4OX9Y

Crystal structure of the aminoglycoside resistance methyltransferase npma bound to the 30s ribosomal subunit
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
219
structure length
219
Chain Sequence
b'MLILKGTKTVDLSKDELTEIIGQFDRVHIDLGTGDGRNIYKLAINDQNTFYIGIDPVKENLFDISKKIIKKPSKGGLSNVVFVIAAAESLPFELKNIADSISILFPWGTLLEYVIKPNRDILSNVADLAKKEAHFEFVTTYSDSYEEAEIKKRGLPLLSKAYFLSEQYKAELSNSGFRIDDVKELDNEYVKQFNSLWAKRLAFGRKRSFFRVSGHVSKH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
molecule tags Ribosome/antibiotic
source organism Escherichia coli
publication title Molecular recognition and modification of the 30S ribosome by the aminoglycoside-resistance methyltransferase NpmA.
pubmed doi rcsb
total genus 68
structure length 219
sequence length 219
ec nomenclature ec 2.1.1.180: 16S rRNA (adenine(1408)-N(1))-methyltransferase.
pdb deposition date 2014-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Y PF02390 Methyltransf_4 Putative methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4ox9Y00
2PXXA 3FPGA 4GQBA 5IH3A 1RI5A 3HVKA 5EEHA 3TM4A 1RI3A 5LQNA 3MCZA 1KP9A 4M37A 2ZFUA 2JH8A 3E8SA 5K09A 1N2XA 3LSTA 3REOA 2OB2A 3C6MA 3EVFA 5HILA 3DXXA 4ISCA 3KQTA 1FP1D 4RTPA 2PJDA 3A7DA 1X19A 2P7HA 4GOND 3HCFA 4E2WA 1SKMA 4GC5A 4IKPA 3VYWA 4DQ0A 3HTXA 4DZRA 1HMYA 1I1NA 4E2XA 1JQEA 1NBIA 4FT4A 5LQAA 4OX9Y 5K0EA 1TW2A 1BKYA 1KYZA 5DSTA 3SSNA 3HCCA 2GS9A 3UBTA 2FCAA 3A7EA 3D2LA 3HCAA 1G6Q1 5JR3A 2VP3A 4PIPA 2IH2A 1D2GA 2ERCA 3G2MA 4ER7A 4ER3A 5DRTA 4E32A 4CWAA 1SVUA 3KQOA 4PONA 3DR5A 3PFHA 3KR9A 3DXYA 4F84A 4POOA 3PX2A 1VIDA 3I9FA 3M6VA 3PS9A 3BT7A 3DTNA 3OU7A 3OZRA 1JQDA 3GRUA 1N7IA 1NW7A 3I53A 4X60A 2HV9A 3UJ6A 3WSTA 2QRVB 2P41A 1NV8A 1R74A 1XJ5A 3A25A 1R18A 3AXSA 2AN4A 3G88A 3C6KA 5DM4A 5E8JA 1PRYA 5GIOE 2P3OA 2P7IA 3CJRA 3LKZA 2OPBA 4OA8A 3EEYA 2V74B 3GCZA 3OFJA 1XDSA 4ER0A 2GB4A 4P7JA 4YUVA 4YV0A 5K01A 1Q0TA 2B9EA 2ZWVA 1RJGA 2XYRA 3KKZA 3R0QA 4IV8A 5E1DA 3ER8A 1VE3A 5EEGA 3T7SA 1AF7A 2OXTA 3LPMA 2BZGA 5K0BA 3GRZA 3THRA 3KR2A 3P9IA 1X1BA 1VBFA 3GU3A 3F4KA 3K6RA 3SR4A 2AOTB 4PIMA 3ELWA 3I64A 3PVCA 4KW7A 4PYMA 3BUSA 4KIGA 4DF3A 5GINE 3EGVA 4A6EA 4HRAA 5DTQA 3EVEA 5GP1A 4AZSA 3ELYA 5KVAA 5EMMA 3GIWA 2QM3A 3HA5A 3CBGA 3DULA 3B5IA 3P71T 3LL7A 4EMSA 5HZMA 2ZCJA 3OU6A 3X0DA 1YZHA 2K4MA 4IWNA 4LG1A 4OA5A 3NVMB 3G89A 2P3QA 3G8AA 3VSEA 3DOUA 1AQJA 5FA8A 2C7QA 5BW5A 1NBHA 1V39A 5FHRA 4KDRA 5EGSA 1L3CA 1XCLA 3HCBA 3OPNA 2R6ZA 4NECA 5FWDA 4PGGA 3PX3A 1BHJA 4QTUB 4DM3A 4P7FA 5G02A 3U81A 3MGGA 3T7TA 1IM8A 3IHTA 2O0LA 3DP7A 4QVKA 3ID6C 5EMKA 5HIJA 2PX2A 3NDIA 2FRXA 4CKBA 2IPXA 1M0EA 1JQ3A 1NT2A 3AJDA 2CMHA 4E70A 1NKVA 3G8BA 4RTSA 1O9HA 2JH9A 5HIKA 5ICEA 5T67A 2H11A 4XUEA 3G5TA 4PCLA 2I7CA 2NNWB 1ZGAA 2FK7A 5F2NA 2ZVJA 3MTIA 1RJEA 3P9KA 4YUXA 2IDJA 2QE6A 3FRIA 1QYRA 1RJDA 4OQDA 4F86A 4C05A 1NW3A 4AZTA 3EMBA 3M6UA 4KVZA 3IV6A 2WA1A 4QQKA 3KQQA 3BGDA 4YV2A 5ERGB 3SX0A 1H1DA 4X61A 5MHTA 1Z3CA 1D2HA 1R8XA 2CMGA 4QDKA 1QAMA 1JSXA 2ZW9A 3T7RA 2BM8A 4HC4A 5KYGA 3P9NA 5CM2Z 3NVKI 1X1DA 3FUUA 2GLUA 2NXCA 2ZBRA 3MB5A 2XYVA 2IBTA 3R24A 5FULA 3KPJA 2PKWA 4M38A 4WVLA 5EQJB 4DA4A 4E31A 3EVBA 4BP3A 3FUTA 3LDGA 2ZULA 2QYOA 2HWKA 3P2EA 2OB1A 4C06A 2BR4A 9MHTA 4BLWA 2VDWA 1YFLA 4AZWA 5K0FA 3B3GA 3EVDA 3R6TA 4DCMA 4BY9E 4PGHA 2DULA 3FZGA 1Q0SA 2GPYA 3UJ8A 2AN3A 2UYQA 5DX8A 3EGEA 3HCDA 3M33A 2IDKA 3OZSA 1FP2A 4G56A 2YXEA 3NDJA 4MIKA 5E2BA 2JHPA 3TM5A 5K0LA 2AVDA 3A26A 1EIZA 4KRGA 3BGIA 4ER5A 5K03A 2G72A 5GM1A 3VC2A 3A27A 2I62A 1JSZA 3P9CA 1D2CA 2YUIA 4P7KA 4RYLA 4E30A 2P1DA 1B42A 5EHIA 4H0NA 1NV9A 3TPZA 3VC1A 3SSOA 1EAMA 1WY7A 3P8ZA 5DM2A 4CKCA 5GWXA 3DLIA 3HVHA 5T6BA 1FJXA 5HIMA 1NE2A 5ICCA 3ELDA 2ESRA 1VLMA 2IBSA 4XUDA 3LHDA 4GOLD 1NW6A 1R8YA 2ZBPA 4V0RA 5FTWA 1MHTA 3OFKA 2HTEA 2QY6A 1KIAA 4PYKA 4ATNA 3HA7A 1UIRA 4HGZA 1WZNA 3LCUA 10MHA 1KPIA 2CWWA 3FTCA 3NW9A 4F85A 2OBFA 2A14A 3KPUA 1KPGA 5EOVA 4E2YA 1XVAA 1MJFA 2O07A 4RVFA 5FHQA 4CKEA 4U7PB 3M70A 4PYQA 1JG3A 5DLYA 3SXJA 1L3BA 3KQSA 4RTLA 1P1CA 3RODA 1YFJA 1EJ0A 4RVDA 5EMLA 4R8RA 4QVGA 2R3SA 2G71A 2G1PA 1XCJA 2P8JA 2XVMA 2AOTA 5CCXA 5BW4A 2XBMA 3MAGA 3FPHA 3NWEA 3OCJA 5M5BA 2PVCA 1VP9A 3G2QA 5H02A 2OO3A 5DTRA 3LBYA 2DPMA 3KQMA 3HVIA 3Q7EA 1VQ1A 1O9GA 4ZTBA 2ZZMA 5K0GA 3FYDA 2N47A 5HOQA 1ZGJA 2PGXA 1X1CA 2NP6A 1UWVA 3CJTA 4PYNA 2IIPA 2O05A 1RI2A 4RTOA 2NXEA 3KQWA 3KU1A 2G70A 4YMHA 1QAOA 4MQ4A 5T64A 4PYJA 3ERCA 2YQZA 1JG2A 2XVAA 4OQEA 2CKDA 3EVAA 1HNNA 4LECA 4GEKA 3SVZA 3UJBA 2JJQA 2GA9A 4M7RA 5EZSA 1SG9A 5KQRA 4GF5A 4BP1A 3G5LA 4MWZA 3UZUA 1KPHA 5ICGA 5BXYA 3FUWA 4L7VA 5LQUA 2C7RA 4LWPA 1SQGA 4BLUA 1XDUA 3S68A 1X1AA 3SSMA 2WK1A 2PXAA 2PBFA 5EC8A 5GOZA 5D1HA 2ONZA 3KR0A 3TKAA 1L3IA 2BM9A 5CVJA 4KDCA 1T43A 3EMDA 4E2ZA 4LWOA 3T0IA 5LSAA 3ER9A 2AOXA 3FUXA 5DTMA 4EQZA 3FPFA 3KPYA 2ZLBA 2AR0A 2HR1A 3RIEA 2Z6QA 3TFWA 2FHPA 2ZZKA 3EPPA 3EVCA 4QDJA 3DMHA 1EQAA 3BKWA 4CTJA 1R6AA 3DXZA 5EKXA 5GIPE 4IV0A 2ONYA 5DSXA 3M4XA 1QANA 1P39A 2ZIGA 4X1OA 5EG5A 2LD4A 3V8VA 4Y30A 3LBFA 5EKUA 4FP9A 4GUAA 3TOSA 2ZTHA 5FADA 3TLJA 2OZVA 4QQNA 4R05A 5CCBA 3E05A 1KR5A 5E1BA 3O4FA 3O7WA 1VPTA 3I5UA 1RI1A 3DH0A 1YUBA 3CGGA 5E8RA 1I9GA 4E33A 2VDUE 2UZ4A 3UJ9A 2GAFA 5DXJA 1SUSA 5KS2A 3OZTA 1VP3A 2NYUA 5HEKA 2YXLA 4GOMD 2OYRA 4YUWA 1ZKDA 5C1IA 2BH2A 3P2IA 5CVDA 2ZZNA 2EJTA 3QV2A 4PYIA 5FA5A 1XDZA 2E5WA 5FQOA 5K0CA 1QAQA 2OY0A 4EK9A 4RWZA 4U7TB 5B1SA 2G8NA 1JR4A 3KPWA 3C3PA 1G55A 3LGAA 3CKKA 3KR1A 4P58A 1KXZA 2ZBQA 3FPEA 4UOEA 2JHAA 3C0KA 2IP2A 4HGYA 5E9QA 1ZHFA 1WS6A 1WXXA 4BLVA 4C08A 3KPVA 4QPNA 3DLCA 3E7PA 3OU2A 4FT2A 2PX8A 3UA4A 4MTLA 3UJ7A 2Y1XA 4ER6A 3B3FA 3R9XB 4AZVA 1WG8A 2Q41A 3FRHA 5C0OE 2JHCA 2PX5A 3QOWA 3ANXA 1L1EA 2HNKA 2PXCA 5U4XA 5KQSA 4HTFB 2AOUA 4RTNA 5HFJA 3B3JA 3UWPA 2UYHA 4DMGA 3DUWA 4PYOA 1G60A 3BKXA 4HG2A 5EIWA 4OBXA 4DKJA 3EVGA 4PYLA 1F38A 1L9KA 2AVNA 2AOWA 3I58A 3E23A 3LCVB 5F2OA 3SM3A 2Z6AA 3BZBA 5DX0A 3OE5A 4YMGA 1EG2A 1IY9A 4MHTA 2IGTA 5FCDA 4FS8A 2QRVA 4JXJA 3HEMA 3KQVA 3JWJA 5HIIA 2PT6A 3UJAA 2PWYA 1Y8CA 2PT9A 5DX1A 3TQSA 3GXOA 4RSRA 3EEOA 4Y2HA 4RTJA 1JTEA 1EJ6A 5E1MA 3H2BA 5E9WA 3V97A 1FBNA 2V7EA 3LX6A 4QTTB 5LQJA 1XTPA 5D1NA 4K6MA 4CTKA 1U2ZA 3CJQA 3LDFA 2C7PA 5C9ZA 4R6WA 5JUWA 2HMYB 4GBED 3QOXA 1DL5A 3DMGA 5E1OA 2AOVA 2ADMA 2H1RA 4HSGA 3NJRA 4RV9A 1BOOA 2FK8A 5EVJA 1AQIA 5LQKA 4EKIA 4B17A 3BXOA 1SUIA 3EGIA 3FYCA 4QPPA 3KQYA 3LDUA 5DXAA 5EMJA 5K0NA 1YF3A 3HCEA 5BP7A 1NW5A 2AN5A 3G2OA 3OE4A 3HNRA 1UFKA 2P3LA 4O29A 2C7OA 4Z2YA 1RJFA 2AZTA 3LCCA 4YV1A 5CD1A 4PNEA 2JG3A 5DWQA 2PX4A 5LR6A 2YVLA 5DM1A 3B7PA 2EFJA 1BC5A 3JWGA 4RX1A 1TPYA 5F2KA 4EVIA 2NP7A 4FR0A 1R00A 1I4WA 3HA3A 2VZ9A 2PSSA 2O57A 5IKMA 1ZG3A 2H00A 3O31A 1P1BA 3RW9A 3SMQA 2EG5A 2KW5A 1P91A 1ORHA 1RI4A 3DMFA 3BWMA 3ORHA 3PB3A 5EHGA 5CIYA 2IH5A 3CVOA 3GGDA 4A6DA 2B25A 4X41A 2YTZA 5DT2A 3MTEA 5CVEA 4AUKA 2B3TA 1N7JA 3NTVA 1G38A 3MHTA 2BR5A 5FUBA 1JG4A 5P8WA 3B89A 2PY6A 3CCFA 2VS1A 3AXTA 3JWIA 4FSDA 3TRKA 4YUZA 2ZSUA 3MQ2A 2EX4A 1DUSA 1M6YA 1FPQA 3GO4A 5EIFA 1JTFA 3UJDA 4RTMA 2WA2A 4AX8A 3HP7A 2F8LA 1YB2A 3GDHA 3FTEA 1JG1A 2ORED 2NXJA 1VL5A 3L8DA 3NWBA 5K8VA 5EPEA 2P35A 2ZIFA 4PWYA 1M6EX 5E2AA 4PINA 1KHHA 3FUVA 2O06A 3IEIA 3PTAA 3Q87B 2FYTA 1G8AA 4HH4A 3UFBA 3FTDA 2YR0A 4XUCA 4FGZA 4RTQA 5EZQA 5DRYA 2CL5A 3KQPA 4FZVA 3CC8A 4P7GA 4YUYA 3GJYA 2PWPA 2GH1A 2ZWAA 5LQRA 1F3LA 4CXMA 3M6XA 1OR8A 4RVHA 4KWCA 3C3YA 5FQNA 5ICFA 5GM2A 2Y1WA 2UYCA 5CUQA 3FTFA 2AS0A 3GRYA 4X63A 2AOUB 3MERA 4HTFA 4R8SA 3A4TA 5CVUA 1ORIA 1IXKA 3P2KA 4EKGA 2FPOA 2NXNA 3BGVA 3BWBA 4RTKA 4DCGA 3R3HA 4R6XA 5E9JA 2IFTA 3G2PA 7MHTA 1AV6A 3FPJA 2PV0A 4GOOD 2I9KA 3KHKA 3HVJA 2B78A 4C4AA 1DCTA 3GNLA 3MCTA 1G8SA 3TMAA 3G7UA 3M6WA 5CVVA 3ME5A 3THSA 4XCXA 1XXLA 2UYOA 3SGLA 1PJZA 1SQFA 5DPMA 3TR6A 2B2CA 2BR3A 3JWHA 3EVZA 4RVGA 2YXDA 2OKCA 3AWIA 4PCAA 1YZ3A 2P40A 3BWCA 3NMUF 3IYLW 2VDVE 2EJUA 3P97A 4V0QA 8MHTA 1O54A 1ZQ9A 3HM2A 5FWAA 4RTRA 3BWYA 1WXWA 3GRVA 4C07A 2I6GA 2PLWA 3LECA 3TKYA 1INLA 1KYWA 3GWZA 4C03A 2ZIEA 1QZZA 4M36A 3UJCA 3PT9A 5K05A 5K0JA 4GC9A 3PFGA 3LKDA 3ELUA 2IH4A 2XYQA 4KIFA 3GRRA 5DM0A 3UA3A 3PLAE 3AY0A 4WXHA 4FSXA 4OBWA 3K0BA 4C04A 1TW3A 2Z6UA 2YX1A 5LQCA 1NW8A
chains in the Genus database with same CATH superfamily
1FNCA 2F4NA 2CJPA 3KJXA 1FFBA 1I4TD 3A10A 4UAUA 5EEHA 3VDQA 1NATA 2I87A 5A6SA 1ITZA 3WADA 3LFHA 1R4MA 3GK3A 1EPUA 3D64A 3MTBA 4NYMQ 3C6MA 1LD3A 1M1YE 1O8BA 4ISCA 4AJIA 4H9GA 1LRKA 5FTJA 4RTPA 1R9MA 2W90A 2Y9PB 2PJDA 3O47A 3LNCA 1Z16A 3MJFA 5C53B 4YONB 1CP2A 3AY6A 2BSAA 4ROTA 3V4FA 2XCLA 4XGRA 4ZI5A 8AT1A 4NPCA 4BVEA 5JS8A 4Y6SA 5GMOA 1T15A 1VSUA 3IDSA 3V46A 4DCJA 4QPCA 1F17A 4V2UA 3OQIA 1QH1B 3C3XA 3D1JA 2A1UA 3COVA 4RVNA 1PFVA 4H08A 4MDYA 4DV0B 4PWZA 4M1MA 1ISJA 5D00A 3E9NA 1XPUA 4FM9A 3LC2O 2EZ4A 3DR5A 4MVJG 1OXSC 3TUJC 3VPDA 3NX4A 3I83A 1OI7A 3BT7A 2YWJA 2CJXA 5EMNA 1WB5A 4ARUA 1IOLA 4K2AA 3UJ6A 4TTVA 3SKVA 2QRVB 2P41A 1IB6A 1R74A 4JVMA 1V26A 2N1MA 2BCJQ 2BGMA 2P7IA 3SC3A 3FWNA 3PDWA 3V2UA 2JATA 1L5RA 3H2IA 4R2HA 5E7IA 4BRZA 4BV2A 2QIOA 3I28A 3KKZA 4IV8A 1JHAA 5IUJC 1U1IA 1E5QA 2FFBA 4QLBA 2C54A 1XRSB 4MWEA 1L7QA 4ZRNA 1LFAA 2X5KO 1M2GA 3ACBA 4WH0A 1M0TA 1GSIA 1GR0A 1HH4A 1VBFA 4GFDA 5EKDA 4QDOA 4D98A 3PI6A 1RU3A 3O4RA 1US8A 5D01A 2UVDA 3M6IA 3BUSA 4D45A 4OP1A 3OCXA 1V8FA 3A6DA 5DTQA 2P9QA 1XZIA 1U8EA 1C29B 3UGQA 1KEZA 3MELA 4NBSA 1H0SA 4OREX 3Q8LA 3MT9A 4A6PA 4LDJA 1VFNA 1YC2A 3QWIA 3I6IA 3L6EA 4MCHA 2VNJA 1U7TA 1G5FA 2ORYA 2QTNA 1ODJA 3DT9A 1KHTA 2MR5A 2WUVA 2YHBA 3BMNB 1YBFA 3KYJB 5GGYA 4Z4QA 3Q7QA 3OLXA 4C0SA 2FPPB 5KJFA 2QEQA 1X1SA 1PYOA 1Q7EA 3THXB 5BW5A 1DC4A 3NGLA 1ZONA 2YV5A 1ODTC 4PHCA 5IMSA 3O8RA 4YIKA 3ZQ4A 5B7PA 2JC3A 5DBIA 2VF7A 4IIDA 4C7VA 4A27A 5KTYA 3K70B 3AUXA 4QWWA 2D0PB 3M1YA 5HIJA 3T0FA 5DCWA 1UJ2A 2P5UA 5F7OA 4L8WB 3GI1A 1GN9A 4KCGA 3U4QB 5HIKA 4IDEA 1P60A 4Z3KA 1HLFA 3B8EA 4P86A 3FOAA 2P9BA 1N8TA 1UOQA 1V1MA 3DL4A 3INYA 3KEOA 1LDMA 4QX6A 4TXNA 5G4KB 5DISB 3HPQA 1A9RA 4BDSA 4OHFA 5EUQB 4IX9A 3SXUB 1ST2A 4M86A 3QE3A 2IDJA 2Z8ZA 2G83A 1KGSA 1QYRA 3P45A 3QRWA 1HORA 3U37A 4HGNA 5FTNA 4I1UA 3RT9A 1N2CA 4QQKA 2PMCA 2RD2A 2VBIA 3BGDA 1XZNA 2WVHA 1OU0A 2J59A 2X6RA 3TQRA 4DV7B 3W9UA 3LK7A 4QDKA 1JSXA 1GAJA 4PO3X 1M6WA 2WP0A 4HC4A 3SE0A 2XZPA 3HO8A 4P5EA 2COUA 4IYRA 4CLDA 4D8YA 3UUGA 3JSAA 4GZMA 3GJ3A 3H1FA 4WTOA 5AKGA 5TPWA 4B6GA 1IN5A 3PD7A 2C4WA 4INZA 3ZV6A 4Q02A 2ACWA 4EQ6B 3O4IA 4UHJA 1M76A 1PX0A 5C51B 4E21A 3EFOB 5DYWA 3T5DA 1Q1NA 3H4MA 4L51A 3WGYA 2CXNA 3LKVA 4QLOA 2C3MA 4QQ8A 4P81A 1E9RA 2Q6IA 3F3MA 4GDMA 2RMKA 3ETCA 4DHEA 2D00A 3EVDA 1IPHA 3B2EA 4WADA 4H0FA 3D3NA 3ASYA 3GRAA 1XCBA 3F90A 3KKKA 2UYQA 2ONJA 1PJBA 2QTGA 3K92A 3NDJA 4WGGA 5GV8A 4BMZA 3IQZA 1T26A 3LPDA 4GYKA 2J9FA 4JOSA 3DVAA 3AEKB 4I2NA 5DP1A 3N28A 5ADUS 3ZQ6A 1CRQA 1CUFA 4DV6B 3LHIA 2ECPA 2X13A 3WMEA 1CTQA 4FYMA 4X7PA 4BFUA 5JOQA 1ULSA 3JD2A 2I65A 1A88A 2NSJA 4OFZA 4XKJA 2EL7A 4GG1A 1JHDA 1T8UA 5ERYA 3L6UA 3BXHA 3WNZA 3NAGA 2G1KA 5EJ6A 1P72A 3L40A 1ODKA 5AVQA 3PXBA 4R01A 1SQ5A 3FNGA 1ISMA 4NULA 3ZNPA 1NR7A 5H16A 3K72B 4FHCA 1CIVA 1E79A 1JVBA 1NQXA 3QHQA 4HGZA 4YQYA 1YQ9A 2QUIA 5CB6A 2KBFA 1WUYA 2FLWA 2VP5A 3GCGA 2GAIA 3R9WA 4YRFA 3WWYA 4FNGA 2QHXA 3HNOA 2X2OA 4JSYA 2O9JA 4GSYA 4CFSA 3VR0A 4CYMA 2VRCA 1SZJG 1XEWX 1OD6A 4KV7A 2OZKA 1U90A 2WLTA 4PYQA 3KUUA 1TFRA 1GKKA 3KQSA 4PX3A 2FW6A 3I92A 2DSNA 4IIVA 4QG7A 3KT6A 4TV8B 2Y0PA 1B8VA 4OXQA 4EYKA 2HH9A 5CT6A 2P8JA 2DWOA 4K6CA 4CIAA 3DEIA 4JI3B 5AK3A 2ISCA 1X7GA 3JAKA 3PA8A 4C78A 4F60A 1DFGA 1L7DA 2HHHB 4BGIA 4EELA 2PVCA 5TF4A 4PYRA 2DR3A 3AVQA 2OO3A 1MJ5A 3DAHA 3FLMA 3HI6A 4DLVA 2ZZMA 2ZAYA 1PR3A 4KZKA 5IW8A 3H5LA 1X1CA 1MX3A 3CZMA 2A4MA 1UWVA 1YUMA 2GTPA 2ZWMA 2QDXA 1RI2A 3DE4X 4ZTUB 2G70A 1L5FA 2WSMA 4ZAZA 5T64A 1XU7A 2ZBGA 3DVAB 5JQGB 4LRYA 4MYHA 4ZJUA 2I67A 1YOVB 3PPYA 1C3JA 2VHXA 4US0R 3MLAA 2KSQA 3VSBA 4EPXA 2QUZA 4S1WA 2ZYIA 2WSLA 1KARA 2IPMA 1AUQA 1IH8A 2J1LA 5AJYA 1FVHA 3PFKA 4AD8A 4IHQA 1H2RS 4FLFA 1UP7A 1B16A 1DE0A 4YV7A 1U7WA 4DQLA 1QVVA 3EOBI 3CUUA 4A8JB 1E60A 1YV9A 1BFUA 5DOZA 3R3UA 1NDQA 1RIIA 4IICA 4KDCA 1M83A 1GNSA 4QD3A 5CK5A 1E4EB 4A8HA 4B47A 3T0IA 3LE8A 4W4TA 1R9JA 6YASA 1ZJZA 5H3HA 2P2ZA 2XOKD 4FYHA 2WWFA 4RQAA 1KK0A 4J9UE 1VG1A 3G3EA 3CCBA 3RIEA 4M0EA 1U9IA 4E6EA 2YJTD 4S0XA 5EPOA 5SY6A 4H59A 1WMDA 5I4CA 4GPAA 2Q4TA 3LZCA 4MAFA 4NH4A 1XDBA 2FQXA 3HYSA 3VH4A 3W6OA 3PG5A 1P39A 3WS7A 4RPJA 4A4DA 2LD4A 2WY2D 1NVVQ 1XRLA 4GL4A 4LYJA 5AJTA 2WT4A 3OPXA 5HGJA 3UY4A 1I7SB 3CG0A 1RZ3A 1KE2A 3DD5A 1YQGA 2Z57A 3VYRB 4GPIB 4ED9A 4UUPA 3OZEA 2FFAA 4R05A 2CHVA 4E5KA 4MKXA 4TKVB 4X90A 1Z18A 2P4UA 3DHYA 5CLHA 1B6SA 3DUFA 3MT0A 4U8GA 3T5CA 3DJFA 4LHVA 2BGGA 3WGJA 2PKQO 4C7BA 3L5OA 2AMJA 3C3CA 3Q12A 2C0QA 4HAYA 1AF4A 4C0AC 2I7TA 3GEMA 3OZTA 3QIVA 1R10A 4WFIA 4GMHA 4QOSA 3WL8A 4UBNA 2HM7A 4YUWA 3AG5A 1GV1A 4B83A 2H7CA 1QE3A 3UW1A 3BHJA 4OQ4A 5FAXA 3WGLA 4OUKX 1SMKA 2EFDB 4U7TB 3OQBA 5C3UA 3PFFA 1N1DA 3EQ8A 1PGOA 3K9BA 3V80A 3EXEB 5F78A 2G63A 2VNKA 1R50A 2ZBQA 1RRPA 2EOAA 3RIHA 4EP1A 3DBLB 2VJAA 3WGIA 3B6JA 3OM0A 3E7FA 4GPBA 3WK5A 4II2A 1PJ8A 4DSNA 1IN1A 3BMQA 4FT2A 3MOSA 4QYXA 4DQDA 4MTLA 1I0IA 4JMPA 4AZVA 3ADOA 3MOIA 1T1EA 4GLOA 5AKXA 1NQUA 5BVHB 3DF7A 4O2BB 1HYQA 3RTGA 3V7UA 3TQCA 3AR3A 1ILEA 1NAIA 1P77A 1XFAA 5KHOC 1ZUHA 4EDHA 3PQ7A 1U3CA 5HKKD 1C0EA 2IYQA 1QSGA 4OAPA 1GDDA 1OJ7A 2W2PA 2DUNA 3HLYA 3PXXA 1J21A 2QYSA 4XIFA 5MN5A 4G89A 3PXCX 3V8BA 4Y3UA 3BZBA 3T15A 2XGGA 1KK1A 2CNWD 2O50A 3DS8A 2AXQA 4B4DA 4YPOA 1PG2A 2VOEA 5IAEA 2XUAA 2PZ8A 4W1RA 1HYEA 3JWJA 1NXTA 5ALUA 3HCPA 4JL8A 4KQGA 4AULA 4QGAA 3RRYA 1N4DA 2GJAA 1KAOA 3AMVA 5P21A 5TNXA 4U1RA 3DPSA 4IGKA 5AO9A 4DCOA 4E12A 3WNBA 5A9TA 1D4FA 1FRNA 1VL8A 3GYBA 1HDXA 2OBMA 1O58A 3JQ7A 2B4KA 2IIQA 1Y5IA 3L1KA 3VR5H 5LQJA 4A26A 4D44A 4PXYA 1EBBA 2HHAA 4LY3A 5CK4A 1D2MA 1ZEJA 1DWQA 1RHJA 4PLYA 4QSMA 4I3HA 4H6XA 2X0FA 1TKBA 2DTXA 4DB4A 4BDTA 1XQ6A 4R8KA 5EHQA 4P53A 2JIDA 4AN1A 3VPHA 4EKIA 3HDHA 4FZ3A 5LQKA 1J8QA 3ZHOA 4AF7A 4I6EA 1UT8A 4ID9A 4ZHQB 4IDGA 3MIZA 2CDCA 1JKFA 5B57C 2JJYA 1W0KD 4WFQA 1DDGA 3IJ5A 3WOVA 4HAVA 1X3LA 1KZ6A 3BTSA 4BC0A 4R1QA 3W8RA 3REQB 1WUTA 4QTZA 1TAHA 3UG6A 1ZEMA 5AJVB 1D5CA 2I76A 3OJFA 5EN4A 1A2KC 3VDNB 2VZLA 3Q8XB 1L5VA 4ZYVA 1DBWA 4B3IA 4C6SA 1UANA 1UUFA 2QRHA 2EFCB 2Q8PA 3H2YA 2XW6A 3ORHA 3EZGA 1R0WA 1TQ8A 1W5TA 4PG5A 5TS3A 3KSZO 5TT1A 4O59O 4D4MA 3GEDA 1Z3IX 2YCBA 4MRMA 1JR6A 1JG4A 2J08A 3WB2A 1ZD4A 4MQ6A 4MAAA 4W5RA 5HQ3A 4HR7A 1CHNA 4IS3A 4YRLA 1ZCZA 3ANNA 4G1FA 4IZHA 1ZVKA 1T5TA 2GK3A 4ZEVA 3FGPA 1RNLA 1V35A 2GBCA 2NPIA 2WU4A 4TKZA 4YJ2A 2BBOA 3IVCA 2XB2A 3I2KA 3PJFA 2LV8A 1T1IA 4R81A 5EWJA 2AG8A 1BE8A 2ORED 4BCCA 3U3XA 4Y6GB 5JRZA 3D0OA 4JX9A 4EKDA 1GSHA 1XDDA 3GP3A 3I1JA 5AI6A 1MEJA 4S1OA 3TG8A 1T1GA 1WDTA 2FH5B 1V5FA 4FS3A 1RC8A 3O4VA 2H0RA 1NUHA 4JLBA 5EQDA 1ZM2A 2PKXA 3FUVA 4CVNA 5L4SA 3U5ZB 3Q87B 4IW3B 3GUZA 4RIFA 1F4VA 1FSFA 1NBMA 3L4EA 4G0OA 2FDCA 2ZB3A 4TYPA 4PSVA 1J0XO 1JA0A 3S0JA 2QP9X 4YUYA 2O8CA 2GPNA 1QK3A 4L74A 5LBUA 3FX2A 1H05A 3AFOA 3CZCA 3L8EA 5B7GA 5BMVB 1Q74A 2GCNA 5KOHB 5IVPA 1U31A 3GMSA 1JU4A 3C98A 3OSZA 3ND8A 1AURA 3RSGA 2AOUB 3MUOA 2NW6A 2XQGA 1VMIA 2YOFA 1CJKC 3KKLA 1V4VA 4NQZA 2NO1A 3AY3A 1AKYA 2VH2A 4PC3A 4DNQA 4EECA 5I4BA 4L6IA 1ZH4A 3JV7A 4FPXA 3WKAA 4E46A 4ZJPA 1WQ4A 3K0FA 3FPJA 3QF4A 3LRPA 5JMPA 2O1WA 4WRRA 4V1CB 5LU8A 3P4YA 3DWEX 2Q3MA 1YVUA 1T2AA 2E5FA 2O54A 1U3FA 1YJ8A 1FFGA 3KNZA 1RWPA 3F9IA 4INJA 4LX0A 4LXTA 3V1NA 4BAGA 5DW0A 3SGLA 3O2JA 1ZK0A 2WJVA 4WCFC 3DFZA 3EVZA 1X8LA 4RW0A 5FFFA 1LWOA 4TMWA 4J2OA 5FOTA 3AP2A 4X8LA 2VDVE 1SC4A 4GI2A 5HJ7A 4NU6A 1E1QA 4P83A 4BQPA 1DB3A 4ZO9A 2JLZA 3BWYA 4CCSA 2BRUA 2GYWA 5EQTA 4YRSA 3NO4A 1LRJA 1WU7A 2IXFA 5IG2A 4MQEA 3GEIA 1N2ZA 3OQMA 4FE4A 2NV0A 4TGLA 1W1UA 1XD9A 2QD2A 3JATA 2OMKA 3OPYB 3K5WA 4OKNA 1KYTA 2IH4A 4DA8A 2XYQA 4YROA 5EJMA 1A9YA 1J1ZA 3Q15C 4J0QA 1JEOA 4FSXA 4QOEA 4OBWA 4TL6A 3L7MA 1F0KA 1RLUA 3K0BA 4CM1A 2QRLA 1IZ9A 2BFDA 2G09A 4P35A 1FTNA 5IVDA 1T2VA 1QONA 4IZOA 1IYZA 2BFFA 3FPGA 1GTVA 3RKRA 3SPXA 3ZDFA 5H3LA 2FA9A 3L0IB 5JLJA 5GGXA 1Y80A 2PGOA 3LSTA 3MJDA 2RH8A 1FFXB 4IDPA 4ZDWA 3NTOA 4ZVUA 1FFWA 2BFEB 2YZKA 4XAQA 4OMDA 3GPLA 2OAGA 1GIAA 4F21A 4KYIB 4LHEA 1A9XA 1OILA 1ZC4A 4IKPA 1C7RA 5B58C 3A9TA 2D1SA 4KBGA 4RZUA 2IXBA 1N5OX 1OA0A 2G9RA 3EOZA 3LD9A 3O9MA 4NPHA 1RM0A 3E9QA 4FFMA 1L4KA 4RFVA 3UBTA 2HNBA 3B60A 3JASA 3SDZA 1E3JA 1RE0A 4D4IA 5HQTA 4GWKA 3THYA 1L5LA 2LTAA 2NU8B 3SHOA 4WY8A 3FB4A 1W88B 1XTRA 5A71A 4D9CA 4NV1A 3M6VA 1E2HA 3FZNA 1OXKB 2QJFA 3OZRA 4EVSA 2IHZA 4PTLA 3KJEA 2YOGA 1TZCA 4I8XA 1BE1A 3OQOA 1XVTA 3GVIA 4FN4A 4O5AA 3T52A 1GN8A 4BEBA 3AXSA 4AQYB 2R6HA 1YA8A 1U6JA 3B5EA 4FMBB 5NLLA 2K7FA 2BH9A 4QELA 3AINA 3ML1A 3OZWA 4K6KA 1IWBB 4Q4AB 1GG5A 4ZMBA 2DBQA 4PPGA 4XH9B 3PPXA 4Q1BA 2ZKLA 5EEGA 1QP7A 3M0EA 1H4TA 3O7MA 3HGQA 3GQVA 5UKDA 2IW3A 1QGOA 1VI2A 2O2JA 4XYLA 3OCWA 3K71B 3GGGA 5IK2D 1IOWA 1U65A 2VUUA 3FVWA 3I5AA 3AKZA 1JT2A 4M1SA 1F4LA 1BAPA 1WULS 4XSVA 3ESQA 4KQCA 3S4YA 5IKOA 4FD3A 4IQ4A 4Y1RA 2CBZA 4MR7A 2QRKA 4TSFA 5EJFA 2VLBA 1CS4C 3GW8A 5CH3A 2VI5A 1OX5A 1HT2E 3CEPB 3X0DA 2P5YA 3VDXA 1YQEA 3NLLA 5ADWA 2W6ZA 3IA2A 3IQFA 4YCJA 1KS9A 1CEYA 3FVTA 1FVXA 4N5LA 5FA8A 1F6WA 3OMLA 4X3CA 1IY2A 1G59A 1RLMA 3FCSB 1BDHA 4W8GA 3WTBA 1JIXA 1AKTA 2B20A 4JJ4A 4MJXA 4Y1EA 1QG6A 1ZWLA 3PX3A 4AWXA 4ZV4A 3F2IA 4CF3A 5C8YF 1ADJA 1RC0A 5THKA 3DP7A 4GP6A 4OMFG 4MWGA 5MGNA 2IPXA 4FFDA 4G5GA 4CFYA 4E70A 3RBXA 3H84A 4EFKA 2PXHA 4MIYA 4B9EA 2A88A 3QVXA 1DIAA 1ORVA 3I23A 2XB4A 2OCBA 4YRRA 1TIPA 4HZIA 2ZVJA 5FWYA 1RJEA 3D3WA 4TM8A 3PT5A 3HHPA 2F3PA 1IQ0A 1P4RA 1UBMS 1YZNA 3P9XA 2INGX 3UFXA 2NU7A 4BBJA 3EWSA 2IUYA 2QE7A 1Z56C 4JNKA 4C7JA 5KX5A 4U6QA 1RXUA 5C4MA 4EEXA 2MSWA 1KZ1A 2FU5C 1P3DA 2N46A 1B0ZA 3SK0A 3IS3A 5CB4B 5IRCD 3AESA 2FP3A 4OQZA 3GGOA 2E9SA 2ZBRA 4CE6A 1X80B 1YBAA 1KTVA 2HRRA 3K32A 3OG9A 3OM1A 4HBZA 4NENB 4UPDA 2IUSA 1T8YA 3H8WA 5SY4A 4GSKA 1JBQA 4BNKA 5A02A 4X0EA 9ABPA 1UZAA 2HF7A 3I0NA 3RK4A 4KRYA 1Q7TA 3IP9A 2QF7A 2C4MA 1U2EA 3PC7A 1FQJA 3D1LA 1J99A 1LPPA 4TTIA 4K6FA 4A15A 1CK4A 2OE2A 1VHDA 2CHUA 3FSJX 4B44A 1L8LA 5DX8A 3SLRA 2H7YA 4YT8A 2UV8A 3PHCA 4WNYA 4BLOA 3FR7A 2PVPA 1K5GA 5KYVA 1QQ7A 4WKOA 4CMEC 1Y3BE 2IWHA 1RJ9A 1YBHA 1QTQA 3TI9A 2ZRBA 2XH8A 3UV6A 2E0IA 1KEEB 4PNHA 2O14A 2YYSA 3SJAA 3OUZA 4FLEA 821PA 3B3AA 5IEJA 1CF9A 5JMWA 5AMXA 3UK1A 1P2GA 2YJ6A 1NE2A 3T4XA 1F9EA 4K88A 1BDJA 2FE4A 4D0SA 1VLMA 3PUIA 3DBOB 1Z4KA 2OV4A 2FPLA 2Q7XA 3NUGA 5J5AA 5BN5B 3RFUA 4F7WA 1N36B 2BTOA 1VGVA 3GVCA 3MEQA 1GZ3A 3CLTC 4DTCA 4NATA 3E53A 3KXDA 2B1GA 3NHAA 1LC0A 4PYKA 1OWLA 3HA7A 2ZUTA 4UNPA 2QPOA 1K8XB 10MHA 3ULKA 3VKGA 2PLNA 5IKEA 1VYUA 1YRQA 3TRFA 4KTVE 2QJWA 3R5KA 3W04A 2F7SA 3PUHA 5DI9A 1A72A 4E13A 4HAOA 3PWSA 1RW4A 2GEVA 3H18A 3LMKA 3ONDA 1UFOA 4M1ZA 1H2ZA 3FE2A 1QYCA 3PP8A 4QICA 4CETA 1EFPB 5JAPA 1G7SA 3VU8A 1HT0A 3FHCB 2HU5A 1OIXA 1TMOA 2QW8A 2Z8XA 3QU2A 4UHCA 1T6YA 4Y0NA 4BLSA 2PGLA 1MX5A 1U0OC 3PENA 4G1EB 4JQYA 2A67A 3JQEA 4Q48A 4RGQA 1VHJA 2QUJA 2YS6A 5CVTA 1T9GS 2IPNA 4GOJA 3BB4A 2HY7A 2NUPA 4I1YA 1VQ1A 4MUNA 4AK9A 4FCCA 4EMBA 3RYCA 3ROQA 1XSEA 4NOJA 1UZNA 4OI0A 3RVLA 4MV1A 2UKDA 3CJTA 3L7NA 2O05A 2JLRA 3ESAA 3L1JA 4BS9A 3R7WB 4M54A 2HHJA 4Y2UA 2VIIA 4JJGA 1JG2A 2PYDA 1KIMA 2WD7A 3FKJA 1J2EA 2F9FA 4LYFA 3TX6A 5JXIA 2I78A 1XI2A 1DIRA 2IPLA 4S2EA 1F60A 5HZHA 5CPFA 3BRSA 1J8YF 1PDOA 2DPYA 4YRPA 3RYHA 3U40A 3ZG6A 4EIWA 2YKGA 1JA9A 3A9UA 3GLTA 3UK0A 1THZA 4Z0HO 2TMKA 4ZRMA 1YMUA 2PYIA 3COSA 3EK2A 5THQA 3NYRA 3E0XA 3CLUC 1H93A 3IGFA 1QVAA 1ZX1A 3UAVA 1Q7BA 2HPZA 2IKSA 2PHZA 1RM5A 1VMAA 2BEWB 2WMOB 2V54A 4GUDA 4WAUA 5FUYA 4FCVA 3HJUA 2C2ZA 3O93A 4I19A 4QJBA 3HSSA 3T95A 1ZSNA 5KINB 2GXAA 2YZNA 2ZJBA 2QW0X 3GJXC 3S2IA 3H9CA 4DJJA 1R6BX 1YDEA 2AOXA 2EKZA 5JRDS 3L7DA 3VKHA 4N54A 1R0KA 4XDGA 4MVYA 4IEFB 4OP2A 1OXMA 4V24A 2VYND 1IBCA 2P9HA 1MB2A 2ZE6A 4PTZA 5AOCA 4HMPA 5B36A 4PGAA 3F49S 4PQRA 4KR9A 3RADC 2RGWA 2JFBA 3VZSA 4E15A 3BHNA 2ZIGA 4MRNA 3KU4A 3H19A 3WYNA 4ZYTA 5CGQB 1NONA 4EATA 1ZICA 3HUTA 3QVSA 4DMKA 2ZTHA 1NF8A 4RSHA 2P62A 1O95A 1QS0B 1O2DA 1TB4A 2OG1A 3K9QO 5PNTA 2QVBA 1SKQA 4PZLA 3WOHA 4Y6RA 2D6FA 4QVIA 2VYCA 3QLTA 1WRBA 4WNIA 4DW8A 3GJQA 4G8BA 4OD0A 1OH6A 3DFMA 2Q5QA 3DWGA 2C7VA 2V45A 3Q10A 4GZ5A 4RHTA 2NYUA 2YXLA 2RHTA 3GZNB 3M83A 2ZDHA 3T5PA 3Q5GA 4N47A 3A2NA 1YZVA 1KVRA 1I2CA 2AMFA 4KGVA 2OILA 4MVJM 3AFMA 2B1IA 5EJIA 1T1JA 3M6FA 5K3CA 1JR4A 3UOGA 2O2IA 1SIOA 4NOMA 3QVOA 1SU6A 4K9OA 1DRJA 1DKRA 2FN3A 1RWXA 4Q1EA 2IYRA 5KTOA 2I4MA 1GQSA 2B98A 2FRDC 4I99A 2O5EA 2EX0A 4RPLA 4CMJA 3WJ7A 5KKNB 3LCJA 4JT2A 4JLPA 1CJSA 5GJWC 1N2GA 3WLJA 4JHXA 3LA8A 4HLNA 2ZI6A 1A0OA 1AS3A 1AA9A 1GKIA 1YOBA 2A5JA 2W9XA 4HYYA 4LQ4A 1JR3E 5DI3A 2HBYA 4UBKA 2IYEA 4UMVA 2VDRB 3I9KA 2WNIA 1YCHA 2I2BA 4YDHB 5K8LA 2YMMA 1D9ZA 3ADCA 1F20A 3TVTA 2V3WA 4GLFA 2H85A 2WP8J 4NV3A 4BFSA 3EEFA 3SD7A 2P77A 1LZLA 1VIAA 1DAPA 5I9LA 2H1HA 4MHTA 1QOQB 1IY9A 1T8RA 4XYMA 4D9MA 1GVHA 1NMSA 2WHPA 2XIJA 4DDMA 3FPLA 1WO8A 3LT5A 3K70C 1VLQA 2X0RA 4KU4A 3HA2A 3ZH9B 1QO7A 1SWVA 4UHDA 4E1AA 3KLBA 1ZCAA 3KETA 1J8MF 1ZZEA 1KDVA 1ABFA 2GFQA 2QSYA 1BU8A 1NQ5A 2X58A 1L7EA 4NCHA 5IBRA 1MAWA 4RS4A 1NVUQ 3A6GA 1BJRE 1YNOA 4H3HB 2FSUA 4GRDA 3FNEA 1BMQA 2HL6A 2JIZA 2ZVQX 2WEKA 3GJ6A 1L5QA 1I2BA 1HLGA 3N59A 4LNUA 5FORA 1S4QA 3KE9A 1G8GA 4JUAA 2X5OA 4LWQA 3I9V6 1YR7A 1N6LA 5C9ZA 3EBOA 2A5GA 2ZT8A 3VVMA 3MJTA 3B85A 4MUJA 1SVNA 5L7TA 2AKYA 2YN2A 3RRFA 4C5BA 4D80A 2VQFB 4CCWA 3IDAA 5BQ3A 1AKQA 2YIDA 3WSWA 2W2LA 4XDZA 4BWYA 2V65A 2WNHA 5CPBA 4IVQA 3K0CC 1NWCA 1AS2A 1BS2A 3CLRD 2IY8A 3FPSA 1UFKA 3Q8KA 2R5WA 4BVLA 1RJFA 5EJ2A 4YV1A 3DBHA 5BV0A 3D2CA 2JZNA 5A4MS 3EMKA 1GTMA 2H08A 2XF2A 4ENRA 3ORSA 4XVUA 4HQ0A 3QYAA 1BD4A 4EF6A 3EIUA 2QQ5A 2PYZA 3QWHA 4IO0A 1X42A 3K5PA 4K8RB 4MYCA 1I2MA 3TXYA 1LPMA 4A82A 1Q17A 1VKJA 1HEUA 4MIOA 3DKVA 1VA4A 4LHWA 1SUWA 1G2PA 5B5SA 4M1EA 1CY1A 1KZYC 3RVMA 4H7IA 4AG6A 5HTOA 1RI4A 1LVGA 2BN4A 4M2LA 4BMPB 2RHDA 2QYTA 2OHHA 2PL3A 3O8NA 3ZE2B 1N3YA 1X8XA 4YRGA 3CONA 2NUTA 1BWQA 1UBKS 3GR6A 5P8WA 5FUBA 4DR6B 1Y3IA 3QU4A 2Q9UA 4UDXX 2Q6TA 4J76A 1PUIA 2IT1A 4FXPA 4IO1A 1MENA 3MQ2A 2HA3A 3CEMA 4N7MA 5KIAA 1M6YA 2ZJOA 3AHGA 5FOUA 4IJVA 1PEYA 1FPQA 5EIFA 3R7FA 4G0PA 1EWKA 5KJCA 1XMJA 3AB3A 4B43A 2GBIA 5KDOA 4EA6A 1BROA 2QVGA 3OPQA 3U44A 3P9PA 2HCBA 2WKQA 1R5JA 4HL6A 2HADA 1HQDA 1G5HA 1TAQA 5EPEA 4NNJA 3TE6A 1CETA 1KJNA 2YASA 1DTWA 4KQEA 4DLUA 4X95A 2IDZA 4PFSA 5IZCC 1Z38A 3KYDA 4FGZA 3I4LA 1YR1A 5TARA 4CR8A 2HBZA 2X41A 3A6EA 3CC8A 4JYZA 5ABPA 5I9SA 5F4BA 1PJAA 2ZTMA 1P8JA 4HWSA 4HNAB 2JLYA 2QRZA 3R0IA 1HY3A 3GPDG 3SJUA 3IEUA 3U7QA 1VPVA 3IB6A 1GV0A 3ADKA 4PZEA 4RVHA 4XYGA 5L6MB 2JBWA 1WW3A 2H18A 1LA2A 2X23A 5I47A 4ARCA 5F1OA 3EZXA 4R4JA 3FTFA 1QRRA 1MHPA 3I76A 4BFTA 2Y1GA 4QJ3A 5AVWA 4Y6PA 1YRLA 1P4SA 4I4IA 3TLMA 1MX9A 2WTEA 2WUDA 3ZXXA 2VXOA 1OYVA 5HJ2A 2V7VA 1SA0B 3E5NA 5JARA 2PAAA 1XJ0A 2GEDA 2DE0X 1XTJA 1K7SN 2DBZA 2QJOA 1USGA 4GLLA 2MMGA 4HVLA 1PT6A 4KMOA 1V8DA 3MCTA 4PF1A 4YRCA 4TSFD 4Z51A 5DHPA 2NACA 1QRUA 4FXOA 4KMRA 2EGUA 4RA6A 3U1TA 2GWHA 4KWEA 4OL0A 4BVGA 1EBFA 1U3GA 3IOYA 3IMFA 1SOWA 2TMDA 4LXUA 4TKUA 2C2OA 2FVXA 3D7SA 5K3BA 1RAGA 2WQ6A 4M55A 3QMWA 1O0CA 3H13A 1V8BA 1VXOA 3PNQA 3WGUA 4EEKA 4C03A 2DKNA 1XBTA 4N40A 1UMKA 4GC9A 1E1DA 1U7HA 1M54A 3LYAA 5GZ6A 2G9VA 1JDNA 2OYSA 2OCKA 3RG2A 1SU7A 2VHQA 1V1JA 3DCJA 1WE2A 3WICA 2ZAGA 3G0IA 3RAJA 5F23A 3WV5A 3IE1A 3GV0A 4W1PA 3JD0A 2ZRHA 4X3PA 3CZ5A 5BQXA 2W98A 3V8MA 4GS5A 2Q5HA 3Q7RA 2ZSIA 1F06A 5AQ1A 4BN4A 1Z2CA 4YXWD 3SC2A 5JZVA 1MA3A 4YO8A 5HILA 3SYLA 4MWOA 3VYTB 4AMGA 1KKUA 2NMVA 3GMTA 4ZYXA 2Q3FA 1A69A 3O92A 4TLEA 4HXFB 3HUFA 3SFZA 2W93A 3MOGA 1RPZA 1EAYA 1XZGA 2NPOA 2JFPA 4KP7A 3SHWA 2P6MA 1M3SA 4LVOA 1NNSA 4FT4A 1BKSB 5K0EA 1A8UA 1UXGA 4WCFA 4FC6A 3FSEA 4ISBA 1JVSA 4JI4B 2GS9A 2PPLA 1CC1S 2ATCA 2Y9MB 2H9IA 5AXDA 5A7GA 1J2JA 1W4ZA 3A1UA 3AUYA 3DDCA 3F71A 4FBLA 3F8SA 3QMVA 3EA5A 1NX9A 1J23A 4J9VA 1CY8A 1JI0A 1M6NA 3CUTA 3QXJA 1SVUA 2QX6A 4MUMA 5GAJA 4LDZA 4IIJB 3NIFB 4BAUA 2CCKA 2I3BA 4D9FA 3GFSA 5EE0A 2PLFA 1R0LA 1QR6A 1UDAA 2CFCA 5AIAA 1U04A 4LN1A 1WXHA 5EZ6B 3D2BA 5AT1A 3K1TA 1Z7WA 2PVSA 4RORA 1DAOA 2QXTA 3CU5A 3WNVA 3IPYA 3WSVA 5I3ZA 3U3OA 3LKZA 5AVOA 1I10A 3QI2A 1MAVA 2XQJA 4XSHA 3RS9A 1M0WA 2CXRA 3OFJA 4MLCA 3V8EA 4BE9A 1K9SA 3NQ41 1IRIA 5FH9A 4EB0A 1TAGA 1UM9A 2VUTA 1DXQA 3L8FA 1BYUA 4FSHA 5DHQA 2EQBA 1TTPB 2AFHA 2C9MA 4Z49A 5A1TA 1H1LA 3LT2A 1SEVA 4MA4A 3D59A 3O95A 1TZ2A 4B71A 4CM5A 4O08A 1BW9B 1T6BY 2DQKA 4YK7A 3W6UA 3GLVA 3QJYA 4JBWA 1CCWA 5J4VA 5E6SA 2QMZA 4ZI2A 4TRRA 3I6MA 4TTAA 5TQ2B 3WHIA 4REMA 5DU2A 2WIGA 3EFBA 4R8MA 3Q7SA 2BEUA 2J6BA 4RD0A 5KVAA 2RHGB 3U31A 3WIDA 1MV8A 1CZOA 3HA5A 4L4RA 4Q19A 5GQSA 1T9BA 3ZWXA 1SCJA 5JAQA 4J16A 3Q8WA 4K2HA 4NNOA 2FZ4A 2R6CA 4O4JB 5AESA 3KAQA 5I7SA 2DT5A 4X66B 2EJVA 4JBIA 4NEGA 1N0UA 2IF2A 4Z9BA 3I01M 4HXEB 1BNCA 5AI9A 2YFQA 3IAAA 4OHOA 4RUKA 1X7YA 4QRDA 1Q21A 1ZMTA 1HUQA 3ZJUA 1TKCA 4TTJA 2R6ZA 2QXYA 2R1ZA 1RT9A 4PGGA 2JPDA 4G5HA 2GN1A 4HY3A 3NP7A 2W2QA 4GGOA 5ED0A 3L0CA 1J7JA 4Q1CA 3IUSA 3ZIUA 2NX2A 3C3WA 3FKSD 3WLIA 4ER0A 1CJTC 2QD1A 4HJXA 4PZCA 1QRSA 1DHTA 2EJBA 5B30A 5EXEA 3ZWDA 1NQOA 4JI1B 5DYNA 3SKYA 2Z5VA 3EC1A 2Y2VA 2VLIA 3QUSA 3NBZC 1HSOA 1AHNA 4L8VA 2NVOA 4CV1A 1B6RA 3FY4A 2Q0XA 1VA5A 4UC0A 4JP5A 5FNZA 5MDHA 1NVKA 4NTZA 4PZ0A 1K0UA 2GJSA 1QLWA 3AJAA 4MEBA 1E58A 2B5WA 2G3YA 4C4ZA 2AXNA 1R37A 4ZALA 3X1YA 1I5OA 1TXGA 4CTOA 1JFRA 4WJZA 1OHHD 4GP7A 4J4TA 5JNLA 5KYYA 1GQFA 3HVRA 5WRFA 3ZQJA 4Z7OB 1CUJA 4KKVA 4WLOA 3P9NA 4EFLA 1GRQA 1IWPB 1UPAA 5LWHA 4M38A 4DA4A 2BLNA 1VJ5A 1A1SA 3TZKA 3OTIA 4N7JA 1OCEA 2BFNA 4KFCA 5K6TA 4QJ4A 4YREA 4AAYA 2KLBA 1KP3A 3FCOA 3K4PA 4WCVA 5C34B 2EGGA 4PCVA 1L7NA 2GTIA 3DTYA 3R5TA 1IHYA 5KYYB 4B3CA 4PGHA 3R6WA 4YALA 4AWBA 3MT7A 5T4FA 3TZBA 3B51X 1CKEA 5HFAA 3AM4A 1DAMA 1G5QA 2EJCA 1S7GA 2H07A 5TJHA 4B79A 3EMVA 4BB6A 5LXTB 3SQNA 2EHJA 3O8BA 4DUYB 3A9CA 5FBRB 1B93A 3C1UA 3IDFA 4FKMA 1BVUA 1T9ZA 1LPBB 3D7KA 1E8NA 3G9TA 4KLZA 4O1HA 3MIIA 3TPZA 1J00A 1IN6A 3Q6IA 4FOTA 3REGA 3OQNA 3ORQA 5DM2A 3OKCA 1FJXA 3ANSA 5T3UA 4EYSA 5JI3E 4GR5A 4YRBA 1JV2B 1G8YA 2IOYA 3X1ZA 3IOEA 5EI5A 3DO8A 3AU9A 1XD8A 1O4WA 2CDNA 1UKZA 3W3AA 1PQUA 3OFKA 2HTEA 3PL1A 4G63A 3B5JA 4W82A 5TF0A 2X86A 4L28A 3NG1A 1KZ9A 4LDPA 3C7AA 4N1AA 1I8TA 1ZA1A 2HU7A 2CWWA 4GKBA 5EXSA 3E9CA 3W2GA 3VU9B 1J9ZA 1YU9A 2JAXA 4CLRA 3T4UA 2GPSA 2V6BA 1QUFA 2IBTA 2O07A 1YZLA 1NXPA 1N8KA 4UAGA 5FHQA 5C3MA 4XEHA 2NU6A 3JQ9C 4YMSA 2NO4A 5ALSA 4C89A 2BEUB 2F2TA 1W4RA 4EH1A 2R4QA 3ABOB 1MC5A 3GT7A 1KDPA 3CISA 4LYYA 4Q9KA 4YXWA 2EG9A 3TB6A 1CY7A 3T3NA 4HQ6A 3UCFA 1WSDA 2A94A 3P1JA 1JKMA 5LZ2A 1LS1A 4MS1B 2R8XA 3DDHA 3JQBA 5U4QA 3KIPA 2CHFA 1RTTA 5D3QA 5H02A 1ZOIA 4G9BA 1Z2PX 3ZKWB 1IUNA 3S44A 1E4YA 2PGXA 3UMCA 1NYLA 5CA1B 4JP8A 4M9RA 1F51E 3ZHQA 1EXNA 3OPYI 4F56A 2QU7A 3HY3A 4J0HA 1WCIA 1P1IA 3OP4A 2WJ6A 3A9RA 2JKZA 4KYTA 1ZOLA 1OX6A 3O91A 3T7IA 3RSQA 4YA6A 5AW6A 5K0ZA 5LJIA 3U6BA 4EG6A 4YT5A 1U8YA 1X7WA 1QQ5A 3VPAA 2I99A 3T41A 5HK8A 1V6AA 1E2FA 3GNSA 3KZCA 2C03A 2QUKA 2HT6A 3EIHA 4JVOA 1OFIA 2VWGA 1TZJA 2PKEA 1PD1A 4DT1B 4A10A 3NAZA 2HYIC 2XWPA 5KQLA 1C7FA 1B0PA 1O96B 4KUGA 4LYEA 4NBTA 5D2CA 4BHTA 1NBME 3PHJA 4OIFA 5LM3A 3AFNA 3C6YA 1FW8A 4Q7EA 5F64A 1Z6XA 4IXMA 4UVEA 4I1SA 2WJJA 2I4OA 2IELA 2QMHA 2H2HA 1OBHA 1B8OA 2I71A 3IOCA 4ZZ0A 3INGA 5DIFA 3WKCA 1FMCA 3CF4G 2XZTA 3DLTA 2J48A 4FFVA 3SZRA 1TT7A 2PQMA 3ER9A 1AHIA 1W0KA 2SKEA 2ZWIA 1JKXA 1U28A 3ISVA 4AYTA 5BSMA 2DG2A 3SBXA 5C31A 3ZWNA 4U7GA 1XTVA 3DQQA 1AZTA 3CSSA 3QLEA 1EUCA 1Z88A 4H0CA 1UK7A 3KT0A 4QXOA 3VO2A 3K9FC 1PWEA 1RAIA 1Q0QA 1QFMA 5SZJA 3TOXA 1XV5A 4CTJA 2WIBA 4CL2A 2GILA 2EKDA 2GRUA 4TPKA 1O5OA 2E4VA 3PF9A 1TYBE 3DL0A 1Z2EA 1XA4A 3O75A 3U4AA 3WFZA 4JB8A 2CXTA 1P6QA 3SF8A 1WB4A 1WOYA 2Y6UA 3KXKA 4R1PA 5KYKA 1PQWA 2YHAA 4Y9TA 2CN1A 2YQ5A 2R60A 1MD9A 2CHGA 2JBHA 4RLHA 4UPEA 2G9ZA 1HSZA 2C8JA 1LQUA 1V7QA 2W0SA 1II0A 1X14A 1FXWF 3FKSA 4IIHA 4Q05A 2XTZA 4WHMA 1KEWA 4UU7A 5ALQA 3Q1KA 2FMTA 1YIDA 4KBYA 2MDTA 1NKTA 2JHGA 5LYYA 5K8JB 3MJVA 2NGRA 5CMLA 1KFJB 3K1YA 4CDGA 4RD1A 1QGUA 5BOSA 3CLTD 3JR3A 1CV2A 2BMEA 3TIXB 1FYXA 1XRJA 2ZZNA 5J1SB 2R79A 1E9SA 6REQB 5EIAA 1NLUA 2IW1A 2FUCA 2O7SA 4IJ6A 3RJ9A 1R0CA 2P6OA 5JCOC 2X14A 2R4UA 3R0XA 3AUUA 1GCGA 1GGFA 1S1MA 5BQFA 4IDBA 1N34B 1TC1A 4RA6B 2H9YA 4YJ3F 5DLEA 2X0NA 1RAHA 1RR6A 3VSDA 4RLFA 4D8VA 2BMWA 3A06A 3DLCA 3E7PA 2NT3A 1IVYA 3PV0A 2NU9A 5LUAA 2GD1O 1R16A 3BICA 4L1KA 2QM8A 1RZRD 5BR1A 1C9NA 4H7FA 1X1EA 1EJ2A 4B48A 4EG8A 5I7RA 1QOPB 3RS5A 2Y05A 3B3QA 1UMCA 3KBBA 2XKJE 4KTTE 4L27A 3Q9SA 4MHSA 5HFJA 3WISA 5CEJA 2XOEA 3CGWA 3RCBA 2C1ZA 4DIDA 1JFVA 4ETWA 3HABA 4MB2A 2G77B 2C5BA 4B7ZA 1DKNA 3DKRA 1P9WA 1ZR2A 4LCJA 1G41A 3K0AB 2FVYA 1KVQA 3KVRA 1KL7A 1G3RA 3HUUA 3I8SA 4LHZA 2WG1A 2VNAA 1EUDA 1GKYA 2CLDX 3TL3A 4CR7A 1J22A 2XWQA 2CVOA 2GETA 2V4ZA 3UF0A 4OJQA 5J2TA 4BFWA 2PQ6A 1I32A 1V6SA 4TS4A 3VYWA 5KEIA 1K88A 2OT3B 1RYZA 1I3CA 3H8JA 3IUYA 1C7QA 1GPH1 3MS7A 3MA0A 3O94A 4ECEA 1XVVA 1Y3CE 2P11A 4J94A 5D7BA 1KRWA 3KXIA 3PUVA 4B0OA 4BO6A 2VYFA 4JR0A 4L9WA 2R6R1 2ZR9A 3MFQA 3NH6A 3X2EA 1B73A 2A5DA 5BPHA 2Q7DA 4J1SA 1X7XB 2I6SA 2Z08A 1MGPA 3TD6A 1XKTA 1MC4A 2CLKB 1CUAA 4N3AA 5DHFA 4B87A 3A6JA 5BWMA 1UK8A 3OA0A 1PDWA 4RCZA 3T94A 3WBFA 1CF2O 2H1RA 4WFKA 5HCUA 1JA1A 1X7ZA 4FW8A 4WVFA 5ENVA 4H35A 2Z58A 3N2KB 3W3AH 3W79A 4D74A 1J0AA 1ZM9A 4DDKA 1T9DA 1WIWA 2NUTB 3H8SA 4CLOB 4RHUA 1K7EB 2HQ1A 2HWXA 2ZYVX 3RHSA 3KQYA 5CFQA 1FE8A 2WHEA 4PICA 4KVGA 2P3LA 3ILXA 2PH1A 1PW7A 2J8ZA 2WIKA 2PX4A 1ZWKA 3FYHA 1GO2A 1V5IA 4QU9A 3VV2A 2HDNB 3N2ZB 4RPKA 2ZBFA 1KP2A 3EW7A 4GR9A 4NC9A 4OOEA 4NZMA 2A0KA 4PNPA 5SZHB 3WLSA 4D57A 2CYBA 3QKSB 5BT8A 1UDBA 3DHNA 2YYZA 1H9CA 1RYDA 2O57A 4D9NA 2H00A 1JMYA 3QUQA 4BKPA 3SMQA 4ETIA 1Z0KA 2A6PA 3WI7A 1Q92A 5DCUA 4B7AA 5K0TA 4DLRA 1VJTA 4EB3A 4OQXA 5KUTA 1WKBA 3F5QA 1XTQA 3ZE0B 1N5KA 3BHIA 3EBPA 5CVEA 1ENYA 2PZMA 3EQ7A 3HBAA 3OOWA 3RTDA 3QX3A 3K35A 3A1FA 3WJ1A 1O6GA 4GE3A 1EXMA 3ESCA 2VAMA 2FPKA 5EIBD 1DHRA 2ECOA 4HWGA 2PUCA 3TX2A 2GK6A 2ZSEA 2D4HA 2B8EA 3C24A 4FFOA 4NJMB 1VB5A 3EPRA 1L7XA 3H2KA 3L7CA 3MWYW 4R5MA 3AVXA 4DA9A 2WHRA 3P9SA 1DBVO 2IBMA 2B4AA 1ZK3A 4HDAA 3ZD8A 3L6CA 1E7QA 2Z9BA 3ZJ4A 1L5YA 1JS1X 1X7HA 2PT7A 2HLDA 1U1DA 3HCNA 2EW1A 3PNOA 4MZDA 4BMYA 1JDZA 1LVHA 1Q91A 4LYHA 2W70A 4G07A 3IEIA 3E81A 1DADA 1YZGA 4UE6A 1KYXA 4WACA 2WHPB 3WRYC 3ZHUA 1RBMA 3L4JA 1BCSB 1SXIA 5TB5A 2B94A 3ER6A 3N0XA 3PJEA 4M0KA 3AM5A 4FMDB 2Z6QA 1HDOA 4NOLA 2HHLA 4LQCA 2DUMA 2X2EA 4Q7QA 1QHSA 2HCFA 3HGTA 4BV9A 5DWVA 4LXGA 3RS8A 3IUPA 3H42B 2YWHA 2Y1LA 4YB8A 3W5HA 1LI4A 2R7MA 1BCSA 3KTDA 1AGPA 2DF8A 9GPBA 2YICA 1L5HB 2JIOA 4C14A 4BGUA 1NULA 4GOOD 4LBYA 5ITWA 3VJRA 3CH4B 4TS3A 3V1TC 5LMCA 2DBYA 4H3VA 1L0BA 2VP9A 4XVCA 3R7NA 2IQ5A 3RG8A 2R4TA 1YJCA 4FBMA 4HMOA 4NJOA 3L4KA 3TIFA 1MG5A 4X6XA 1RWOA 2P4SA 3GZJA 2ONKA 4ZKDA 2E4ZA 3PA6A 1XF9A 1Y8RA 2PCJA 1ECCA 1TJNA 4HH1A 4NU0A 4QHTA 1X38A 5AQEA 1TO2E 3HXKA 3NBFA 4UZSA 1L5OA 1Y6ZA 2I03A 4NR0A 3GRCA 2PWBA 3L7KA 4JQSA 1CJMA 1SBIA 4MIEA 2QBYB 2ZUEA 3T7KA 4U00A 5T41A 4E51A 3W7BA 2AEFA 3OX2A 1INLA 1ZBQA 1NXQA 1QZZA 1S7CA 2AEMA 2ACEA 3PT9A 1VHQA 5SYMA 1SBTA 1QDUA 1SC9A 2FP4A 3FA2A 4KIFA 3AY0A 2AFIA 4UZEA 1VE9A 3BYZA 3ZXIA 1FX0A 2WWGA 1LB1B 2YX1A 2BUCA 1CUUA 5AJXA 3QKSA 4ACAA 4E33A 4AUMA 1CJUC 4RPGA 2BHTA 2X22A 1M7GA 3VOTA 4B81A 1KU0A 5HP4A 3ZLTA 1E6LA 3K2BA 3Q98A 5D6NA 1XK6A 1O0BA 2O7NA 1NVXQ 4F8YA 3IP3A 2I55A 1Y6FA 2EFYA 2CLFB 3UK6A 2QL5A 2QLJA 1DX4A 1V16B 3IO3A 4QL3A 3KZ1E 3RAEC 3R5SA 2XQFA 2JA2A 1S3FA 2DTEA 4HVTA 3NBUA 5JCJA 3QBEA 4ENVA 5GTDA 4MEAA 3Q8MA 2AX3A 4J8PA 2ZRDA 1GDTA 3W1WA 1E2GA 3AEXA 1E9BA 1EWTA 4XX0A 5B6IA 4PPFA 4FHFA 1RLOA 1CZUA 4MVJE 5EJ8A 4TMXA 4WW0A 3N8NA 2NUBA 4FONA 3IELA 1XT6A 2ZYDA 4L5CA 5D5HA 5E2IA 1NVMB 1WKCA 1UOEA 2WVGA 2R6JA 3W4KA 2QG4A 3N87A 4RZXA 4OM7A 5JR3A 1OLSB 5A4FS 1NI4B 1TEHA 1QG4A 1EX7A 1RQ7A 1RBQA 2WWIA 1AQLA 3DOFA 4E32A 3KR9A 2ZJ4A 2HQOA 3QWFA 2WF8A 3GUCA 2VRCD 4LOJA 1ZD5A 5DN6A 1Z74A 3WSTA 4F7DA 1LK5A 3MJEA 1GUYA 3V32A 4ZCLA 1XJ5A 1B43A 4RVCA 2AN4A 3G88A 2EF1A 5FTMA 3MCAA 4HZUA 5CYOA 4AT1A 3P0FA 2ETVA 3YASA 4OA8A 3KZOA 4ZYYA 1NP7A 3BK7A 4P7JA 4HKTA 3RC7A 1M2FA 2QLNA 3ASZA 4HN2A 4LBZA 3PBKA 4FFBA 3VX4A 4YFVA 4EY4A 5I48A 3ER8A 4EI8A 5J1TB 1B14A 3EWIA 4GICA 3ZK9A 3NONA 1EINA 2CB0A 2IXEA 2OCAA 4CPDA 1O57A 1A8SA 2XE8A 4MITA 2IYAA 1VM6A 3H9EO 3P9IA 5F51A 4DAEA 5U9CA 4YNBA 1W4LA 4X44A 3EQ9A 3JQGB 4OQQA 3GN1A 3LVFO 4ZCPA 1ZXLA 1AK2A 4LE2A 1WETA 4YJFA 4GXQA 2NQTA 2R68A 4D42A 1NPYA 2C9DA 2O8NA 3DULA 3ZHRA 2ZRNA 5CNKA 3L9XA 2ZCJA 1YRYE 3DOOA 3SYRA 2H65A 4IWNA 2DKFA 4J07A 1EDBA 4MUAA 1UC4B 1XZFA 1PWZA 3G89A 3G8AA 3HCOA 3GGSA 3L8HA 3S40A 3GUUA 3PNVA 4AIIA 3U49A 1JDBC 2GXQA 2BUBA 4R8VA 5KCMA 1CHDA 5BOSB 2QT0A 4ZCRA 5LN1A 4NECA 4C01A 4DHWA 4AJJA 4OHCA 3AC0A 4GI1A 1NRJB 1HDGO 3GXBA 1MRZA 2F67A 2YMPA 3I1YA 3NDIA 4FC7A 3PL5A 4JASB 3AJDA 2AZ4A 3KQLA 3EF1A 1M6VB 2VDOB 4OU5A 2W2OA 3G8BA 4JB3A 1TM1E 2QR2A 4R9UC 3C74A 5KYWB 2CFRA 6AT1A 1SUFA 3KQUA 2VHZA 4EUSA 3H11A 3ICEA 1P17A 4Q3LA 5CHYA 1NYQA 1OAOC 2YIJA 5CXSA 5EERA 3AIMA 3FIJA 4Q7KA 4HDKA 4OJNA 5E6RA 4IDNA 2R00A 1GJRA 3R74A 2PD3A 1NT4A 1NW3A 4ZDIA 4A5OA 2PZLA 4FGLA 1V96A 2AKAB 3IT2A 4RSGA 3ZE7A 2R9VA 1FNMA 1Z3CA 1D2HA 4KN6A 1WZUA 1QV7A 1QV6A 5JZMA 4EVQA 1GEEA 1BHO1 1EZ4A 4RXUA 4TMVA 3P9RA 2JH3A 4Q6WA 4ARZA 2R2AA 3R24A 3R77A 1OW3B 2SHKA 1GFWA 2PKWA 1TUBB 2HBRA 3FDFA 2ZP1A 4AO6A 3NM6B 4K9MA 4E08A 4G97A 1TI7A 5DO9A 4BNFA 5HK9A 1E1QD 3CR7A 2WJPA 2OB1A 2YV2A 3BH6A 2OFPA 3IX7A 3ZZMA 2ZITA 4ZT5A 3RUHA 3ST7A 4TZKA 3PHBE 3R5HA 4Z7QB 3EODA 5YASA 2ZAMA 4G01B 1WMBA 1WW8A 1ZIOA 2LXNA 2XJ9A 3KYCA 5G40A 3GL9A 3TM5A 2AVDA 4IRXA 1E9AA 2LNDA 4B35A 2Q07A 1TVKB 2XTJA 4FWTA 2Q0QA 1H8HA 4MJLA 2QRQA 3NP9A 3OWOA 4N18A 1IAVA 5G41A 4DCSA 2B1JA 1GOTA 1L4YA 2GHTA 1QK5A 1EP3B 4KDEA 1NDHA 2JGMA 4NE9A 2GNAA 3Q3GE 3JRNA 1J9GA 5IDWA 1P1RA 2H2FA 3A1TA 3O9ZA 3HVHA 1YS6A 2QLLA 4CEIB 4OY3A 2EKLA 3TTXA 3IPCA 4RFSB 4RL4A 1X1QA 4B76A 4C5AA 1OFHA 4D81A 3AV3A 3VKUA 3W4JA 3HB5X 3RSCA 3UT5B 1H6BA 1KI6B 3PFBA 4FJ2A 2XE6A 2F62A 3QKRA 4JUDX 4F6LA 1H2XA 3QVLA 1ZH2A 4PN7A 3ENVA 1S8NA 3IULA 1X1TA 3GEGA 1VL0A 4KN5A 4LKRA 3E9ZA 4X62B 4DM4A 5JAZA 1MJFA 2PN1A 3AR4A 1NL3A 3CX8A 4N4AA 4Q12A 1N5MA 1ADGA 4UNIA 1L3BA 2XKKA 3D3JA 1RWKA 1KBZA 1RZVA 3D02A 5J4LA 2C9ZA 2X8JA 4NF2A 3ESRA 3NTUA 1AKNA 4IH9A 1M74A 4DMUB 1G6KA 3HLKA 1LPAB 5FO0A 1BMFD 3EGCA 5A04A 1PK7A 5KTRA 1W2GA 1F3OA 1GKLA 1QB8A 2YHUA 3N2NA 4OJTA 4ZMSA 4LJAA 4X8MA 1CQJA 3CZQA 3KQTA 5DP2A 2NTEA 1S9DA 2BFOA 3QA3E 1I13A 1UK6A 4RE6A 1ZVMA 3ZDZB 2JFNA 3FYDA 3VJKA 4AP5A 1BG6A 4JDPA 3G13A 5ITZA 3PR2B 1W49A 2FUG1 1XMSA 3O84A 3RR2A 1N0VC 2IIPA 3N8IA 1LXCA 4QPZA 1KQNA 2VT7A 3RT1A 5CFMA 1QAOA 4GVXA 4CLXA 1L8XA 2FB9A 3QELA 3CH7A 4PQGA 4AY5A 2PRYA 2WPDD 4QSHA 1WLSA 3DQZA 3Q0TA 4FHZA 2CLIB 3ZN2A 1ISGA 3W5SA 5LXTA 4P5PA 1NUTA 1OH5A 2VNHA 2IZOA 2LCIA 3TIGA 4N8EA 5FUQA 4URHA 1K27A 2FEAA 1S01A 1R4AA 1SG9A 3VVLA 3G5LA 5DTIA 2HNAA 4ZAFA 1TKRA 2NU8A 1U2PA 2Q9CA 4ES6A 4U7FA 2C7RA 4LWPA 2X4DA 2W6MA 2XUOA 4L3VA 5G1NA 3JASB 3MGKA 3UHPA 2X19A 3TRJA 3QEMA 3V1YA 5E4FA 4MRVA 4Q4DA 3FJYA 2PFKA 4BRSA 4E2ZA 4FHGA 1KJWA 3JTMA 2XECA 3NHPA 3OQ1A 4JI8B 1IMJA 3ZVNA 4HEHA 3UIEA 2AR0A 2GBGA 1TLTA 4QDJA 4AVYA 1YDHA 3FBGA 3TZEA 1FFXA 1RZUA 4ONEA 1TYAE 4RVOA 5KQMA 4LA4A 4BMVA 3L92A 2FW9A 4TYQA 3TTWA 4A1FA 1AKUA 3KLOA 2R86A 1CF4A 3VR6A 4Q18A 1ORTA 1ZJ4A 3HB1A 1R8SA 2ACKA 3DB2A 2FJ0A 5HKBA 1NBMD 1AE1A 1V43A 3O73A 5E0OA 3X44A 4ZQEA 3UQYS 5C7IO 5JNTA 2MIIA 6ADHA 2XCTB 4JYAB 1KR5A 2VP6A 1Z5UA 4E4RA 1VPTA 1A96A 1JQBA 3AP1A 3K0KA 2R8OA 1YUBA 3BN3A 2XDQA 1PLKA 3SVTA 1MRNA 4JNCA 1U5CA 1FK8A 5L95A 5A0FA 4GMKA 1UZLA 3K8YA 4MVJA 5CDSA 1IN8A 3OUUA 1QC5B 1A95A 4A16A 4D6YA 4LSWA 2CL0X 5JH7F 4BNDA 2K2QB 5LP6F 1Y7IA 3KZMA 3W9YA 1FDIA 2AQIA 4B45A 1YB4A 3KALA 3DO5A 4HCJA 3UUWA 3WZ2A 1SK8A 2ZPTX 4I4LA 221PA 1YJAA 4O4JA 1G55A 2JI7A 3LGAA 5H70A 4URVR 2JGAA 3CZAA 2IXGA 3DA8A 5H83A 2GRJA 4INAA 2GYUA 1H85A 2X1LA 3DBIA 2QPTA 3OJWA 1O89A 1SPXA 3RGGA 5FPKA 4C6HA 1WS6A 1YHNA 2B4TO 4S1TA 5A0VA 2RAVA 2BHSA 1WXIA 2HB6A 1WA5A 2D54A 3DLPX 4YRQA 3ZKAA 5I5GA 3RO7A 4EX7A 2RGXA 4JSTA 2WINI 3QLVA 4JBLA 2WD8A 3HFSA 2OV8A 1HWYA 2ZRAA 3ZLVA 1BW9A 1JHPA 3OT4A 1HE4A 2XMZA 5JD4A 3RC3A 2C9YA 3C87A 3IIEA 2WSBA 1H1LB 3BKXA 1KI4A 2B99A 1V9CA 1Z0DA 2XVYA 2G07A 3DHWC 3G0BA 2VFAA 2OSVA 4LXHA 4TL8A 4E22A 4ZCQA 2V7PA 2H9AA 3AYXB 4TV8F 2IV3A 2AKEA 3TQHA 5K6AA 4XQGA 1FDOA 1W96A 1RPNA 3AL3A 3URMA 1IJEA 1XVUA 4KK3A 3WLKX 3V7WA 2VHVA 3QA9A 1EJBA 3TEFA 2IGTA 1H5NA 3CNEA 5FCDA 1E96A 1FJHA 3HU1A 2X0DA 4ITUA 3QG5A 2B37A 3WWPA 1SD2A 3W5DA 3BB3A 5SZIA 3BSSA 3PJGA 2Q99A 5BNFA 1A5ZA 1QIFA 4Y2HA 2IUEA 4MP8A 2CXXA 4BU1A 3L6OO 4RTJA 3PC8C 2WICA 3VO8A 5E9WA 3MTQA 4YUAA 1GNTA 1TD1A 1PJ3A 2R2GA 3L04A 3P27A 2C82A 3R4CA 4PLVA 5AK6A 4COKA 5HZGA 1H0HA 4LXXA 3T1HB 1BJKA 4O4HB 3LDFA 3CJQA 1NHGA 3P9YA 4FZRA 1CBUA 4HXGA 4BO3A 4I81A 2R96A 3RIMA 1DL5A 4US1R 3T1TA 4RV9A 1AQIA 2C77A 2H4WA 1W0CA 2JS7A 3FNBA 3NAQA 4YJHA 4KHPB 3KYIB 3UB2A 2J0QA 1V48A 2I4IA 1RKQA 2HMSA 2ILVA 1GPDG 5JY1A 3HBJA 2EFGA 2MSEB 2VUSA 3HCWA 3V7FA 1EEHA 1DEXA 1NVVR 2CXOA 1D4ZA 1J06A 2VYVD 1IK6A 3KX2A 2ZRPA 4Z2YA 1JVNA 2A57A 3A05A 1GGKA 1K7XB 3NI2A 1RYNA 1SHKA 2ZAOA 4GYWA 1NKSA 3AVWA 2PU7A 4IV5A 2FEMA 2W2MA 2Z6VA 2OCIA 4CV2A 4E5SA 4ARIA 5FJIA 4Y9DA 5F77A 4U7JA 4OGGA 1TGVA 2KW5A 1NZDA 1FP7A 3F4LA 3H9QA 5EHGA 1S8AA 2CVZA 1LBHA 3CVOA 2XQKA 2IEIA 4Q3AA 4HNGA 1EH5A 3GLHE 3O8DA 3I5XA 1AT1A 4G6ZA 3FMIA 4LJSA 2AMVA 4K3UA 1SHTX 1GT6A 1D1SA 3ENZA 3IQIX 2PEYA 5LUBA 1JKIA 2PMFA 4YJKA 4PFQA 4I9UA 2DWPA 3B1YA 4BRWA 1EA5A 4JQZA 1XTIA 4O4HA 2GRAA 2JVIA 4F1WA 2H4HA 2OO7A 1DAGA 2WWRA 2VJKA 4IIJF 4R9VA 2IOQA 5T8KC 3UATA 5KHLB 1F0PA 4OXYA 3ZBQA 2P9YA 4DMLA 3HKBA 3K9GA 3RI3A 2VAPA 4RNDB 3INRA 1KBOA 3PNKA 2KB0A 4XLLA 2O2GA 3TGWA 5ESRA 1TLLA 3SHVA 2I3DA 2ZJ0A 5LU9A 5IM4A 2ZT5A 5KVSA 1ZITA 2PUTA 3ILVA 4HH4A 3ZJTA 2BJWA 1RS0A 4H4EA 2GWRA 5LBTA 3NORA 2GCOA 5K3OA 4JUFA 1GCIA 1PL6A 1R66A 3GA5A 3KB2A 4JB0A 4FCWA 5HRAA 3AF4A 4YI5A 4RSMA 1XFDA 1XRRA 4IG9A 3RU2A 1E0KA 1OR8A 3R8FA 5JWHA 4OTZA 4IIGA 2CXPA 3R23A 1G19A 1I2DA 3HXPA 4YLYA 1BTOA 2RAPA 5LBIA 2AS0A 1U1CA 4HRYA 3RPEA 2WUWE 3FYUC 1OFVA 4KR0A 1AN0A 4BIMA 3BOSA 3MMXA 3A6LA 2QR3A 3BWBA 4IFIA 4P1ZA 5DZSA 3TLAA 5I7VA 3KYDB 4RTKA 5AW8A 7MHTA 3BHMA 3NWOA 2JB9A 2HRDA 1NVTA 2VHTA 1W5SA 2YWBA 1PV2A 4LSZA 4PLZA 4PQFA 5A7HA 1KI9A 1Q2UA 5EZYA 4WK6A 4B6QA 2HU8A 1N6HA 3DEJA 4FQ8A 1VTKA 1E94E 1HMPA 4KWIA 3TMAA 2A9JA 3ROEA 1HDZA 3KCNA 4C7MA 5LMZA 1TJYA 5ALDA 1V9LA 4OGWA 2CCJA 2X8AA 4BNIA 4G1BA 1BDIA 4Q82A 3VR3A 1ZJWA 1K7YA 4AP9A 2OHOA 3IYLW 4GVPA 2VT3A 4TQUS 3RIGA 1I7LA 5EVCA 5KNBH 3X1JA 1BWPA 5F2KA 1TU3A 2WAAA 3N6VA 3MS2A 1W75A 4UU8A 4BX0A 3D54D 3LECA 4CT4B 5A3SA 2ZI7A 3EYAA 4FNAA 3ONWA 3VZBA 3TJRA 5B4VA 5F98A 5JSHA 1QHXA 3CWCA 3EA0A 1XE3A 3TWOA 4OB7A 4FGJA 1NXOA 5DM0A 5AXCA 5ALEA 4WXHA 4TL9A 2P1RA 3R0JA 3W8NA 1NN1A 4C7OB 3B9RA 3V8QA 5IXSA 2BM0A 1C8VB 3K6SA 1NVFA 1X13A 4JJ8A 2Q5EA 5MGBA 1K75A 1RXEA 3SZLA 4P32A 3EZNA 7AT1A 1T0UA 4JBYA 5KSPA 3DBHB 3EZLA 3UMGA 2VJBA 4LSMA 1QDLB 3IVXA 5HR5A 1TX4B 1OGIA 2E1RA 3KTFA 4MUHA 4P4TA 1B0UA 1E69A 4B7UA 4KAFA 3TZLA 1H22A 2XVXA 3IR7A 4MRAA 4Q4JB 4BQQA 3B20A 1Z22A 2CK3D 1QJCA 2I3GA 4OX9Y 1ZA2A 3W4IA 3UAGA 2H17A 2KBEA 4RD2A 2QAIA 5D3KA 1B6GA 1PVVA 1CLUA 3BBPA 5BYBA 1RM4A 5CLQA 3PPWA 2IYPA 4LNUB 3GLIA 3WGQA 3C8MA 1Z07A 4RM2A 4NK5A 1KH1A 3ZWMA 4ER7A 5IPFA 3NEPX 5JNVA 4RDHA 2G88A 4PONA 1HOXA 2WFLA 5GZ3A 1H23A 1JQ5A 4S12A 5LXTF 1DOHA 3VOAA 2ZIXB 3BE5A 2PQ2A 3PS9A 2QAJA 1VKRA 4WA8A 3U7JA 1DAFA 3TB4A 3N6XA 3ZJVA 3BTOA 2XA2A 1Z62A 2CXQA 2Z2ZA 4A0SA 1WVIA 1MVOA 3C14C 1WXFA 1N33B 5JQGA 3U09A 1MABA 2IYLD 3G2IA 3T9FA 2JFVA 2OPBA 4FUQA 2H5IA 1U0EA 3HXQA 4DBLC 1LQ2A 1MRSA 1ZRMA 2P90A 3SU8A 3HDQA 4XFDA 3WIOA 4K6HA 3UH1A 5K01A 5C2JB 3QKIA 3IEKA 3CVVA 4RPCA 3G1WA 5ITZB 2ZANA 1L4FA 1P19A 2AFVA 3PFCA 3UG7A 1C7ZA 1YBVA 4QOHA 1SUCA 3HJCA 4RV5A 1ZAYA 1E5LA 2ECKA 1K08A 1MUUA 5K0BA 1FYEA 3GRZA 4IQGA 4Y7DA 2TS1A 3D43A 3KJNA 3WWCA 2QVCA 3AG6A 4X1YA 4B3RB 3K1AA 4P4LA 2DPGA 3RKSA 4CU2A 3ELWA 4PAGA 4PYMA 4DLKA 4BXOB 3SQMA 3EGVA 3ZEIA 4DNFA 5B4UA 2J0VA 4L2IB 4CQNA 3ECCA 1M72A 2HDOA 3IB3A 4WESA 1E9VA 1VE1A 1AB6A 3EWAA 3B5IA 3OY7A 3PZRA 4K5QA 4FEYA 2GZRA 3K8QA 4GD3Q 4BZWA 1UK9A 4MB0A 4KXMA 3VPCA 1UPUA 3FNFA 4W63A 3QFCA 1SULA 2PL5A 4BKMA 1QFYA 5JWRA 2DWCA 3O8CA 4X45A 2DQYA 4HX9A 1V39A 1X9HA 4DR1B 2J9YB 4DLXA 5COQA 3OPNA 3T5AA 1DRVA 1PL7A 4XOIA 1JALA 1WW2A 5BSTA 1LLQA 3EN0A 1NN0A 3DE6X 3TDKA 3KK0A 2YNMD 4XB2A 4XGQA 3T5BA 3U81A 1A97A 1E8DA 3CX7A 1NSTA 1ECJA 3T7TA 1CERA 3U3RA 2PUFA 2JGFA 5CA0F 3R8XA 1ESZA 1XJCA 1QS0A 4RTSA 2LRHA 2BFBA 4G37A 4A03A 4C20A 2XNKA 4DVGA 1L8QA 4PCLA 4GYYA 5A4IS 1MB0A 2OEPA 3JW8A 2WAMA 3AEKA 2J3JA 3PCXA 1SB8A 3EEIA 4FVTA 1NJFA 3ICWA 3UWMA 4LFAB 1OGJA 3W0LB 2HCTA 4KACA 1APBA 1UXKA 2GF2A 1UAGA 5JPIA 4CNQA 3T5GA 1KAMA 2PTGA 3IJRA 2QRJA 5J40A 5M29A 3H1BA 4RVSA 3RYTC 4E88A 2CMKA 1PI3A 4Z7NB 1R8XA 5F4ZA 2OUIA 2FZLA 3GOHA 5CM2Z 1OYYA 2GLUA 3KEQA 4B46A 3O82A 4EW6A 4Y2JA 2OA0A 3UXHA 1TCAA 3R6DA 3AEZA 4UBLA 4BAZA 3RFFA 3UB3A 5HUJA 1Z2AA 3ZU6A 3EPHA 3UICA 3F5MA 4FZJA 2BKUA 1Y9DA 3NDPA 1QGED 3NANA 3TPCA 4XWOA 5KWSA 1Q77A 1NZFA 5AI8A 4G65A 1EK0A 5LQSA 2P0AA 3SLKA 3IUBA 2JLSA 3L8ZA 2Y0DA 2C3PA 3P4XA 4PS0A 3WK6A 4JU9A