3Y A;  4RW9 A;  4EZ9 A;  1ILY A;  4PKG A;  2YNG A;  3CCQ N;  3E1Y A;  3VTI A;  3P39 A;  2JLE A;  3EEQ A;  4MFB A;  3LZI A;  2Q0R A;  5EY4 A;  3DMJ A;  3DXM B;  2ZQB A;  4IO9 L;  5JS1 A;  4OGC A;  3ZT0 A;  3CC7 N;  4IEE A;  3A5O C;  4F2R A;  4RTF D;  4CIF A;  4BAC A;  4CED A;  3CCE N;  1Z6R A;  3NH0 A;  3AVG A;  3ULE B;  2G8V A;  5CZ2 A;  1NGE A;  2P9S B;  2CGJ A;  2ZF5 O;  3V9Z A;  2Q1N A;  1QSS A;  2VQE K;  1E4F T;  4FLX A;  3ITH A;  3AVN A;  4HHT A;  1C0T A;  4DR6 K;  2YHB A;  1RDA A;  4OKE A;  1FJG K;  3ENH A;  3NVK A;  4KAZ A;  4A59 A;  2Q3S A;  2FXU A;  1LCU A;  4FWQ A;  5M1N A;  4BQZ A;  2P9N B;  4FJH A;  4CFB A;  3ZX2 A;  1WB9 A;  1X9J A;  4OKJ A;  2E6M A;  1KVC A;  3RWU A;  4F8R A;  1U45 A;  4Z4I A;  3F9K A;  1YIT N;  4WQ5 C;  1E3M A;  4FLW A;  3QFU A;  3J8A A;  2D1K A;  3B6P A;  3WNH A;  4FSV A;  3OYJ A;  1EWQ A;  4GNI A;  4KTW A;  5FLX O;  3SJJ A;  1DGK N;  4DB3 A;  3RR8 A;  4OLB A;  3MX5 A;  4KRF A;  4B9N A;  2I7N A;  4JHD A;  4LC9 B;  2HF3 A;  1SUQ A;  4I7F A;  3WQU A;  5ADX A;  3TAM A;  3W0L A;  1JLE A;  3QEV A;  3OYN A;  5HBM A;  5BRD A;  4DV1 K;  3RMA A;  4IOC L;  4YY3 K;  3OYB A;  4KHU A;  4B9Q A;  4UQG A;  3RMC A;  1JL1 A;  3OYM A;  4CE9 A;  3L3V A;  1OH8 A;  2ZGY A;  3VQ9 A;  5C15 A;  3C7N A;  1SKS A;  3CFP A;  3SUQ A;  4DSJ A;  4IJN A;  4CZM A;  3K9K A;  1RTD A;  3OYL A;  4IG3 A;  4WQ4 A;  3ZSZ A;  3K59 A;  1VQL N;  1ZBF A;  5E26 A;  1TL3 A;  5CR4 A;  2DY4 A;  2FBV A;  4DV7 K;  4BE2 A;  1T03 A;  4FZX C;  4FWS A;  1JCG A;  2HHV A;  4H5W A;  4A61 A;  1RDD A;  4O0J A;  4ZTJ A;  1KCF A;  4IDK A;  3CYM A;  5TKW A;  4X66 K;  4YOR A;  3O1W A;  4CJS A;  2OTJ N;  3LWL A;  4MLE A;  2W42 A;  3VQD A;  1XMQ K;  2O4I A;  4MLH A;  3EL2 A;  3RR7 A;  3HI0 A;  5AQT A;  1L3T A;  4CZH A;  1KRP A;  5F0X A;  1RDW X;  3LPU A;  3V81 A;  3MEG A;  3K9J A;  2O8B B;  1V4T A;  4IFV A;  1VQ8 N;  3E9O A;  3QB0 A;  4FLZ A;  5BPM A;  3GL1 A;  4QS8 A;  4BRQ A;  2KFN A;  1BCM A;  3ULE A;  4C23 A;  3RMD A;  1YJW N;  3TAR A;  2YNF A;  4G1Q A;  4E7L A;  1BIS A;  1XI1 A;  4PL7 A;  3D2F B;  2AJQ A;  3BZC A;  4YDU A;  4CJT A;  1BU6 O;  3HJF A;  2FC0 A;  1QQN A;  4FLT A;  1EQY A;  3LM2 A;  3TWH A;  1O13 A;  4E7J A;  5C2D A;  1IO2 A;  4NCA A;  4DV6 K;  4JKC A;  1WOQ A;  2HMP A;  1XHX A;  2E6L A;  4WQ4 C;  3ALY A;  2YKN A;  2OYQ A;  4I9Q A;  2UXD K;  1F21 A;  4DF8 A;  2IIR A;  1JL2 A;  4MQ3 A;  1QHA A;  2ZE2 A;  3L4I A;  3TAG A;  1WAJ A;  1S22 A;  4HCC A;  1KAX A;  2GV9 A;  3VEW A;  4H5V A;  4BQL A;  4KPY A;  1C0M A;  5SZT A;  4AIL C;  3AVL A;  1EET A;  2QEX N;  5AQF A;  5AFU A;  1U48 A;  4DR4 K;  4BRC A;  1RT1 A;  3AVM A;  1C1B A;  3QIP A;  3VF6 A;  4LF6 K;  3FZF A;  2HMI A;  1VK0 A;  3AO2 A;  3WXM B;  1Q9Y A;  1CZ9 A;  5I42 A;  3ZEU A;  3SMP A;  4CGJ A;  4ID1 A;  4GV6 A;  1VQO N;  1HJR A;  3NBP A;  5AQV A;  1VSH A;  4QS9 A;  1GLL O;  2QA4 N;  4KBO A;  5AQR A;  1XC3 A;  1SKW A;  3Q7C A;  3VEX A;  3DLB A;  4E3S A;  5JIC A;  3H08 A;  3CER A;  3HP6 A;  2IDO A;  2BE2 A;  3C6U A;  1ITG A;  3JS6 A;  1T6C A;  4XH5 A;  2P9U A;  4JI8 K;  3PLA A;  3CXC M;  1YHQ N;  5BRF A;  1BA0 A;  1JXB A;  2YHW A;  3TU5 A;  4DV3 K;  1D4X A;  3CCU N;  3VF4 A;  4XH1 A;  3AO4 A;  1WSG A;  1ZC6 A;  2WFB A;  1TAU A;  3AAR A;  4IFY A;  3TAP A;  3DRR A;  1LW2 A;  3MXJ A;  2Q97 A;  4BR4 A;  4OX9 K;  3AVH A;  3LAK A;  3G4S N;  4DFP A;  1QS4 A;  1LW0 A;  2O8C A;  1BOT O;  2AP1 A;  4CBU A;  3LDO A;  1HRH A;  1ASW A;  3WT0 A;  3EO3 A;  3KKR A;  4H8K A;  1VQ7 N;  4FOI A;  4Z4E A;  3VQ5 A;  1RDC A;  3WXJ A;  3PX0 A;  4JK9 A;  1VQ6 N;  4C1N K;  2VWK A;  4DTS A;  1XNQ K;  4FLV A;  4OPH A;  4Z4H A;  4Z4C A;  2KTQ A;  4JS5 A;  3AA4 A;  3ZT2 A;  1W9H A;  3K0S A;  2B6A A;  4NYF A;  3THW A;  1NOY A;  4NLB A;  3ATU A;  4H5T A;  2HBM A;  1J6Z A;  2ASP A;  3S9H A;  1NGA A;  3ASM A;  1HNX K;  1U49 A;  3O9S A;  4A5A A;  4BWM A;  2P9I A;  4XIU A;  4K8Z A;  1ZBU A;  4FCY A;  3CM6 A;  4RG8 A;  3J7Y P;  1WSH A;  3ZSV A;  4PKI A;  4HVJ A;  3UKR A;  5JVH L;  3MXI A;  4CIG A;  4FWL A;  1BO5 O;  5GIN A;  3VN5 A;  2ITG A;  2HHS A;  2B4J A;  3AVF A;  2OPQ A;  3QIN A;  4E89 A;  1L3V A;  4J2E A;  3AV9 A;  1IKW A;  2KHO A;  1VQ4 N;  4H03 B;  4YDU C;  4XEI A;  4E7K A;  4DTO A;  2G8K A;  2VGN A;  2QTD A;  3SQ0 A;  4M3Z A;  3L6Q A;  1LWF A;  2A1S A;  3R3L A;  1T8E A;  2X78 A;  4KHY A;  4LH4 A;  1I94 K;  4CES A;  1VSJ A;  4DS5 A;  4FYD A;  3U4L A;  4AHS A;  3OYC A;  4DUZ K;  1VQP N;  1NK9 A;  3K58 A;  3MED A;  2Z1H A;  4QS7 A;  2QWQ A;  2GTD A;  1VAZ A;  4IXC A;  4KB1 A;  1BQM A;  4O55 A;  3WEE B;  2PY5 A;  5CYM A;  4Z4G A;  4LH5 A;  1T6D A;  3MXM A;  2A5X A;  2QXF A;  1W7A A;  3WNE A;  1WUA A;  3P1G A;  3IS9 A;  3HYF A;  5CZ1 A;  2Q31 A;  5DM6 L;  1GLC G;  4BRO A;  5LMU K;  3ATV A;  1NG9 A;  3AVJ A;  1YUW A;  3GG4 A;  3FZH A;  4OLA A;  3WXI A;  3C7N B;  3H3N O;  1RCH A;  4DV5 K;  4GMJ B;  3FR0 A;  5CE3 A;  3OS2 A;  3ID6 A;  3MK6 A;  4JI4 K;  3KLE A;  3ZCM A;  2PZS A;  5BN8 A;  3KKS A;  2GX9 A;  4O8U A;  4DQP A;  5E84 A;  3O9T A;  3H1Q A;  2P51 A;  4ISF A;  5KRS A;  4LD0 A;  2UU9 K;  1VRU A;  4PL8 A;  4Y0W A;  3LP0 A;  3F73 A;  3J7Z O;  4B1V A;  4BR7 A;  5I9E B;  4JN4 A;  3T1A A;  3V6D A;  4PWD A;  2W41 A;  3UB5 A;  4I2Q A;  5LMN K;  3TAN A;  4JI2 K;  1DTQ A;  2QI2 A;  1MA9 B;  1LWC A;  1V4S A;  3VTH A;  5DK5 A;  1BDG A;  4YOX A;  4DTM A;  2O8B A;  4JKB A;  3OYH A;  5EOY A;  2OZS A;  4QOZ B;  4W5Q A;  4JK7 A;  4PKH A;  4CD3 A;  3M8R A;  3VEZ A;  5M1F A;  3DLG A;  2KZZ A;  3TTC A;  1B9D A;  4BG9 A;  5A2Q O;  2BAN A;  3BP8 A;  2NRX A;  3PO5 A;  4FWM A;  4O0I A;  4DHY A;  3T3F A;  1WBB A;  2HBK A;  2O8D A;  1A5X A;  1KVA A;  2QXL A;  1NK7 A;  1ZBS A;  1Z26 A;  3DYA A;  4BVO A;  3O08 A;  3KTQ A;  3QEX A;  3OYG A;  3EE9 A;  1D5A A;  3SQ1 A;  1HYS A;  4DR1 K;  4FWO A;  2E2P A;  3DRS A;  1SQK A;  2HOE A;  3U6F A;  4DFJ A;  1OKJ A;  4CZL A;  5DM7 L;  2D5R A;  2W40 A;  2VG6 A;  1NLV A;  2YI1 A;  2E88 A;  2QWP A;  1RT6 A;  1JLC A;  3MEC A;  1YF5 L;  3HPH A;  1VQ5 N;  1ATR A;  4CEZ A;  2H3G X;  3NVM A;  3THX B;  1GLB G;  4OPK A;  5KGW A;  3IAY A;  2NZT A;  5EU7 A;  5BRE A;  3KZB A;  2F8T A;  1RT7 A;  3K5O A;  5AQS A;  1KQS M;  3WUH A;  4CJ3 A;  4OJR A;  3S41 A;  3KD5 E;  4H4M A;  3O4Q A;  4RW4 A;  3ZT4 A;  1WAF A;  3RRG A;  4K41 A;  2D0O A;  3V9S A;  3C94 A;  3EZW A;  1CXU A;  3ZSW A;  3O3G A;  1YJN N;  4KHN A;  3BUZ B;  3HXM A;  3QEP A;  2HHH K;  4FJX A;  2X74 A;  4H0T B;  4I2P A;  1NJX A;  4B3M K;  1RBS A;  2QWR A;  3HM8 A;  4CGH A;  3R9P A;  4ILJ A;  2DFE A;  4CJ4 A;  1U4B A;  4V19 S;  3NFA A;  3U3G A;  4X65 K;  2QWM A;  3IFR A;  3KWI A;  1MDU B;  2YNH A;  4JNE A;  1XQS C;  4FZY A;  3L8B A;  3HK2 A;  3VEN A;  1QQM A;  4B9V A;  2WUS A;  3B8A X;  3TPQ A;  1S3X A;  3OA9 A;  4FJG A;  5JLF A;  4F2S A;  1NGJ A;  2CGK A;  2BDP A;  2VQF K;  1LV5 A;  3FFI A;  4B1W B;  1Q8I A;  3P31 A;  2WBN A;  4JLH A;  2UUA K;  2OZM A;  3L2U A;  4IFE A;  3CJ9 A;  3QBX A;  3DM2 A;  1CLQ A;  3TR8 A;  4CZI A;  4H0O A;  1VRT A;  4DSK A;  1FKP A;  3PSI A;  4KI6 A;  3H45 C;  2ZJQ L;  3CJA A;  3QML A;  3HRG A;  3E01 A;  2V51 B;  4JI6 K;  3AAQ A;  3HT3 A;  3HZ6 A;  4E7I A;  4FJK A;  2GEM A;  1IKV A;  5HRR A;  4EFH A;  2O8E B;  4CF9 A;  1IBM K;  4HCB A;  3D0P A;  5HP1 A;  1VSD A;  4CZG A;  3DI6 A;  3M8P A;  4CJF A;  4DQS A;  3THW B;  2IGI A;  3WQT A;  3TTD A;  5HL7 L;  3OYK A;  3CQ8 A;  2WTU A;  4GW6 A;  1EXQ A;  4YOT A;  5C12 A;  1GOA A;  3DLR A;  1TKX A;  1ZBL A;  3DOK A;  5BPL A;  3RSE B;  1VSE A;  2F8S A;  1J5O A;  4M7Y A;  4AHV A;  3F5T A;  3QBW A;  2NRW A;  1ASV A;  5KPT A;  5B8H A;  3CF5 L;  1RT2 A;  2PFU A;  1X3N A; 
#chains in the Genus database with same CATH homology
 2UU9 K;  4JI0 K;  4B3M K;  2UUC K;  4AQY K;  4GKK K;  4DR4 K;  1IBK K;  4DV7 K;  3J7Y P;  1IBL K;  4V19 S;  4X62 K;  4X65 K;  5LMN K;  4LF6 K;  2UXC K;  4JI7 K;  4JI2 K;  5LL6 Z;  1N36 K;  4X66 K;  3T1Y K;  3JAM O;  2VQE K;  4JI1 K;  3J81 O;  1N32 K;  2E5L K;  4JYA K;  4K0K K;  4DR6 K;  1HR0 K;  1XMQ K;  1FJG K;  2VQF K;  4DV2 K;  4DV4 K;  3J7A P;  4DUY K;  4DR3 K;  2UUA K;  5A2Q O;  4DV0 K;  5BR8 K;  1I94 K;  4JI8 K;  4LFA K;  4LFC K;  4LF9 K;  4DV3 K;  2ZM6 K;  4DUZ K;  4DR5 K;  1XNR K;  4X64 K;  4GKJ K;  4KHP K;  4JI6 K;  4LF8 K;  3J80 O;  4B3S K;  4DR1 K;  3OTO K;  2UXB K;  4JI5 K;  5FLX O;  1HNW K;  4YHH K;  4B3R K;  1J5E K;  5IT9 O;  4LFB K;  1IBM K;  2UUB K;  4LF7 K;  4OX9 K;  4NXN K;  3T1H K;  5IWA K;  4DR2 K;  5LMU K;  4CVN E;  1HNZ K;  4B3T K;  4DV5 K;  4DV6 K;  4JI3 K;  4JV5 K;  4DR7 K;  4DV1 K;  1XMO K;  4NXM K;  4LF4 K;  4JI4 K;  4YY3 K;  1XNQ K;  1N34 K;  2UXD K;  5AJ3 K;  4CW7 B;  1N33 K;  2HHH K;  4LF5 K;  2F4V K;  1HNX K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...