4OX9Y

Crystal structure of the aminoglycoside resistance methyltransferase npma bound to the 30s ribosomal subunit
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
219
structure length
219
Chain Sequence
MLILKGTKTVDLSKDELTEIIGQFDRVHIDLGTGDGRNIYKLAINDQNTFYIGIDPVKENLFDISKKIIKKPSKGGLSNVVFVIAAAESLPFELKNIADSISILFPWGTLLEYVIKPNRDILSNVADLAKKEAHFEFVTTYSDSYEEAEIKKRGLPLLSKAYFLSEQYKAELSNSGFRIDDVKELDNEYVKQFNSLWAKRLAFGRKRSFFRVSGHVSKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular recognition and modification of the 30S ribosome by the aminoglycoside-resistance methyltransferase NpmA.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 68
structure length 219
sequence length 219
ec nomenclature ec 2.1.1.180: 16S rRNA (adenine(1408)-N(1))-methyltransferase.
pdb deposition date 2014-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Y PF02390 Methyltransf_4 Putative methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4ox9Y00
3DTNA 4NECA 5DM4A 2ZW9A 1HNNA 1JSXA 4OQEA 4RYLA 1VL5A 5KYGA 2Y1XA 4M7RA 4MTLA 3UBTA 3ELDA 1RJEA 1FJXA 3FTCA 5EPEA 2OO3A 3G89A 3RW9A 3E8SA 5ICEA 4PYOA 2GAFA 3GRZA 4RTQA 3G2QA 5K8VA 3I58A 2IBTA 2NXJA 4RVGA 4C08A 2ZTHA 5EC8A 5LQCA 3IEIA 3HCAA 2PXCA 3NVMB 4GOMD 4KVZA 3L8DA 3UZUA 2PKWA 3V8VA 4C03A 2NXNA 2FHPA 2I6GA 2ZSUA 3KR0A 4PCAA 4PWYA 4LECA 2B25A 4PYMA 4QQKA 5HZMA 5LQAA 2UZ4A 2VP3A 3HCCA 5K09A 3MGGA 4A6DA 1YUBA 1INLA 2EFJA 2P1DA 3SSOA 2O07A 2BM9A 2AVDA 2Y1WA 2VZ9A 2ZIFA 4PINA 4F86A 3EVDA 3LBYA 4ISCA 2ZBPA 3NDIA 4ER5A 3GDHA 2H11A 2XYRA 3BGVA 3IV6A 1VP9A 3I53A 4EMSA 1BC5A 1TW3A 3HVJA 1SUSA 3LDUA 3PFGA 5K0GA 3BXOA 1QANA 2XYVA 3R9XB 4CKCA 1NE2A 2P3QA 5HEKA 3D2LA 4KIGA 1WG8A 5CVDA 3KPVA 1R74A 4C4AA 5F2KA 2AN3A 3UFBA 3EVAA 3Q87B 3TM4A 3DR5A 2O06A 4RVDA 5FHQA 4DKJA 1DCTA 4OQDA 4EK9A 1R8YA 1PJZA 1KR5A 3FYCA 3LDGA 4M36A 3UWPA 2QY6A 3JWHA 4DF3A 4RV9A 1G8AA 1NW7A 5ERGB 2AOWA 3DP7A 1KP9A 3P71T 4E31A 4DQ0A 1KPGA 2JJQA 2AOVA 3SGLA 5M5BA 1FBNA 4DMGA 2NP6A 4MIKA 1EAMA 2HWKA 3JWGA 2K4MA 1R00A 3IHTA 1JG1A 2CKDA 1Z3CA 3KQYA 3CC8A 5DTQA 5FTWA 5CUQA 4YUVA 5EEGA 4HTFA 5KQSA 2HTEA 2P7HA 3GWZA 2P7IA 3GU3A 3HM2A 3LSTA 3MCTA 5GM1A 2UYCA 5EMMA 4BLWA 2C7PA 7MHTA 3SXJA 3EVGA 1YFJA 2OB2A 1O9GA 1FP1D 5K0NA 2XBMA 5T64A 1NW3A 3CCFA 1VPTA 5CVVA 4PONA 3OZSA 2IFTA 3TQSA 4PGHA 5BW5A 3JWIA 2ZWAA 3DMGA 3G8BA 4DCGA 5DTMA 3P8ZA 4XUDA 3REOA 4RTNA 3TFWA 3EGVA 5E2BA 3HCFA 3HEMA 4PYLA 5CIYA 5ICGA 3GJYA 3M6WA 3KQQA 3KU1A 2GS9A 5CCXA 3HP7A 3TR6A 1WZNA 1I1NA 4KDCA 3G2MA 3UJ6A 3UJCA 3TRKA 5CD1A 2CMHA 2ONZA 1N2XA 5F2OA 3C3PA 3RIEA 4FT4A 2AOTB 5EKXA 1N7JA 3A7DA 4LG1A 4RTLA 5DM2A 2PWPA 3BGDA 3MAGA 1ZG3A 5DX8A 5EVJA 3E05A 3GXOA 3FTFA 5K0JA 3SM3A 3SVZA 4YMHA 4RTMA 3HA3A 3TM5A 3PTAA 3KQVA 5DSTA 1NW6A 2NNWB 5IH3A 3AWIA 5KVAA 5HILA 4BY9E 2ESRA 4KDRA 1QAQA 4G56A 4P7GA 1IXKA 2HR1A 4M38A 2JHPA 1RI4A 5E1BA 2EJTA 1BHJA 3UJ9A 1YZHA 4YUZA 2UYOA 2I9KA 3BWYA 4X63A 1RI3A 1RI2A 2XYQA 5LQUA 1OR8A 4B17A 3U81A 3IYLW 5K0EA 2ZCJA 1QZZA 5EIFA 3O7WA 1F3LA 1AQIA 2ZZNA 3FPJA 4LWPA 4IKPA 2V7EA 3Q7EA 3R0QA 3ELWA 1XVAA 5FA5A 1DUSA 3C6MA 5DT2A 4IWNA 2YXLA 4HTFB 5MHTA 4ER0A 1NV9A 3LX6A 4V0QA 3SSNA 5ICCA 1F38A 2Z6UA 4QVGA 1XXLA 2VDVE 1QYRA 5FUBA 3E23A 1TW2A 3KQMA 5EOVA 1YZ3A 1D2CA 1L3IA 3MQ2A 1P39A 4RTRA 3EEYA 5FWDA 1EIZA 5EIWA 5EMJA 3OE4A 5DXJA 4L7VA 3G5TA 4HH4A 1VLMA 4ER7A 2EJUA 8MHTA 3I64A 2LD4A 3HVHA 2BH2A 3C6KA 3PLAE 3NWEA 1JSZA 2YR0A 3GIWA 4PCLA 3CVOA 2OB1A 3DULA 2JHCA 2NXCA 5KS2A 2IP2A 3O31A 4OBXA 3TKYA 1L3CA 5DX0A 5HOQA 2I62A 4Y30A 4POOA 2IIPA 3ER8A 4RTKA 2R3SA 4PYIA 4IV0A 5B1SA 2AS0A 3LCVB 4CKBA 4AZSA 2KW5A 3UJ8A 4AZVA 3MHTA 3EVFA 1KYWA 3DLIA 2PX4A 3LKZA 3B3FA 1NKVA 5F2NA 3HA5A 3G88A 2IDKA 1BOOA 3P2IA 5LQJA 1FP2A 1XTPA 1RJFA 4C04A 2JH9A 1Q0SA 3PFHA 2YVLA 2G71A 3QOXA 3WSTA 1WXXA 1JTEA 2AR0A 4BLUA 1H1DA 4UOEA 2ZVJA 3TMAA 3KQPA 2AOXA 3VC1A 2PXAA 4C06A 4EKIA 4OBWA 3BWCA 1WXWA 3T7TA 5LQRA 4MQ4A 1G6Q1 3KPJA 2AOUA 3DOUA 3KR1A 3KKZA 4RSRA 3RODA 2PT6A 3KQSA 3G2PA 4XCXA 2ORED 3EGEA 2VS1A 3ID6C 4DCMA 3TPZA 2G8NA 1X1BA 2PV0A 3DMHA 5C0OE 5C1IA 4DM3A 3PVCA 4HC4A 4GUAA 3P2KA 1RI5A 1IM8A 3P9CA 5P8WA 2FK7A 2PY6A 5C9ZA 3FTDA 2OZVA 3FPEA 1RJGA 3MERA 4U7TB 3UA3A 1AF7A 2JHAA 5DXAA 2QYOA 2ONYA 5E1DA 5E2AA 2ZZKA 2OYRA 3GNLA 5K05A 3B89A 2G70A 2O05A 3O4FA 1XCJA 5E9WA 5E8JA 2NXEA 3AJDA 4WVLA 5CCBA 1JG4A 1KPHA 3C3YA 1WS6A 2PJDA 3PS9A 4PYKA 5EMKA 3A25A 3OFJA 2IDJA 3EMDA 4XUEA 4R8RA 5E8RA 3KPWA 4YV1A 1G8SA 2C7RA 4P58A 3T7SA 3HCDA 5E9JA 2FRXA 1KPIA 1B42A 3FUVA 4OA5A 4RTSA 1DL5A 4ER3A 4V0RA 1VP3A 3VC2A 1PRYA 2QRVA 3B3GA 3BKWA 3LCUA 5FHRA 4EKGA 1JG3A 3HTXA 3KHKA 3FPHA 4HG2A 3P9IA 2UYQA 3FPGA 4MHTA 5IKMA 2CL5A 5E1MA 2HMYB 9MHTA 3DLCA 3CJTA 2QRVB 1Y8CA 2N47A 3NW9A 4GEKA 5EGSA 3X0DA 3KQTA 3GO4A 4X60A 5DTRA 4BP1A 4HSGA 4C05A 5DSXA 4RTJA 1WY7A 2P41A 2YXDA 5DRYA 3A4TA 5GINE 4AX8A 2FK8A 2ERCA 4FT2A 3EMBA 3FUXA 5DM0A 5GIPE 3FPFA 1XJ5A 10MHA 2JG3A 1KYZA 1L3BA 4KWCA 4CTJA 2AOUB 4JXJA 3MCZA 3K0BA 5KQRA 2Z6AA 3GCZA 2Z6QA 2OXTA 2OPBA 2PX2A 2PBFA 1NW8A 4O29A 1EJ6A 3BUSA 5HIJA 4PGGA 1ZGAA 2R6ZA 1SQFA 3G5LA 2BR4A 3HCBA 1AV6A 5E1OA 3KR2A 1NBHA 1G60A 3A7EA 5CM2Z 3LL7A 3BGIA 2XVMA 2PT9A 3F4KA 3R24A 1X1AA 4DA4A 3GRUA 1M0EA 3OZRA 2AOTA 5FWAA 4FSDA 1YF3A 4CXMA 4EQZA 1NV8A 1XDSA 5FCDA 4PIMA 5EEHA 2AN4A 1D2HA 1HMYA 1O9HA 5H02A 1P1BA 3EVEA 5D1HA 1R18A 4FP9A 2BZGA 1T43A 3ELYA 3NDJA 5BP7A 3OU2A 3VYWA 2ADMA 3M6VA 3UJ7A 3B5IA 3OPNA 4GOLD 2EG5A 1UIRA 2YUIA 3NVKI 2NP7A 2F8LA 3MB5A 2DPMA 1NT2A 5ICFA 4P7FA 1SQGA 2I7CA 4E33A 3SX0A 5HFJA 2CWWA 3G2OA 3G7UA 3LGAA 3EVZA 4E32A 4U7PB 3FRIA 1VIDA 2JH8A 1Q0TA 5LSAA 3M6XA 3QOWA 1JQEA 1EG2A 2PVCA 3B7PA 5CVUA 5LR6A 4PNEA 2P35A 1G55A 4ZTBA 4Z2YA 4YMGA 5K0BA 3DH0A 2VDUE 3M4XA 2IBSA 4FR0A 1VQ1A 4AUKA 1RI1A 2HNKA 2PX5A 2OY0A 3CGGA 4FGZA 3OU7A 2ZLBA 4A6EA 1EQAA 5DLYA 5FQNA 2GA9A 1X19A 3PX2A 4AZWA 4E2WA 4HGYA 5K03A 3GGDA 2OKCA 4PYQA 4QQNA 3HVIA 2IH2A 3JWJA 4YUXA 3ORHA 1KHHA 5HIMA 2V74B 3GRVA 4YV2A 5T67A 1JTFA 2PWYA 3G8AA 2AN5A 4E30A 3TLJA 2DULA 2YTZA 4GF5A 3KPUA 3CJRA 4PYJA 1YB2A 3UJBA 4P7KA 1X1DA 2PGXA 4R05A 1ORHA 3S68A 3HCEA 3M70A 3NMUF 1SUIA 3BZBA 3NWBA 3DXYA 3DMFA 3EVBA 3KQWA 1ORIA 3PT9A 1KIAA 2AZTA 4QPPA 3NTVA 3OU6A 1EJ0A 5GP1A 3T7RA 4QTUB 5GWXA 4YUWA 1KXZA 2O0LA 3DXXA 3UJDA 4E2YA 1JQDA 2A14A 2NYUA 4R6WA 4C07A 4YV0A 3NJRA 1AQJA 4LWOA 1TPYA 4RTOA 2B2CA 5FULA 3P97A 3THSA 3LKDA 3GRRA 5LQNA 2CMGA 2OBFA 2Q41A 5GOZA 3V97A 3CJQA 3M33A 4CWAA 5FADA 5EMLA 3LPMA 2P8JA 3OFKA 2EX4A 1L1EA 1N7IA 3MTIA 3FUTA 4E2XA 1P91A 3T0IA 5K0CA 3M6UA 3KPYA 1SVUA 4BLVA 2FYTA 3AXTA 1M6EX 3HVKA 1V39A 2WA1A 2YQZA 3CBGA 1UFKA 4OA8A 4QDJA 4ATNA 1G38A 2BR3A 3C0KA 3FRHA 1I9GA 3A27A 4M37A 3HNRA 5D1NA 4F84A 1MJFA 4YUYA 5BW4A 2IH4A 5DX1A 1X1CA 4EVIA 2GLUA 4GOOD 2UYHA 5JUWA 3BWMA 2AVNA 1ZKDA 3DXZA 3E7PA 1R8XA 2BR5A 2PLWA 3AXSA 3KR9A 3LECA 4PYNA 2IH5A 5CVJA 3ME5A 4H0NA 2BM8A 1D2GA 3BKXA 3PB3A 3BT7A 4QDKA 2E5WA 3FZGA 3VSEA 1IY9A 4GOND 5T6BA 1FPQA 1SG9A 5G02A 4RX1A 5JR3A 2WK1A 2B3TA 3LCCA 2P3LA 4Y2HA 5CVEA 3TKAA 3SMQA 3BWBA 4BP3A 4CTKA 3SSMA 1U2ZA 3EGIA 2ZIEA 2WA2A 5DRTA 3AY0A 2ZFUA 5EQJB 5FA8A 3B3JA 2ZIGA 3MTEA 3FUUA 1UWVA 3ANXA 2G1PA 3R6TA 4AZTA 5K0FA 5EHGA 1JG2A 3K6RA 3FYDA 1BKYA 3PX3A 3FUWA 1JQ3A 1XDZA 4PIPA 1NW5A 3H2BA 4KIFA 4XUCA 3ELUA 5U4XA 4WXHA 3UJAA 3EEOA 3QV2A 4KRGA 3EPPA 5EKUA 4HRAA 2G72A 4GBED 4X61A 2P40A 3R3HA 4HGZA 4KW7A 5DWQA 2ZULA 3LDFA 1VE3A 3LBFA 3P2EA 4X41A 2P3OA 1I4WA 1NBIA 4FZVA 5EHIA 1QAMA 5EZSA 2QM3A 2GH1A 3KQOA 2YX1A 4R6XA 5HIIA 2ZBRA 1M6YA 4RWZA 5GM2A 4DZRA 4FSXA 3CKKA 2ZZMA 3GRYA 2XVAA 1RJDA 2B9EA 3ERCA 4E70A 1ZGJA 1P1CA 2GB4A 3OZTA 4IV8A 5FQOA 2H1RA 3LHDA 4QTTB 3TOSA 2GPYA 2HV9A 2PX8A 4RTPA 4F85A 4GQBA 3HA7A 4CKEA 4FS8A 1SKMA 3THRA 2C7OA 1ZQ9A 5DPMA 4R8SA 3DUWA 5EZQA 5K0LA 3I5UA 4ER6A 2IPXA 4QPNA 2FCAA 3P9NA 1L9KA 4MWZA 3OE5A 3SR4A 5E9QA 2IGTA 4P7JA 4GC9A 2FPOA 3A26A 2QE6A 3FTEA 1XDUA 4QVKA 5DM1A 1R6AA 4RVHA 2H00A 5HIKA 1YFLA 3P9KA 1XCLA 4X1OA 1VBFA 4K6MA 3EVCA 3ER9A 4OX9Y 2ZWVA 3I9FA 5BXYA 2C7QA 3OCJA 1JR4A 1O54A 2PSSA 4RVFA 5LQKA 5GIOE 1ZHFA 2B78A 3UA4A 5K01A 1MHTA 5EG5A 1QAOA 4GC5A 4E2ZA 2O57A 2PXXA 2YXEA 2VDWA 2ZBQA
chains in the Genus database with same CATH superfamily
2AMLA 4BX8A 3SKVA 5B7QA 5BVGB 1DMRA 3E3OA 3GXBA 1AMUA 1DKNA 4WD3A 2Q2NA 3FZYA 3UBTA 1QH9A 5AO9A 2H1LA 1JVSA 3C1OA 4GWKA 3PITA 4R2LA 1FS5A 1Q0UA 1U7WA 5I9IA 1DE0A 1FNCA 4K0KB 3FMVA 3LI2A 3PFNA 5LBIA 1A72A 3ZNQA 4O4IA 4OJNA 1M2OB 3QFTA 2DT5A 4Y8VA 4UE2A 4NBSA 4X97A 3AF3A 4F04A 1Y3FE 2HU7A 3H86A 4GPTA 2BN4A 3CN9A 1P2DA 2VDLB 2X23A 4MS1A 1SIBE 5JQWA 2PRIA 3RUCA 3W8RA 4OPMA 3GD7A 3ZU6A 3AM3A 1VSTA 5DM60 5TR9A 3TDNA 4NG5A 4Q16A 4ROSA 4YDSA 3SF8B 5IEJA 2VH1A 4R1MA 1PI3A 3ANSA 1FYEA 3CVVA 1S2LA 1WCXA 4YJDA 2VPXA 3EDYA 1IY2A 1R8SA 4KR0A 3B1FA 4UOQA 3PYMA 1KYIA 3AX6A 1MB4A 1FOEB 1QF9A 2GR9A 3QG5A 4P81A 1S8NA 1C8LA 1GZ7A 3KSDO 3VKUA 2EJVA 2G76A 1BYUA 3IMCA 5IULC 2PJRA 2WFZA 4F56A 1W4RA 3HZZA 4X44A 5F2KA 3EVAA 3KVOA 1K27A 4HXFB 4KYVA 3WIDA 2HDOA 3MB8A 2WE7A 5AVSA 4GI5A 2O8VA 1ID1A 1JYSA 1ORVA 1R5NA 1Y1QA 2WWGA 2ON6A 2X0DA 3W4IA 2HCRA 1JFSA 1KP9A 1KOLA 1IU9A 1EGHA 1UZLA 2PXHA 3ZUPA 5LBTA 3LC0A 4F46A 3M6FA 3N0VA 5I7RA 2DF8A 3JWGA 2HWKA 4Y6LA 4UCWA 4HWRA 1OH6A 2VC2B 3PYLA 5KQSA 3T1QA 4UATA 1E2JA 2D0DA 2P7IA 4RKYA 1SUEA 4RD0A 1FTGA 2R4UA 3CR3C 3EE6A 3GZJA 4F3YA 4IEIA 2L42A 1AN9A 1R10A 2RGNA 2IFTA 3UGTA 3ZIUA 1USIA 5BUSA 1F3OA 3L7IA 3NTLA 4NFLA 4ZYZA 1QYCA 2PR7A 5DTJA 3Q8MA 4B9AA 1Q83A 2XEDA 3KLOA 1QVRA 4XUDA 1PG2A 3GPLA 3OUZA 1UJNA 4ZPXA 1AE1A 1UP4A 3VNAA 3K73O 2SCUB 4K1XA 1OLXB 3AY7A 3CF4A 5FBWB 6YASA 1VLHA 1ZH2A 3V9PA 5THKA 1Z06A 4EW1A 3VNSA 3LUGA 1QGED 3TR6A 3B1ZA 1I1NA 1VZ3A 5C80A 1FLNA 3TZQA 5CBPB 5EKDA 3IVMA 4PC3A 1H22A 3OT4A 1CY0A 2O6HA 5BMOA 4ZCSA 2VRBA 4MV3A 2Q1TA 3RBAA 2FPWA 3CV3A 2CBGA 3QXHA 3AVTA 1NDHA 1PJTA 2HT6A 1NQ5A 2W98A 1SXQA 2GJSA 3I2KA 2GJ9A 2VHZA 4X90A 2QM8A 3T94A 5K7SA 3DHYA 3AVOA 2I8CA 3K5PA 5HILA 2ECQA 3ND6A 2PSEA 4LV5B 2ZSIA 4BWYA 2C98A 2JHPA 2VSFA 4FDVA 4J0CA 1EUCA 4E7OA 3UJ9A 3HBLA 1Y3BE 2YWEA 3GRPA 1LI7A 3KOYA 1HA3A 4I8DA 4ZEWA 4YUZA 4X66B 4UDXX 5AVZA 1GG8A 2JI9A 4D7AA 1RI2A 4TLMB 1ZH8A 1FF9A 4UMEA 3UMMA 4ABTA 4OJYA 2YN4A 2QTMA 4MWEA 4WECA 1NF9A 2RC5A 2RKOA 1EXWA 1VYTA 2LZ0A 4BMOB 2YWGA 4NULA 1YDFA 4ZGBA 1OPRA 3GLKA 3I3SR 3VZDA 5F3DA 1RYDA 1U5AA 4DSNA 4KE9A 2QZSA 4WXEA 5H4HA 1A5TA 4QXMA 3RABA 4DMKA 3C6MA 4NZOA 1RAFA 3OF2A 5EIHA 5KEIA 1GTMA 1CERA 1FDRA 1X8LA 2OFOA 1IY8A 4RDIA 4ZOLB 1QYRA 2ZJ0A 4PTLA 4FOPA 4CKEB 1M2NA 3IAS1 2Q1WA 3DLAA 4ZAYA 1P39A 4IO1A 3ORYA 2BZ0A 2ZJ5A 1SCDA 4RJJA 4NZMA 2CNLA 5EMJA 5FO0A 1M0TA 2FI1A 5DNEA 1N0IA 4BAGA 1AKMA 1ODJA 2YYYA 3QQ5A 4EYGA 1R4ZA 3UVEA 1HLGA 3GUHA 3UUEA 4BV8A 5KPJA 1SXGA 2ZDGA 2ZS9A 3LHSA 4ZVPA 1JILA 4C7BA 1WSDA 3QI2A 3GJQA 4L78A 4R1UA 1PSDA 4JL8A 2E49A 1N8SA 3PHGA 3CVOA 3PDCA 4RL6A 3V4ZA 1MHTA 3RSQA 1P9RA 1DQRA 4DXHA 4CEIB 1B6SA 1Z34A 1JA1A 3FF1A 4PBRA 2RI6A 4WJZA 5EP4A 2JFXA 2QVLA 3HYLA 4KIUA 4OREX 2ZAYA 3A0RB 4PR0A 4PFJA 4RIGA 3Q5EA 1J8MF 4EMBA 5HRUA 4K9OA 2D06A 4RC9A 4YJFB 3PPVA 4NICA 3ER8A 2VIIA 3LUBA 4IY1A 4PYIA 3PVSA 5PNTA 1DWUA 2ZJBA 2QP9X 5BW6B 3E84A 1P61B 1W1WA 2QS9A 3CNEA 1ESDA 3D7KA 3MJEA 4MEBA 1VCOA 1YMQA 4AZ0B 1FFBA 4DM4A 4J6FA 4AWXA 2X15A 2BRUC 1U6KA 3P2IA 1Y1SA 4ALIA 4UW9A 3KL4A 1FP2A 4RM3A 4C04A 1R3UA 3WKEA 2JIPA 2BW0A 2JH9A 2ZAGA 3B1XA 3E4DA 4V24A 2PL3A 3N07A 4PHFA 4UEWA 3L77A 1JYEA 3STVA 4ILKA 4Z9BA 3WSTA 3KQLA 2BEJA 3UTDA 3TG2A 3JPWA 3RS2A 1NX6A 3H2SA 2PXAA 3DE5X 4O4IB 5TNXA 1E2MA 4MQ4A 4G67A 5F5XA 3DOUA 1RM3A 1YK0A 2V4ZA 3E15A 3I52A 1UAAA 2VYVA 4FMBB 3LXXA 4J0EA 4CDMA 4DDHA 5A4DA 5JZMA 1OZHA 3QKRB 3QLEA 2OSVA 3NWJA 4DLUA 3I9LA 1O94C 5C0OE 1GCUA 3TPZA 4DM3A 5JAHA 2H3EA 3X44A 4QQFA 2ZJ2A 4PYRA 6ABPA 3D8NA 3LNTA 4ZT4A 2NADA 3FHOA 4UAUA 4HGPA 1U3CA 2OBYA 3PUXA 4A5OA 5KYVA 8ADHA 5M34A 2IU4A 3A28A 3FNRA 3TXYA 2OO5C 2KX7A 4IIVA 4F96A 1UBGA 5CCEA 4IXTA 2QYOA 3L46A 1N78A 4ON9A 2QRQA 3OQNA 3SK0A 4NYJQ 4TN1A 1C9EA 1UMDA 3FPAA 5KINB 1LPMA 2RKWA 4DV3B 1Z74A 2OV2A 1U0TA 3GARA 3PA6A 2A9KA 1ADBA 1D9XA 2V7UA 4OK6A 5DHUA 3T6KA 2ZUSA 3ZY4A 3C3YA 4ZQHA 1JPVA 1II9A 1XP8A 3DVAA 5JNLA 3J81k 4CEJB 3I2HA 4XUEA 3RVDA 1Z6AA 1DRJA 4QXPA 1G8SA 3EWNA 4OVKA 3HCDA 2IS2A 1ODSA 1UPXA 2B1IA 2H2GA 2EP8A 4W82A 1E77A 2I2XB 1DL5A 2P0AA 1YZYA 4OF4A 1TGYA 3I1FA 3CRVA 5LOVB 3SICE 3OG9A 4H59A 4WGFA 3MJFA 1TM4E 3MTDA 4HH3C 3OTWA 2R87A 4IQ8A 4XKJA 4HRVA 3WZ2A 1DEXA 2A0KA 2E89A 2VLIA 3FLAA 3PU6A 1YVPA 2WJZB 4JUCA 8GPBA 2C2OA 1G5FA 2RG1A 3SQOA 2QE7A 3IJEB 2IWHA 3E2MA 4QOSA 3UAYA 5B57C 4RTJA 2YASA 3OBIA 1IZ8A 4UPEA 3LG2A 1IOVA 4JVNA 1KJNA 1ONPA 2H63A 2KWIA 2W48A 3A0UA 4FFNA 4AMVA 1USVA 3K71B 2W4QA 1N34B 4JXJA 3MCZA 4XDHA 4ALMA 4Q4CA 1SULA 1QP0A 1IULA 3JZAA 1ZI6A 4F9GA 2PX2A 4NDNE 2FUEA 1PO7A 5CYFA 1FA9A 3RAJA 1T2UA 2ERYA 1R5BA 3LDAA 2HGZA 4EUFA 3KELA 1EBFA 1GDDA 3KAJA 1NLYA 3QE9Y 3H5OA 4DUGA 6ADHA 3PCTA 1SVKA 3C4VA 4A92A 3OZRA 2WINI 4BBPA 5FOVA 1RRFA 3KVNA 5F9HA 4Y67A 4IFEA 2J3KA 1U6IA 1D04A 2VF5X 2YIJA 3NDRA 2C7VA 5CA1F 1YQGA 4OYYA 1BZYA 1B2LA 2H7VA 2IUFA 1T3HA 5CT6A 1RPNA 3TEFA 4AYWA 4F3RA 2DY1A 1BEZA 1EX7A 5F7ZA 3T5DA 3VYWA 4F4JA 4KEAA 1CRPA 1EVZA 1KAGA 3OPNA 3ZU2A 1W0KD 3G2NA 3BMCB 2R79A 4FDLA 3F67A 1NTOA 2VAVA 3K8YA 1JJAA 1U3WA 4C3UA 1FDVA 7GPBA 3STTA 4LV8B 3EVZA 2JZCA 4YLEA 3S29A 2PKEA 4MUAA 4E32A 2AN9A 3VR4H 2OCGA 4ZK2A 3VO8A 2WU0A 4ARCA 4GBGA 1P2TA 1TCAA 2WQZA 3QOWA 2EX0A 1W44A 4PNEA 4MS4B 2G36A 1PZHA 2C31A 4YN3A 2IBSA 1O6ZA 2AKYA 3KOWA 2PBRA 5I7HA 3GLHA 4FUTA 3L4JA 2FFHA 4KOAA 1G7TA 1TIBA 1Y63A 2GBLA 4A7PA 1WV0A 4PYQA 1XTZA 2JBAA 1GRRA 3GLHB 4YK7A 2PGDA 5CFOA 1KHHA 4G36A 1YKGA 4MYSA 2AN5A 2VOEA 1GGJA 2AG1A 2G28A 2CF6A 2Q8PA 3W7BA 5IKEA 1QR6A 1VIMA 2DULA 2IHUA 1XZ8A 3KVYA 2KSQA 2FPSA 3AK4A 3RYIA 1E6MA 2EDCA 4Z51A 2NQTA 4ND4A 4ZDWA 1UQRA 1H4SA 4DA0A 3PDWA 2IY9A 4R9UC 3NWBA 2GXSA 3ZGLA 3AF1A 3PT9A 1DQZA 1J8DA 1FP7A 2Q1YA 1E5DA 1P3DA 1RAAA 3OU6A 2R8YA 4G1MB 3TW6A 3GGCA 2OFWA 5I7FA 1E3LA 4B35A 4ESOA 1OVGA 1JFRA 1IPEA 3EEBA 1AZLA 1S8OA 2HF7A 3TIVA 3KTAB 2PN1A 4REQA 4EYSA 4URHA 2BYTA 1WX1A 3MVEA 4MI6A 1JJVA 2QTNA 1Q0PA 3E9CA 2IHVA 1QC5B 2GXQA 2WV7A 3BK2A 4G86A 4HQ6A 4I5EA 4I8XA 5JDIC 4D98A 1ESZA 2ID8A 3GCDA 1Z3IX 5I8WA 3LQFA 5IDWA 4S0XA 1UXOA 1CQJB 3AR4A 4C30A 4MPDA 4RXUA 5BSFA 4KO8A 4LMBA 2QLMA 3HZHA 3F47A 3JVDA 2RARA 4M0LA 2PYZA 4I19A 5DCUA 4BLVA 3CBGA 1DPFA 4ATNA 2OENG 5TSDA 3MIIA 1E3IA 1MJFA 2HRZA 3PI7A 3WLMA 5I7SA 1NNLA 1NN5A 5ENZA 4QUDA 1O0SA 1VM6A 2I1WA 4TL8A 2RH4A 3AXSA 3WWYA 4PYNA 1UPAA 1LNSA 4ZYTA 3VJRA 2BFCA 1IH8A 2CB0A 2W8BB 3OCUA 1RAGA 3PB3A 1OIXA 4IVRA 4AO8A 4ENUA 4MI9A 1OXSC 1S1MA 2DU8A 2H2AA 2C9DA 2BJWA 2QRGA 1QORA 1TT5A 4WJKB 1IN1A 2AQKA 1VBNA 3N53A 5G02A 3IP6A 3M6MD 4ID9A 4W1PA 4DLLA 1NDQA 4YJ3F 1DPGA 3PRJA 2JLVA 2Y1GA 4YQZA 3SMQA 1KU0A 3C8DA 1GSOA 4CTKA 5DRTA 4RUKA 1E2DA 1GITA 4M9QA 4PSCA 3DDOA 4QDOA 4WOCA 1CHDA 4AZTA 4BHTA 5DH9A 4FCTA 3GCGA 1VYVA 5EHGA 1KQPA 2FMFA 4DTIA 2HV8A 1WHTB 3SDSA 1E3SA 1AQLA 1TTPB 2J1LA 3IKJA 4K86A 3VPSA 2GDZA 1U2SA 2J5KA 3EFOB 3EGXA 3C5VA 1ORDA 4YAFA 5F98A 1KEZA 2UV8A 2W6OA 4EZIA 1OH8A 3THXB 2NYRA 3KSRA 3PDJA 3C1UA 2ZRCA 4HGZA 3S70A 2O48X 3DP9A 4MR7B 1G21A 2GZAA 3AM4A 4GZ5A 2XT9A 2QG9A 1VL2A 2F1IA 3CRQA 3IOCA 1LQUA 2IV3A 1GWNA 1R0SA 1GAWA 3EUFA 3L05A 1SKAA 2QM3A 3V34A 2O59A 5LYYA 1RWOA 1E61A 2G07A 4IRMA 1H5NA 4M0MA 1R3DA 1RJDA 4TTRA 1EVYA 1JH8A 3CIOA 1SXJE 5JZ9A 4QTTB 1DQPA 4B4KA 1WTAA 1RVDA 1SVIA 3ECSA 4L8FA 2P1ZA 3PJFA 1SKMA 3RQIA 1QH1B 1CF2O 1ZW6A 1H2FA 4R8SA 4F7WA 4GT1A 4LTNA 2FUG1 2XTJA 4DABA 1XHFA 2XB4A 2XKAA 3SC2B 2YWBA 3DE6X 4DTCA 3D02A 4Y0AA 4RZXA 1O95C 2QX9A 5TQVA 1N5RA 2I4MA 1FZTA 3UCXA 2IOYA 1UKCA 5FEUA 4TTTS 1PNVA 2A0YA 1KDYA 5DBEX 1VBFA 4OJMX 3ER9A 3KKNA 4BX2A 1QPBA 3G79A 2DTEA 3PWZA 3NR2A 4M1YA 4YAUA 1ZHFA 4AWBA 2IYQA 5M7EA 1T4MA 4D8WA 2VFAA 3FG9A 1YNSA 3FPKA 3DBRB 3QVKA 4UQOA 1NOJA 2YYSA 1R0WA 4QBHA 3V8NA 4BMVA 1OIVA 3HLTA 1FW6A 3BB4A 4TTQA 5FV7A 1T3SA 3EZLA 1OX4A 3FCXA 1DO8A 4MRVA 1E3QA 3WIBA 1MH1A 4UQPA 5FUQA 1GPAA 2JLAA 3LVRE 3DKPA 3E8SA 3WX0A 2FNAA 3RTEA 5TLSA 1IM5A 2IYTA 4N03A 3JD2A 2IU0A 3GRZA 2X9LA 3RNOA 4HF7A 5CEJA 3GFPA 1Y3HA 5TQ2B 4MCHA 1YA6A 1TVKA 2QLTA 2ZSEA 4HFNA 1ZWLA 2H8KA 4FGKA 3GLFA 3FCEA 1RIIA 2Q3LA 3U7QB 2VYNA 3FMFA 3CO0S 3HC7A 4NPHA 3VDNB 4AICA 4EFNA 1C7EA 2HMUA 3BWXA 5BN5B 4EELA 4I1RA 2BGWA 3LNCA 3O4IA 2GHIA 1R6UA 3B78A 5IHXA 3SYTA 1NJGA 2IIBA 2EFJA 1XJCA 5GVRA 3MCVA 1QRSA 2HGSA 3C3AA 2EL7A 1HLDA 3QM1A 1AOXA 3MT0A 1EJBA 1I4TD 3HXKA 4GOXA 4MKZA 2VCHA 1F17A 3MMNA 3E35A 4TWIA 2ZIXA 3ZGXA 1KZYC 4M1KA 2FJUA 3FYUB 3GT0A 4WNCA 2KM1A 1NPTO 1E7YA 2F3PA 4I36A 1RPTA 2QQ0A 5AKHA 1CT9A 2O5CA 2Z2JA 4EECA 3IUPA 1C1DA 1IEVA 2P4UA 4LRYA 5H16A 3LY8A 4DE5A 2BFBA 3EAGA 1E2BA 4BEJA 1X42A 2AG6A 3AI3A 3Q87B 1J9GA 4RVDA 3WB9A 4GECA 3KAQA 4Y98A 1HKUA 3EXAA 5H80A 2VP5A 3BMNB 1KR5A 2GBLC 4HXGA 3Q15C 4Q4LA 4U9UA 3WO1A 3M6IA 4HATA 3RS3A 3BGOS 2F55A 2ZSHA 2HRBA 1P19A 4P4TA 3P71T 1MRSA 1AKTA 2WG1A 4YWJA 1VIVA 3HU3A 1NMEA 4PSUA 1BH6A 4Z9YA 2OSBA 1O95A 3KEOA 1D4FA 4HY3A 3TNFA 1Z5NA 4GI1A 2YOHA 4PQEA 3DMDA 3P52A 2NQ2C 4HTFA 3WL4A 2UYCA 1E7SA 1TLLA 1VYHA 2TMKA 1E1CA 7MHTA 3IVRA 5JAPA 2XF2A 1B7GO 1H05A 1TFRA 3FSEA 2VDJA 3Q6IA 2X2PA 3LQ1A 1R4AA 1WJGA 3NRBA 2XB2A 1F0PA 4Y6PA 1BDJA 5I47A 3JWIA 3L2OB 4HAIA 3NGXA 2F62A 1T3GA 1UWKA 3RE1A 1H65A 2F9LA 2LCFA 2QN9A 2XDAA 3REOA 3SHQA 3SYRA 5IF3A 4KN9S 4M49A 2DSTA 2YZNA 5EUQB 3DLHA 2ZBVA 1Q19A 3OPVA 1IHOA 2KE5A 2OCYC 2Q9CA 4LJLA 4Q3OA 5L3RA 2HQBA 4CDNA 4MRPA 4N8EA 2VHVA 2W90A 4F45A 4IDFA 3KYIB 4W1SA 5KYYB 2FXVA 5UKDA 3TRKA 2EZ9A 1X86B 1N2XA 2VWPA 3LW7A 3C3PA 2AOTB 3FE2A 3H05A 4KG7A 4YONB 1JGTA 1GXSB 3EBOA 2PZAA 5DM2A 3O4GA 4RS3A 2X1MA 1IOLA 1P2GA 4L6AA 2R6HA 3N76A 4QYMA 2C03A 2Q4DA 4B3RB 1EM8B 2G25A 2HWUA 3DL0A 2F64A 4YC7A 3W8EA 4UFPA 3H3FA 3PTAA 2GI4A 1A7UA 3STXA 2PAFA 4L72A 4QIHA 3L7NA 5A02A 1P1KA 2OMKA 1NL3A 1T4BA 5IBCA 1Z38A 1CCWA 2C2MA 2IOFK 3LHKA 2H0AA 3NC1C 4MICA 5ECGC 2HCTA 2G9VA 5BUZA 4EPVA 2QPTA 2I9KA 4URYR 2J0VA 4AJNA 3WS7A 1K2VN 4EJ0A 4ZZ3A 3WGIA 5LMNB 1DBQA 2BAGA 3BREA 1DAMA 2XXAB 1G7CA 5G41A 3NZEA 3DTVA 3KXLA 3HUUA 4NXMB 2VHJA 4KPEC 2BGRA 4IWYA 2YRFA 3D59A 4KAAA 4WH0A 5F73A 4KFCA 4JC4A 5AVRA 2V7EA 4Y1RA 3EK2A 4FW9A 1BCSA 2PJUA 3EZ6A 3O9ZA 3QFFA 4M1SA 5JT1A 1JVBA 5E3IA 3TLBA 3HJNA 1ISJA 3O74A 1UFRA 5DYIA 2Z6UA 2AFVA 1GPBA 1XXLA 3JARA 4QLOA 3BSYA 3ZHSA 1YSCA 2Z4SA 4AY5A 4WBNF 4PQYA 4C2BA 4IRXA 2Z8YA 2ZRJA 4EL5A 3ZV4A 1CHNA 2OORA 2YQ4A 1O5TA 1T4DA 2W6ID 2MSNA 2V58A 4TV9B 4YJKA 3I62A 1MRNA 5F1OA 1J5EB 5DHAA 1H2YA 2JH3A 3DF7A 5DGTA 1U8ZA 2P30A 1X7DA 2AMJA 2GCIA 2E82A 3RV4A 3NXKA 3X1KA 1M1XB 3GIWA 4ODIA 4ZVUA 3BDAA 3VU9B 4R1SA 3LUJA 3AO0B 3F9IA 1UOOA 4EPRA 4Z4HA 2ORWA 2HA6A 1Z0UA 2CVOA 5ITSA 2BC9A 3HCPA 3O94A 1PD0A 1RPZA 1FTNA 4G5RA 2FEOA 4OBBA 3P9XA 3EIFA 4Q4HB 3WA7A 1P0QA 4RTKA 2DKFA 1A97A 4RDCA 1U2TA 2XNSA 2PUBA 3VKFA 4KQFA 4OQPA 4XR9A 1KDPA 2BFDA 2YS7A 4FDUA 3MBKA 2FLVA 4LJYA 4RK5A 3T1YB 1X7YB 2VPQA 1T35A 3CZPA 4ZODA 3ORRA 4OJKA 4PZEA 5BPHA 1W4BA 3LBHA 3D81A 4KR7A 2BGMA 4BFVA 2CYCA 3LYHA 1VMDA 1D7AA 2NO9A 2WT9A 3RYFB 4DQDA 1RWNA 1T36B 2A8YA 3AFNA 4JP8A 4R54A 4ZAWA 2FEAA 2M6LA 1PJ3A 3QLUA 4B6FA 3GLGE 5A9TA 2V6GA 4W63A 4U5QA 3ZEAA 3TGLA 3D0OA 3L0PA 5BN4A 2VPWA 3ZWBA 1G2IA 2UZ1B 1SCUB 2FG7C 2P69A 4EFKA 5KZMB 4KXQA 4YRDA 3OLXA 5F4BA 4XW2A 2XCTB 3TBKA 3MOSA 4W9RA 1KZ4A 2G8NA 1X1BA 3LLSA 3GPBA 4QVIA 1F48A 1SCNE 1ZJJA 3BXHA 5J2UA 4A8JA 1JEOA 4G5YA 3P9CA 5LC1A 3U61B 3OQIA 4B82A 5EJGA 2OZVA 3BYZA 2WIJA 4B3MB 1YJ8A 5BWBA 4LF6B 2K6GA 1O03A 3QHAA 5DXAA 1E4OA 4KH1A 1CQPA 3ZK8A 1E7MA 2Q9AA 4WDRA 4LW8A 4FYXA 4DUYB 2VRWA 4BMDA 4ZFNA 4D45A 2BDUA 3KFVA 1C0LA 3MQ4A 4FFDA 3SX2A 4BNJA 1JN0A 2R6R1 1G5IA 1NJFA 2YWCA 4R8RA 5K3BA 2C7RA 1NJ2A 1O94A 1RHQA 5E9JA 2Z9CA 3PC8C 4JEMA 2Q8NA 3B85A 3DMYA 4LGYA 5DNUA 3MXOA 4F4CA 1ZLXA 4ER3A 5C81A 2F90A 4E51A 3SJBA 2O1SA 4B6EA 2BFEB 5FPHA 1EDDA 4I7EA 2I3AA 1WCIB 2Q8QA 3BXEA 5ALUA 3UUGA 1AIPA 3FPGA 3T38A 3A3PA 4MHTA 5JASA 2D1RA 3DKKA 1GZHB 3NG1A 3OTQA 4LDPA 3UWKA 5EGSA 1JDSA 4AL4A 2DQYA 3FHTA 2QVGA 2HMVA 5DI3B 5JH7A 4P98A 4DAOA 4ZOCA 3AFGA 3A4TA 1YD7A 1CDOA 1GOTA 1H2HA 2VDQB 3FZEA 5EI5A 1ISSA 5H7XA 5IBPA 1LWNA 3RFXA 3SZRA 3VYRB 9LDBA 1U3FA 5FL3A 4I0WB 1T1EA 3WISA 2BF7A 2C3UA 3DCNA 4IHJB 1ZCBA 3H3JA 1BAPA 2OPBA 1HNXB 2NU7A 3U3KA 1HDRA 2YCBA 4KDFA 3W5DA 1PEDA 1X7XA 3INGA 3IRUA 3N59A 2CXQA 4JC0A 3DL2A 1M8KA 1PS9A 2OZLA 2R8PA 2A0XA 1VC2A 1KSFX 3CEAA 1U0JA 2Z3ZA 1U7PA 1UWLA 2CLMB 3KG2A 3OQIB 4CR8A 2QEQA 3ZQJA 3K5IA 4KLAA 5FWAA 3H7AA 1L1QA 2WUEA 3N6XA 1YT5A 4FX2A 1J5XA 5IRCD 3G8CA 2Z4RA 4D8UA 4YP0A 1BE8A 3PNVA 5DN6D 3U5ZB 2FUNB 2QMZA 5CCDA 2JGFA 2YVAA 1L5KA 5A6SB 5B6PA 1XNQB 4YAEA 2VF2A 4OSOA 4MKGA 4BQIA 1P1HA 1O4WA 2NP7A 2F4NA 2HEGA 2NV6A 2REOA 4HN2A 4G24A 4KO3S 3A1DA 1NT2A 4XVCA 3PFIA 3THYA 3L5KA 1RPAA 1J1UA 4YI3A 2PH7A 5ALXA 5F7JA 2JLSA 4PTYA 3PG5A 5A4MS 2LV8A 4XX0B 4CQLB 3FKQA 4XPIA 4ENRA 1M34A 1Y42X 5C8XA 5LR6A 1NQVA 1WIWA 3DBOB 3DH0A 3FCUB 3ZZ1A 1QYDA 3C7DB 3E5RA 4OHBA 1YS1X 2BBTA 3R74A 4A3SA 4ZAGA 4BO9A 3KEMA 1H8HA 2O0JA 2N1BA 3BRWA 1AHIA 4I9HA 4IX1A 2DWPA 4O63O 1I30A 1DXHA 3NHMA 1Y5NA 4OTZA 2YHUA 4P3YA 2AZXA 1Y6ZA 3HKCA 3MWYW 4HPWA 3GRVA 3RRJA 3UAOA 2UVPA 5BQ3A 2RGRA 2A35A 3IOEA 4OLFA 4H4DA 5BSMA 4N39A 3W3ZB 1N6OA 4DCVA 5CFRA 3CX4A 3KFXA 3PUIA 5JZBA 4P7KA 4RJLA 1WETA 4IVNA 4XD7D 4R05A 3L18A 4OQQA 4OQNA 2B8NA 5KNBH 4TV9A 2MR6A 1E0DA 4J0QA 2VBFA 2IW3A 2PO7A 3DMFA 4TGLA 3AONB 3TYXA 1JQKA 3WJ2A 2WWXA 4IS3A 2VK8A 1HSZA 2CVQA 3SIRA 2WKQA 2OE2A 2Q6VA 2PRZA 2I03A 5E3HA 4XWGA 1GLVA 1NXVA 1RRVA 1ZI8A 2YIVX 4EGFA 2ZUEA 4H08A 1OLSB 4HPXB 5GONF 2NAPA 1LK0A 1YR7A 2EQ5A 2J9ZB 1S2NA 1WCYA 4G85A 4GXRA 4HEA6 2LW7A 4P32A 3R7AA 3RVRA 3WP1B 4B46A 2BGJA 2HQRA 1FQKA 5KTSA 1LLUA 4GOJA 4YP7A 4CUJA 3A4YA 4MQLA 4K28A 5REQB 3LQQA 4P54A 2XZPA 3D7RA 3WWCA 2P8JA 3OFKA 3CVXA 4OI0A 1AGPA 3FUTA 3ZWNA 4JLVA 4IJ5A 1YASA 4MW5A 3QTTA 3E3AA 2KLHA 1CVIA 1O7JA 1M2JA 3IIIA 1NA5A 4LBWA 1XMXA 2WWTA 4K40A 3K31A 2EC5A 4WLFA 1I9GA 1LV8A 3IT1A 4XASA 5AJUA 4ZEXA 3RYFA 2JGRA 3DD5A 3TRJA 4P92A 4CCAA 1KI6A 3O47A 5JUWA 3BWMA 2XNDD 1SD5A 3K2BA 5J47A 1F6BA 4JOSA 3V42A 2D3WA 3G0DA 3VU8A 4PSDA 1E0JA 3GJ8A 2WUVA 3REQA 5CW1A 4I1SA 2VDOB 3VR4A 1H2ZA 2NZXA 3A06A 5DV9A 1UIMA 1SG9A 1IRXA 2W6CX 3KBBA 1ZUD1 1TF7A 1Z33A 5FR2A 3Q88A 1Z5ZA 4LYDA 4XIJA 3W5JA 2XTZA 4PC6A 4LZNA 8ATCA 3FW1A 5CT8A 3OZFA 1ZM9A 1U31A 1V3UA 3HKBA 2C61A 4XSGA 5HTKA 3ZTWA 1PJBA 1Q0HA 3LPAA 2VPZA 5I51A 5KNLA 1XYGA 4RQTA 1F5SA 1NOKA 3GD5A 5K0FA 3MGBA 2ZRNA 3NEYA 2OM2A 1AJEA 4AZ0A 3PSAA 2WPDA 2Z1MA 3P32A 1HBJA 1EP2B 3Q0TA 2MJLA 4WXHA 5LQMA 3B8HA 5L3QA 2JA2A 2F8SA 2WTEA 1YB4A 3C14C 1POWA 1R4NB 3ITDA 4PY2A 4F3KA 5CD9A 3NPMA 1NYLA 3C4JA 2C1XA 5CTAA 4P53A 5TDHA 3L0IB 4EL0A 1MX9A 4DR2B 3N0TA 1Q21A 1CX9B 4H15A 4HJXA 3LBFA 1PFVA 4MVJD 4NF2A 1GPUA 1S6YA 4UMDA 2P3OA 4F2PA 1ND5A 3FFAA 2V9CA 3ESCA 1LPPA 2FZKA 2HU8A 1MNAA 3CT6A 2FWPA 3D8TA 1AS0A 3HY6A 2C57A 2ZUWA 1QH0A 1RQPA 5ALGA 1VG1A 5ER6A 3T4XA 2UZAA 3HXLA 5JMOA 4FSXA 1P8AA 3VZBA 4MDFA 1M54A 1CUJA 4MWTA 3ROXA 1KARA 2P2CA 3W5HA 1XRLA 4FN5A 1SBZA 3GBVA 4K03A 1YXMA 3F73A 4QA9A 1U0RA 2PUAA 2HV9A 2RCNA 4YVFA 3N0WA 4ZVMA 1X92A 1ND6A 2BH9A 4CKEA 1KK2A 1VPDA 1I7SB 5JALA 3F0TA 3Q7PA 4C88A 3MQFA 3BWEA 3UPDA 5B12A 4TTVA 5K5EA 1Z45A 5JYBA 1KMNA 1TM7E 4MWZA 3DNPA 1FDTA 1BDBA 1LPSA 1ZIDA 3I2JA 3BXPA 4F9TA 1A8QA 1R9MA 3CPEA 4H7IA 1DV1A 1E62A 4B85A 3H2YA 1PE0A 5BNTA 2MMCA 2H48A 1PAUA 1RYZA 2Z8XA 3EA4A 1JH9A 2ADFA 3WV5A 3M4NA 3ZCQA 4FE3A 2VXOA 3RHZA 5BXYA 3L6UA 1GXSA 4BJ5A 3KXPA 1RZUA 4JDUA 1YBFA 4GLJA 3LWNA 1I14A 3AR6A 1RABA 1BJRE 1M6NA 3FD8A 1TUBA 1BCRA 3JQBC 2FSHA 2UUBB 4KR3A 2P2GA 2B4AA 1N6IA 1Z6XA 1PGOA 3ROKA 4OHCA 5FPYA 4WY5A 1FFDA 2A5GA 4ZQGA 2Y3IA 3DOJA 5HBGA 3TIIA 1F9EA 5CEEA 3KK0A 3GB9A 4RY2A 4I8IA 1ICIA 2ZDQA 5F7XA 1PW7A 4GX2A 4WFQA 4AJOA 3O4VA 5A1TA 1EEXB 2QTZA 3L6EA 2XSZA 3NBZC 1VRCA 1IAVA 2PR2A 3OOSA 4K5QA 4OYLA 3KJGA 1U2DC 4AY4A 2W8ZA 2IBTA 3N5KA 4X7BA 4OLHA 2GPJA 3HO6A 4ZCIA 4KVZA 3CVUA 3PHBE 1OTHA 2J4FA 1O58A 2NSHA 4JYZA 2ID9A 4KMOA 4QQKA 3ILSA 2XECA 4TV8F 1XZFA 3HCCA 1NQAO 3UMGA 4TXNA 4CUZA 4ETWA 3FTPA 2FPGA 4HLDA 4YPFA 4PPNA 4EAQA 4QWMA 2OXRA 2ZE8A 4JUFA 4PINA 1XALA 1GTG1 2L82A 2DUUA 2NV0A 3K09C 4JGIA 3SVLA 2R7LA 4GICA 3GRAA 4M0EA 4KSCA 2MMGA 2CSUA 2GZ1A 2JGAA 2MINA 4UTXA 3LDUA 3A3YA 4MA5A 1XTVA 1A4XA 2GPBA 2PMKA 2VEOA 3HB0A 4HKTA 3S2FA 1M67A 4DLSA 2VJCA 1AXEA 1QR2A 1SBIA 2AW3A 2GLXA 3IAEA 4M46A 3E3LA 3OPYI 2PQMA 2C4MA 3NAMA 3CU5A 3DR5A 3KJZA 5E38A 5LZ4A 3R9IA 1IJKA 3HCNA 4DKJA 2Z8YM 4J1NA 1MQAA 3IEXA 3FJ1A 5FTMA 3QLVC 3UWPA 3JWHA 3DZDA 3GNTA 1BS2A 4CHGA 2DYKA 4ZVLA 1GL7A 3F4LA 4MARA 2QN3A 5ERGB 2RK4A 1YVEI 2VJQA 3SX4A 5MGBA 3ZGOA 2O19A 1KPGA 4IJKA 4JL6A 2X6RA 4KB5A 4MIKA 3COPA 1QMGA 4R84A 5FTWA 3IA2A 4R31A 1HPLA 4ZIRB 1WZEA 4LXUA 1YCFA 1TMKA 5AICA 1SBTA 3UKDA 3V6MA 4GWLA 3HN6A 5BMVB 1ABBA 2QRZA 2BFFA 3BM5A 3EUWA 3FOEC 3T7IA 1L8XA 3BA1A 4DPLA 1OFUA 1V1JA 2FWMX 5IHPA 3B8EA 3C8MA 1VJRA 2CDCA 3EQ2A 2WMOB 3GVXA 4DM7A 1UBUS 2O3SA 4X7PA 1CR0A 1FLVA 1V5IA 4J6EA 3EAQA 3IURA 5E7IA 3EGVA 4JJKA 4TZ6A 3D6FA 1TYAE 3RRMA 5CCXA 2RGXA 1XBTA 3SEAA 1VCHA 1UDAA 3WGHA 1WZNA 2Q5FA 4BCCA 4MW0A 3V55A 2X5JO 5TY0A 1XTJA 3UJCA 2V5VA 3DSRA 4O4HA 3T3GA 3C98A 3CF4G 4R16A 1BS9A 1GKKA 4ZV7A 3W1VA 2HF8A 5TX7A 3HN2A 5IYZB 3E3NA 3CEMA 3FYUA 4DEYA 2JHGA 2P4EA 1AK9A 2HLDA 2FZGA 5FLYA 2ZWOA 3VH2A 2CXOA 1UBCA 1TAGA 3UMBA 2NAFA 2NV2B 1AS3A 4OQXA 3MS4A 2OVFA 2PBZA 3IUQA 3E9ZA 5DIZA 3KOXA 1IXKA 4YPOA 1NP3A 2EJTA 1NUQA 4RPCA 1IN4A 5M04A 2HEIA 2Y9MB 4YRPA 1AB6A 3WLSA 1TVEA 3FSRA 4GNKA 4LTDA 4N0MA 3SJCA 3PR2B 4ZEOA 1JA0A 1SCBA 3RR2A 1E8MA 4ZVOA 3OEHD 3VR6A 3SMVA 3K1JA 4TTAA 1OR8A 4KHZA 4EG1A 3CF2A 1DAHA 1CETA 1XQ6A 1YQEA 3PC2A 5TQ2A 1C7FA 4N47A 4ZYVA 1F51E 2YS6A 3FVWA 4WIAA 3U4QB 1E4VA 4DNPA 4OOFA 5HGJA 5FNVF 3LRXA 4DBZA 1H6DA 4DLNA 1Q22A 4U1RA 5CIWA 5DGIA 3HB4X 1YGYA 3HJCA 2GN6A 1XMIA 2ORIA 1XQXA 1FQJA 5J4KA 3Q7TA 4V0QA 1XIVA 2BT4A 3PK0A 1NVFA 3KHSA 5FUBA 3R0ZA 4Y2UA 3U3RA 1G9TA 3CE9A 4ENVA 1GL6A 3KAKA 4J1QA 4KWIA 5FWDA 1FFYA 2IRWA 1K3FA 3RHFA 3CLSD 3H5NA 1NQTA 1V35A 5E9AA 4ER7A 4B6JA 2IXAA 3F98A 4GQIA 4IZOA 4D56A 4IINA 3LXRA 2FSUA 5DU2A 1IRIA 4QUAA 4O5AA 4YRAA 1OA0A 1U7ZA 2Z9BA 1UOPA 1IQPA 3L1JA 4ZZ2A 3RSSA 5JPCA 4NR0A 4XJSA 2RG7A 1XFDA 4LJ6A 3OJOA 1PFKA 4MVJH 1XCPA 5TEWA 3RF7A 4LHSA 5HOQA 3CVWA 3O1JC 3TLGA 1H1LA 4UQLA 3O92A 5J2UB 3ULKA 2R3SA 4QASA 5DBFA 2DY0A 2J46A 1L9XA 2QB5A 4JUDX 4W9NC 3K5HA 3VVLA 4KR6A 1HUQA 4S1TA 4YJFA 2HIGA 1BEUB 2CZQA 3GAMA 2KBEA 2YC4C 4TSFA 5FA6A 5AR1A 1U65A 4QBFA 1SXJD 1QFYA 2AIRA 1B8OA 2D62A 1WXXA 5GGYA 1H42A 1STOA 4FHEA 4KBGA 4BLUA 5EIXA 3TMAA 3RTGA 1REQA 2CKMA 4RLQA 1D5CA 3F8TA 1Y82A 4CM7A 3PUHA 4QPDA 1EFTA 1RR6A 2BD0A 3HB1A 3RAFC 1T5IA 3MGKA 4L28A 4RSRA 1B1CA 3OQVA 3IAM6 1VHWA 5JDCA 2NUPA 2OHGA 1A96A 3PJDA 4MVXA 5BWCA 4S2UA 1JHZA 2VDRB 2QXUA 3EJWA 5G53C 3JZDA 1M74A 4QGAA 4LCJA 4NAUA 3SQWA 2GHRA 4IIHA 2ATIA 1RXYA 2GZMA 3EUAA 1PVVA 3I8OA 1EK5A 3RIHA 1U3GA 5IUNC 4B09A 3OQMA 2HCJB 4MAMA 1WDWB 1PG5A 2VQDA 3BD9A 2CN1A 1GL9B 3BMQA 3F49S 2PV7A 4FE4A 4K6HA 2I3GA 4K9SA 2VT2A 3A1FA 3RT1A 3ZV6A 2WMYA 4ARVA 4N49A 2JFYA 2B20A 2YHIB 4DWJA 4QJIA 5CCBA 1JDPA 2WAAA 4RVSA 2XUIA 3BIJA 2P2LA 4NZ9A 3NIGB 4J91A 1VGVA 2IF2A 2WJYA 1LPNA 1K8RA 2AYXA 3H13A 1YJQA 3IDZA 4AKEA 1QCCA 4UBLA 4IMPA 5T3UA 9GPBA 3SOPA 2ZU0C 3O26A 3OZCA 4BLRA 2CZCA 3DC7A 5EJFA 2AE2A 3WJ7A 1YB1A 4XCQA 3C3CA 2JFZA 1EXDA 4PG4A 4JELA 3KDPA 3UTCA 4OB7A 3RARA 5KNBD 3GQVA 3TSZA 1J8VA 1V41E 3PBKA 4OHZA 4ARZA 3H0EA 1Y8CA 2R7AA 3CA8A 3DCIA 4P5PA 3ZIDA 4KV9A 2E7ZA 4U5XA 3SY8A 3X1WA 2WVGA 1Z08A 4RMIA 4HFJA 4XYBA 2VSYA 3H2JA 3HM9A 1IJFA 2V3VA 4Y9DA 5KMGA 4PRYA 4TLLB 4D2IA 3SQDA 2L2QA 1YBMA 4KWCA 4WEOA 4RQAA 2L18A 3DUFA 3K0BA 4XIFA 1TM1E 3FA2A 3IMEA 3GP3A 3PC8A 1CF9A 3S1SA 2OLJA 1RYMA 4LZAA 1MC5A 5E4FA 2R6ZA 3BX1A 5E1OA 5G1OA 1C5KA 5IPFA 1Y8AA 3NETA 1E6EA 3LL7A 4QU5A 1N6HA 2ZJYA 2BHRA 1MAVA 1DTWB 3IOBA 3F6PA 3ODPA 5AIBA 4XWYA 2EVWX 1NV8A 1XDSA 2QD1A 2QUZA 2RBEA 4NFSA 4R01A 2C4HA 3WYGA 2GCEA 1XA4A 4UE3S 4AM8A 3VM6A 5EJEA 2CB9A 1C9NA 3GJ7A 4JEHA 3OOHA 1T0UA 4K1LA 1FSFA 2RHJA 4K9LA 1C0PA 1B76A 4UNRA 1NUUA 2B4KA 3MLEA 4P80A 2G0TA 3MAAC 2YVUA 3ZWYA 1VXOA 2WJGA 3V7UA 2W6NA 2VHEA 4X1YA 2V6IA 3AILA 4HNQA 1XMJA 2LR0A 5EQTA 1WZIA 1E20A 3CWQA 4P84A 4CPDA 2J0SA 5K8IA 5LU9A 1B0PA 4L02A 3OICA 4MHSA 5IJZA 1IBRA 4IKEA 1JBEA 2FPUA 4Z2YA 3L4SO 2QBYA 2HJWA 5SZIA 2Q27A 1ST2A 2H5EA 2Q6OA 4MUMA 2KQUA 3ANMA 4UU0A 3UK7A 4BZPA 3O8QB 4IVPA 4AY2A 2YNMD 5LQSA 4RIFA 5CX4A 1ZCZA 1Z0SA 2ZRFA 4MEJA 3B6KA 1LU9A 3JD4A 1HDEA 1K7SN 1Q2XA 1VI5A 4DXDA 1X8KA 1X7ZB 5G1NA 5BRNA 4C0QC 3USZA 4ETIA 5BR8B 3LUKA 5AW9A 5E2IA 1MPTA 1F6DA 2Q1UA 2ANCA 1V16B 2PWYA 2IHBA 4DNXA 1LDBA 4IOKA 4KL8S 1E2HA 4NBWA 3REGA 3TLXA 3W2TA 4D02A 3CX3A 5A4AA 2CLHB 5CB4A 1FDOA 3ETHA 4MJXA 3H5IA 3SAJA 2KB0A 2E4VA 2BFBB 2R8XA 2EZTA 4MVJE 5JI2E 1PNRA 2FQQA 2IDZA 4KGVA 1XA3A 1ENYA 5HS6A 1Q7EA 4GVPA 4TVKA 4BMXA 3JSAA 3EDQA 3QVWA 3TNJA 2PH1A 4BDTA 3BJZA 2A0FA 3KDAA 4GMXA 1KQFA 2Y92A 3N8GA 1KXZA 3AFOA 2WVJA 3H9UA 1JQDA 4NS4A 2QDKA 1F0YA 1T8UA 3NAGA 4U39A 4W9MC 2IBMA 4C9BA 2AYYA 3BD8A 3DHWC 5EHZA 3C39A 1TC2A 3FCAA 3H2GA 3Q12A 4JI8B 1E9EA 3M33A 4KI0A 3N86A 5LBUA 4EO9A 1L5WA 4FGLA 2X5OA 1L1EA 4QICA 1T9BA 2ZTLA 4NIMA 1Q92A 2CL6X 2I22A 3FOAA 4ZJPA 1SU7A 4JR2A 1YC2A 5CFPA 3M6UA 3WZLA 3AF0A 3LS2A 1UBHS 1V39A 3VUFA 2CFCA 4M3NA 3RVKA 3W78A 4F3TA 4GDMA 3BMOA 2AMVA 4F84A 5DLEA 1PK8A 5AVTA 3GJXC 3T3HA 3SC2A 1FZQA 1XMVA 1AZSC 3FCSB 3EGDB 3LUCA 4HWKA 1N92A 4HDMA 3TSWA 1TNDA 2MYPA 5BSVA 1KJYA 2F3RA 4ZXPA 2FKNA 1YAJA 3SNHA 4KP7A 4FD2A 3Q85A 5KOHA 3VJLA 3COZA 3CLTC 3PQEA 1LDGA 2VPYA 2ZT7A 1D2RA 5KBYA 1A5AB 4DLKA 3SXUA 3B6IA 4IDDA 1FNSA 3N2NA 4J0IA 3LV8A 3B9BA 4UBIA 2FRDC 4PBSA 2WA2A 3ED1A 4LXHA 5FBRB 4QUJA 1U3TA 5THQA 2B99A 1AURA 1XD2A 3DO6A 4ZMBA 4HQ0A 3BH0A 1NRWA 6PFKA 4EG5A 2GUWA 1CE8B 3QWFA 4J16A 2E9SA 1GPJA 2HUPA 4IOJA 4DG8A 1IN5A 4L74A 4NH0A 4I4NA 2XQIA 3IALA 3KXDA 3N0XA 5AI5A 1OWLA 3EPPA 3PP8A 4G6ZA 4RADA 1SXHA 3TB6A 1N1EA 4L0DA 1YHYA 5F12A 1NI3A 3TXAA 2AMYA 4BNGA 3EXIB 4R9NA 1JNYA 1JT9A 2P8SA 2OZKA 3H9EO 2YNMA 3EXG2 1ULSA 4FMDB 1M0WA 3PPWA 1I4WA 2DUMA 5MN6A 5JH7F 1QAMA 1G8MA 3OE7A 5A7HA 5EZSA 4L16A 3EDRA 1OIWA 4XJVA 1KGDA 1WVIA 5FI5A 4C0LA 2UXBB 3A36A 1T91A 4C1NA 1Q74A 2IX9A 2C77A 4WZAE 1FU8A 2JDID 4M8IA 4M9RA 4QWWA 4R40A 4RK6A 2B9EA 2OECA 5B3JA 3TB4A 4D3FA 2J41A 4IV8A 2OTCA 2OA0A 5IVKA 4S1PA 2H1RA 3BFXA 3S44A 1QGUA 5A0VA 2X1VA 5K3FA 3T95A 4AI6A 2H5JA 4FS8A 4OU5A 1GPNA 1XZHA 3LX4A 2JEYA 1RWKA 2QZ9A 5JD6A 4F5EA 4U8HA 3A10A 4QPNA 2A3NA 2OFXA 4IFBA 4UHEA 3V00A 3W6OA 4IOMA 4UMFA 5L3VA 2E85A 1OKKD 2GKSA 1TADA 4N9QA 4IDBA 2G63A 4C4RA 1P0PA 4BKQA 3F6BX 4J0KA 3LM8A 3KEQA 4P33A 4A10A 4OG2A 4RVHA 2XODA 1CLUA 1JFVA 1ML4A 1XCLA 1YL7A 2PKQP 5IAGA 2CXUA 3TQTA 5HOEA 3G3EA 5AW6A 1N25A 3DM5A 5I9SA 3ACBA 3F7OA 3LLCA 5H9VA 1UUFA 4YRLA 4JI2B 1DDOA 1RWMA 3WL8A 2XUHA 2VJNA 4CV1A 3EHDA 4JJEA 4KQ9A 3BORA 1ES9A 4B7ZA 2DGDA 2JANA 1H0KA 1LX7A 1Q77A 2I29A 2ZBQA 1LF0A 3DTNA 2JDIA 3IR5A 4QAQA 4QYWA 3SM9A 3P4XA 4CKWA 4KQKA 3KZ1E 4JT4A 5KREA 3WK7A 2HDNB 5EPEA 1I4LD 3E7XA 2B6HA 3M89A 2VOJA 5I9MA 1E2KA 5TS3A 1K6XA 1Z7YA 2ZTUA 2C8KA 4PGMA 1CZKA 3S8EA 3K9HA 3ODGA 3IILA 1YRLA 3TZLA 1H9CA 1IEQA 2YDYA 2PUDA 4TVSA 4RDXA 2X0EA 4KGZA 1QK3A 3AEQA 1F2TA 1T9KA 3K9CA 1BXRA 4RY0A 1F8FA 3ILHA 1FFXA 4HVCA 4JU8A 5FBVB 1W36D 1UJCA 2Z09A 3IPYA 3EJ6A 3PGMA 3KZCA 1RD4A 3NEJA 1CR2A 2BTQB 3IP7A 3R6DA 2AI3A 5K3AA 3T7DA 4EHDA 3HGQA 4LF8B 3SF0A 3GT3A 4IH4A 4TXLA 2GEJA 1HE8B 4FR5A 2W00A 2Y1WA 1JJFA 2A7QA 3UMRA 3LBYA 4DLAA 2CHEA 3S2EA 3HRIA 3NDIA 4H0FA 3DV2A 5A3VA 2FX5A 3G8YA 4RYDA 2ERXA 1WW2A 3IV6A 4FYYA 1SUAA 4REOA 2AFIA 1YFJA 2IC5A 2AWNA 2RAVA 2IQIA 1IXRC 1U2GA 1OI4A 1P4GA 2OCBA 1PLLA 2YBDA 4FS3A 4TL6A 1RJWA 3C3MA 1YJCA 1NE7A 2QZPA 3IUYA 1M2GA 2P3QA 3D2LA 4LVCA 3TSCA 3V7WA 4GP7A 5CVDA 3K70B 4EARA 5AOAA 2C5BA 1HFKA 4JI5B 1DT5A 1SBYA 4MYHA 2H07A 4HS4A 4AUEA 5B1HA 3FZQA 3UJHA 3BE5A 2CL7X 2FG6C 4KQMA 2RE8A 2C2KA 5HVNA 3S4YA 2OD9A 5E6UA 3PDIA 4E31A 2K2QB 2YJGA 4UUBA 2PUTA 1YJAA 5M29A 3RROA 3SGLA 1TQHA 3PUYA 4IGFA 4N41A 5LXTB 4PCUA 4HSEA 4LV6A 5J4LA 4ZI7A 3EAFA 3BJRA 5I9LA 3V32A 4B34A 2FQYA 2FSPA 3LSTA 5DI3A 2DEUA 4J7AA 2R6GA 3P9QA 3BDIA 3IEPA 3KE8A 4OMDA 2OB2A 1O9GA 1OGYA 3EF1A 2DFVA 4UVEA 4ZVTA 2D0OB 3LAWA 2O8BA 4WKOA 1P18A 3SWWA 4ZT3A 2BI7A 5AT1A 3E8XA 3ESAA 3TZBA 1DZ3A 1Y7IA 3AV3A 4GHWA 1DELA 2Z2XA 3LFHA 3HV0A 4RIEA 3RJZA 5HQ3A 1W5TA 1OF1A 1RXIA 3HCFA 3NDPA 3QMWA 2H4XA 4Y1GA 4DHWA 4MGHA 3EXHB 3ZZUA 2CXNA 2PL9A 1HH4A 3K2EA 4GYYA 4B5KA 4KDCA 4DDVA 4ZAVA 3FOFC 1EDEA 1GDTA 4Q7EA 2W9XA 1CQWA 5I8ZA 5CD1A 1M8PA 2NACA 1ADCA 3JZFA 2YYZA 2WIGA 5EKXA 1Q84A 3SXUB 4BCBA 2UVQA 3N8KA 3QF4B 2ICAA 2BHLA 4H4CA 4M0DA 2L69A 3CZCA 4GE3A 2OO7A 1XVTA 3FTFA 5B58T 3SM3A 1IBMB 2E1PA 1E60A 4LY9A 3TM5A 3ZDRA 5KYKA 5DSTA 1J97A 4IIFA 4NP6A 3DDWA 2HR1A 4G5GA 5LLSA 2OOSA 4CG3A 1SGWA 4FFBB 4MQEB 5E1BA 1A82A 1JQ5A 1KQ3A 2PMFA 3KV1A 4JMLA 4P35A 4C5CA 4EJFA 2VUIB 2WF8A 1IK4A 3H4TA 1XN1A 3BWYA 4I6EA 2WJ3A 4TLBA 4YR7A 1RYEA 4NU5A 2FN9A 2AF4C 1QH8B 1N75A 1U0GA 5G0WA 1KFEB 3PL1A 5IN4A 4Y1FA 4LMRA 1V2GA 2AC4A 4Q7JB 1KY4A 1NKTA 3FPJA 5AYVA 3A58B 1EGQA 4IKPA 2BFEA 3W9UA 2V5AA 2JVKA 4TVOA 4C0HA 2DFPA 2FSGA 2NXWA 3GG2A 3GUZA 3L93A 4Q3EA 5IM5A 5JCOA 5T6MA 3LP6A 4ER0A 2XMDA 1YCHA 4II3A 4ZV4A 4YJ2A 3DOCA 2UXCB 2VSQA 4XX1A 4HP8A 4Q15A 2FRVA 3UAGA 2UU9B 1OV4A 1YZ3A 1MVOA 3D3NA 4ZOAA 1VE5A 1ISFA 1WMEA 4JP5A 2CMKA 3E1SA 4TZKA 2A3RA 4HX5A 3U7EB 2ZYGA 3DEHA 3B2QA 4CF5A 2ZTSA 3RC2A 3IXLA 5DMHA 1B41A 4A23A 2IEDA 2VA8A 3EQ9A 3OPQA 4BN0A 4CN8A 4ZU1X 1FX0A 2IEIA 3QWIA 1YHNA 1Z7EA 3DFMA 3KSAC 4MUGA 5EHNA 3L7AA 2O7RA 5ED4A 2BUCA 3DULA 4YRJA 2J31A 4D6PA 2GCOA 1RQRA 1CW2B 2FZ5A 1UC8A 3WADA 2QJWA 5DX0A 3RUEA 3IQFA 1AH2A 2WAMA 1I7NA 4N76A 3S1LA 2COEA 3N7UA 2PMBA 1L4LA 3G2JA 2JVJA 1U8XX 2V3CC 2EBFX 4IV0A 2EZ8A 2YN0A 3AEYA 4U3JA 2ZIZA 4YLGA 2XW6A 3LCVB 5D85A 4FBMA 1SKYE 4ZT7A 3T0FA 1GSIA 3EF0A 1U5CA 4NOJA 3T3DA 4W8HA 3G88A 4P4SA 5HW0A 3BSFA 3TFQA 1XTPA 2XUFA 3GGPA 2C2HA 5HJ7A 4LJAA 4M7PA 4KNWA 4DQUA 3QOXA 3L5OA 4LOJA 4DVGA 4ZOBA 3RREA 3S5JA 4YX9A 4M89A 2ZVJA 1P5FA 4A8HA 1DJMA 1E5LA 3HDQA 1BWSA 3AR9A 3F5MA 1E4EA 3KTFA 1MGOA 2QMUA 3EDOA 4U6QA 5F7OA 1CB0A 5FOWA 1FMJA 4BXOB 1GYQA 3KKZA 3T54A 1JEJA 1Z0FA 1T1JA 4PPFA 4AMZA 4YP5A 4RK7A 1D4ZA 3PWKA 4Y2XA 3R7SA 1QHIA 5ALVA 3HNOA 5AFSA 3H2HA 4C20A 2NPOA 3HFGA 1SH7A 4DT1A 5K4AA 2IYOA 3IHLA 1RWPA 3IERA 4MOWA 1RJGA 4U7TB 4NNPA 2PMEA 2ECPA 2JLQA 1U9ZA 3A37A 1L7VC 3OIFA 5KJ1A 3UA3A 5KCMA 5L6MB 5FAXA 1LPOA 4J2OA 5HZHA 5DYNA 1DFIA 1VL1A 2EXXA 2WSYB 3KKLA 4JXXA 1FQOA 2F43A 4MITA 4WI1A 1XCJA 2C5AA 5CA0F 5AW4A 1R0LA 4JP1A 1Y3IA 3A6GA 3QX8A 4K87A 1JJBA 2HSDA 2OBNA 2PJDA 1EUCB 3IUSA 5EKTA 5CAEB 3VUEA 2WIFA 3EOZA 5IZCA 4AKIA 4Z49A 2H1IA 3A11A 1LA2A 4GPAA 1P8JA 2QZ4A 4N3NA 4WE3A 3WGNA 5KUTA 4ZARA 4NJEA 5T4BA 4UNIA 3B3GA 4P86A 4XGRA 2IEYA 1Z2NX 3WK4A 5KHOC 3U49A 1KEUA 4YT5A 5IEBA 4AQ7A 1JVNA 1KJQA 2JFGA 2G08A 2LRHA 1E1CB 4G8BA 4O0LA 1TB4A 4G25A 4KQ1A 5B37A 3RSHA 1KSGA 5EIEA 5B2EA 4Q3BA 1TECE 4JAVC 5FUXA 4YB8A 3LSYA 4HDNA 4AX8A 5A4JA 2AW5A 3I1YA 3O4HA 3FUXA 3HYSA 1PWZA 3R6LA 4G8CA 1NBAA 1I7LA 4ITVA 3U37A 1Q95A 2AFHE 3GCZA 2W2KA 4OV6B 2PX3A 3AWDA 3IMGA 3ECAA 4MJ7A 4P38A 4RTRA 3WVNA 3IE1A 2PBFA 3WIEA 3BMNA 5DKFA 3GPCA 1JFFA 3DZIA 3GEDA 2OHHA 1Z68A 1G3QA 1QHSA 3IFSA 4G0NA 2HO4A 1D2MA 1M8GA 1QS0B 3DV0A 2GN2A 1EFUA 1J6UA 1TEVA 1VA4A 1ZCJA 3A3KA 3MPOA 2F9FA 2RONA 1XNHA 4MB6A 5B3AA 4XJXA 4FSDA 1KKMA 5J4HA 3W5AA 4JY7A 1MO3A 3GNSA 4HUQA 4PIMA 4L1KA 5P21A 1NBMD 2AN4A 5KHAA 2P2NA 2Y93A 3NBYC 3N58A 4FN4A 2ES4A 3OEED 1P1BA 1IWBB 4IHKA 4K6GA 5D5PA 3WHPA 1ZZGA 5IAAA 1ZOIA 4E5MA 5JANA 2JRLA 5KNBA 3OU2A 2WOOA 4PXAA 4ESHA 2QN7A 3B5IA 2P9QA 2TMYA 1W2GA 2AQIA 1O6FA 2D2FA 3ZWAA 1HTBA 2DPMA 5FOUA 1A77A 4OJTA 3BSSA 4KFRA 5JNTA 1T3LA 2H31A 5I45A 16PKA 1H4TA 1O96B 1BDHA 1U0EA 4LJ9A 4Z0NA 1N2CB 1QOZA 2AJCA 2BE9A 3PTLA 1G55A 2HMAA 4UBNA 5LN1A 1F12A 4NOMA 1E0AA 1Y4ZA 4CFYA 1H6AA 1R6BX 3HMQA 3DWEX 2GNPA 2R84A 4UHKA 2LNDA 1TF5A 4MA0A 4R1PA 1G3IA 3VHLB 3G85A 2QVCA 5EJMA 4DAEA 2IH2A 2O4CA 4MUNA 3K1YA 5IW8A 2K2WA 4ZHQA 4AX4A 4WY2A 1QYXA 3G9QA 3LP8A 3ZJ5A 3AESB 2R6AA 3GYBA 2ZAMA 5BORA 4HRXA 5FD8A 1YB2A 2RB5A 4QD3A 3CB2A 2Q5QA 4PWZA 4YIKA 3T5MA 2COUA 2JGLA 4IIXA 5BVHA 1GQOA 3R5FA 4KWHA 1RKUA 2O3JA 1PR9A 4FYHA 4JYAB 5J2UF 3C5CA 2V0CA 4P4NA 4QUHA 2B8JA 2PFKA 4GL4A 2QAGC 3EVBA 3SDZA 5T4HA 4UUOA 2HOQA 1KYXA 2BPOA 4J9UE 4HQLA 3SEFA 5T8KA 2O8FA 2A0UA 4JFRA 2D2EA 1NC1A 4YUWA 3DXXA 4TV8B 1CZNA 2FXIA 2QTTA 4JH0A 4C1BA 4UU1A 3NJRA 3K72B 2MYTA 2XCLA 4ND7A 4BNLA 1C3VA 2AFHA 3C48A 3ITKA 4UCQA 1OQAA 3PQ5A 1WMAA 2IY8A 5DHQA 1L5SA 2OBFA 4RHFA 1PFYA 3C2QA 3F6EX 4OQZA 2JC3A 1OD6A 5JMPA 2HKIA 3W5SA 3LUDA 2QR2A 3MTIA 1T2AA 3VO2A 4EB3A 1GZUA 1QZXA 2BEVA 1S3IA 1Z4JA 4IXMA 1CJSA 1ODFA 4J94A 4P6VF 1KTIA 1FNMA 1AKWA 1RTKA 2O8DA 1XEWY 2CCJA 2DPYA 3ADBA 2V7WA 4YUYA 3OEYA 4HH1A 4XJTA 3NHJA 1KRWA 4CMCA 2C2BA 4GOOD 3UB3A 1RXVA 1NRJB 3V7NA 4QYIA 4A2QA 4QU8A 1VMEA 3QNWA 1WL8A 2R8ZA 3C7KA 3RKSA 2FEKA 3ZXYA 3IEKA 4BRZA 3HKDA 4LAFA 4H7KA 4QDKA 4IPTA 1PWYE 1SVLA 1GCAA 1KI6B 3FZGA 4TZTA 4YP6A 4F1KA 3ZLBA 5CIQA 1K6IA 4GD3Q 2CV0A 1LD3A 3ZXIA 5JNVA 1W2WB 2HTFA 5C8ZA 2GVZC 4PM4A 5GZ1A 5JYDA 1UAYA 4KO1S 5LMUB 4I5FA 3QUTA 1JMVA 3WGUA 3GMSA 4LXIA 5FA8A 1Q1EA 4WFKA 3HBMA 5IAJA 5C35A 2B5VA 3I39X 4DV2B 1JWBB 3GJ5A 1SVNA 2NVUA 4FNAA 2X4IA 1U99A 2FZLA 3GUUA 3ZD8A 5JC1A 1PFGA 2XQFA 1D5WA 2OD2A 3EEOA 3QV2A 3ZEIA 1CY1A 1E2FA 3DPSA 4AQYB 4ZDJA 1A9OA 1KFJB 5J4VA 2AQ8A 3I6IA 4HWTA 4QRDA 1OX6A 1OROA 3QEJA 2AXEA 2G67A 4LJKA 4DS3A 1ZN9A 1JJIA 2ZRKA 3AW9A 3JD3A 4WAUA 5KNDH 4QOEA 4PZ9A 4Q82A 1N2CA 3AYXB 3UMYA 1U9IC 3RSCA 4FZVA 1ZRHA 3JQCA 4BZQA 4ASUA 1G2QA 1UEJA 2BEWA 5TMEA 1X13A 2NSDA 3VPFA 4F3NA 3IB3A 3O9VA 3RIGA 4EABA 3KJEA 3WG9A 1M6YA 2AMFA 2VATA 1ECBA 2V59A 3RJTA 5BNIA 4K6CA 2QUHA 4DR5B 4F8EA 1XJQA 6AT1A 1N2IA 1P1CA 1ZOLA 3AJ9A 3LHDA 3TOSA 3AP3A 1NF8A 2AK3A 1PGJA 1JEQA 2CNWA 4JX8A 3ZQUA 4FB5A 3VTAA 1ZQ9A 4J2HA 1SMKA 3EMVA 3JARB 3K4PA 4KXNA 4UDOA 2IPXA 3TTTA 1KETA 2WZQA 5JZSA 1NXOA 4RVUA 1AQYA 3TRHA 3N2YA 4JUBA 4MO2A 4OKNA 3SR4A 3PXUA 1SHTX 3O3OB 3LE8A 3BIXA 3DHNA 2ILTA 2C97A 3V3KA 4BBAA 4F0JA 5IVHA 4BASA 1JU4A 2CK3D 2O3UA 3I04M 3IBYA 3NHAA 2B7BA 2FV8A 3QFHA 4P0PB 2CNNA 4JQCA 3U17A 2FJ0A 1KS9A 1J0CA 3A6ZA 4KZPA 5FP0A 5JCXA 1THTA 3NNNA 5LYJF 4P5DA 2YXEA 3IIJA 4L76A 3L7MA 4GMFA 1W5FA 3A32A 4U8GA 4PV7A 4S04A 4BNYA 1NVMB 1VL5A 1KEPA 1EA7A 2ZS7A 1LRJA 1VKNA 3EIHA 3ELDA 3PC7A 3Q6MA 4HRYA 4HAVA 3ITEA 4RPGA 4D99A 1FJXA 3UFXA 1JDNA 4MQEA 4O25A 3RF6A 3QVUA 3X1DA 4LMPA 3TRDA 3B6ZA 4YMLA 1FUEA 1U6JA 1YZLA 4WXYB 2A5JA 1FJHA 4LJ8A 3NOOA 5C1OA 1JIVA 2EWVA 2Z6VA 5JS7A 4PRZA 4MWOA 1X15A 2ODTX 2NU7B 3G6KA 2ACEA 3KZNA 4JC5A 1C4KA 1AU9A 4OI4A 5EWMB 2I2AA 3RUFA 2H1OA 1PFWA 3H11A 1P17A 2F3TA 3V8VA 1ZNYA 1QC5A 4PCAA 1KRHA 5JS1A 2RCYA 4LOKA 4BS9A 5B36A 1PJ8A 2LGJA 4LSWA 4Q3KA 1NXXA 2JFWA 5AK5A 4CM8B 4F86A 4WW0A 4F92B 2TYSB 4RD1A 2J67A 4DYDA 1N2ZA 1SOWA 2YV4A 3F74A 1S1CA 4ZVNA 3AETB 2ZUVA 1CQIB 4QDZA 4OK5A 5IJ9B 2RKBA 4JI0B 4PNPA 4BJ6A 3GFQA 2QD4A 4IZ6A 4NCBA 2CE7A 3VO1A 1FXUA 2BE7A 3HS3A 2CYAA 5F3RA 1Z0AA 3ETEA 3BN3A 3AMVA 2WJWA 2GERA 3MMZA 4RMHA 3UHOA 3D64A 3V1TC 5GADl 1WQ3A 2O06A 1FSSA 1SPXA 4DW8A 2NZJA 2QZZA 3ZXUB 4FZJA 3ENKA 3AB3A 3LDGA 2AB0A 2IVFA 3QVTA 2XSZD 1U63A 4K88A 2B82A 1T0BA 4N7JA 2W2NA 1V8BA 2UUOA 1AKQA 1DQNA 4OGWA 5E6UB 3VSAA 3PF9A 2FW0A 3DZFA 1PGQA 1FBNA 1NPYA 4XDGA 1VE7A 1A04A 1EAMA 4FFWA 1R00A 2Q3MA 4PC2A 4RSGA 4RZ3A 3HKEA 5JXJA 4B32A 5ITWA 4L4UA 3AJAA 1ESNA 1JAYA 1NP6A 1CE8A 4R2IA 3T7KA 1RRKA 3GU3A 3NHKA 1WXQA 3RV3A 5DCYA 4E15A 2CSXA 2OXCA 4UAVA 4YWHA 3RG2A 2QV7A 3BIFA 3OCZA 4MV6A 3S6JA 3UENA 4ZIRA 1QPZA 3PEUA 2P6RA 3SC3A 1DARA 4ND5A 4D9JA 5LDHA 1P60A 4G0ZA 1HRKA 3Q9NA 4XARA 4DIOA 3STUA 2QX6A 4I4LA 3DVRX 1JEAA 1NVXQ 4JI3B 1PD1A 3AHIA 1K4MA 4QOFA 2WZBA 1DIGA 1Z25A 1PU2A 2Q45A 5IXSA 3HPRA 2Q5IA 2I9PA 2R8BA 3ESXA 3H3XA 1N3YA 1JAXA 5LQDA 4GZMA 4M88A 1Q16A 5AVYA 4DDWA 4QFBA 3IESA 2CLFB 1NR1A 2EGUA 2IZOA 3HP7A 3O8BA 4ARSA 8ABPA 2JGEA 3CLUD 4EPXA 3SYLA 3L0CA 4GVLA 3TH5A 2P27A 4FINA 2Y0BA 4FT4A 3EG9B 3FCOA 1UBSB 3G5UA 4NRDA 4JI1B 4LSZA 3WJ1A 2VG8A 4CVNA 1FFGA 1ZG3A 3BL5A 3JQAD 4ZVRA 2ZYDA 4YALA 3PQ4A 1Z6QA 4YXFA 3GVPA 1OFGA 4YMHA 4W7IA 1FUKA 3T1TA 2RGEA 1MC8A 3JQ6A 4H18A 2QMYA 2C83A 2WJHA 5AW1A 3TW0A 1WXIA 3I5AA 3IULA 2QSJA 3OF5A 4LRSB 4H7PA 2UYOA 2VR1A 4WFJA 1PBNA 4TRNA 1II8A 4MVJA 3NC4A 4RIHA 4MQBA 1BMDA 3CZRA 4Q0MA 5DN9A 4BFXA 3NKVA 4RZQA 3IYLW 1YA4A 3AR5A 5ITVA 1TZ2A 3KUUA 5H1YA 1X8JA 4UU8A 2JRCA 3ZD7A 5F1YA 1QG4A 4XSHA 2G5CA 3IC5A 4JC8A 5EJ7A 1ZL2A 3GG9A 3MWDA 3RYHA 3ZV7A 3DQQA 3DB2A 1RKXA 5H8WA 5AK4A 1DUSA 5DT2A 1ZRMA 1G9SA 4RPHA 5CX1A 3U9LA 3VC3A 1DCKA 1NV9A 3KLPX 4F8YA 1OU4A 2HDWA 4LNAA 1Z39A 3SSNA 1F38A 4EY8A 4YT4A 5KX5F 2OCLA 3L7DA 2QWXA 2FTKE 1WB6A 4P8RA 4A8JB 3MQ2A 1IE3A 1L3IA 5D7NA 4A36A 2ZI5A 5FLEX 1JIKA 4G5XA 3T5CA 3LVBA 3TJMA 5TGTA 2AR9A 2WOJA 1JBKA 3BWDD 5KVVA 1T1GA 3TQRA 5HZGA 3CUVA 4CT0A 3CX6A 2BH2A 4X7MA 4OM7A 5K3DA 1L8LA 1QJCA 3C6KA 4N3GA 3D4NA 3PLAE 4YCNA 1GU1A 1OBVA 4WLNA 3CLRC 1MZPA 4UPDA 1RBQA 2VL7A 2PLAA 4XB2A 4AROA 1II8B 2WM9B 1Q1GA 1EI9A 1QLJA 3TKYA 1L3CA 2LIVA 1Z29A 1B0UA 1I01A 2PMCA 1DEAA 1F2UB 1U1GA 1SCKA 3FTQA 2R68A 3L4KA 4I1OA 2IYRA 4NZNA 1XNGA 3SHFA 1ZM7A