4OX9Y

Crystal structure of the aminoglycoside resistance methyltransferase npma bound to the 30s ribosomal subunit
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
219
structure length
219
Chain Sequence
MLILKGTKTVDLSKDELTEIIGQFDRVHIDLGTGDGRNIYKLAINDQNTFYIGIDPVKENLFDISKKIIKKPSKGGLSNVVFVIAAAESLPFELKNIADSISILFPWGTLLEYVIKPNRDILSNVADLAKKEAHFEFVTTYSDSYEEAEIKKRGLPLLSKAYFLSEQYKAELSNSGFRIDDVKELDNEYVKQFNSLWAKRLAFGRKRSFFRVSGHVSKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular recognition and modification of the 30S ribosome by the aminoglycoside-resistance methyltransferase NpmA.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 68
structure length 219
sequence length 219
ec nomenclature ec 2.1.1.180: 16S rRNA (adenine(1408)-N(1))-methyltransferase.
pdb deposition date 2014-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Y PF02390 Methyltransf_4 Putative methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4ox9Y00
1ORHA 1ZKDA 4KIGA 4RTLA 5EC8A 2GPYA 1N2XA 4AZTA 3A7EA 5FCDA 3JWHA 5C1IA 3BKWA 3GGDA 3P9NA 2QRVB 2PT9A 3SXJA 3ELWA 1VL5A 3OZTA 4P7GA 5DXJA 5ICFA 3DH0A 1RJDA 2I9KA 2Z6AA 3SVZA 5BW4A 3NDIA 2YXLA 1ORIA 1XDUA 5CM2Z 3VYWA 4BP1A 2PXCA 2CKDA 1XCLA 3HVJA 3SM3A 3TKAA 2I7CA 4QTTB 3UJDA 4E70A 5GOZA 4CTKA 3KPJA 5K0CA 1KPGA 3OE5A 4KIFA 4HTFA 3PLAE 4RTOA 5F2KA 1JQ3A 3BXOA 3NVMB 4P58A 2HNKA 3I9FA 4MHTA 4ISCA 4V0RA 2O07A 4A6EA 2BM9A 3LCUA 4DCGA 5K03A 4HGYA 8MHTA 3P9CA 5EZSA 5CCXA 5EHIA 3ELYA 2C7OA 3R3HA 5E1BA 4PNEA 3PX3A 1JG2A 3E05A 2AZTA 2JJQA 3THRA 3HCDA 2O57A 3B3GA 1WXXA 2XYRA 3DLIA 3FPEA 4QVGA 4CKEA 3DXXA 3MCZA 3UFBA 4X61A 4GC9A 3X0DA 4RVDA 2EFJA 2UYHA 1P91A 1RJFA 4M36A 2O06A 3HCAA 4E32A 4F85A 5K0FA 5LQAA 3TLJA 5T64A 5K05A 4XUEA 4IWNA 2FK7A 2GLUA 1QANA 3G2QA 3CJQA 4AUKA 1FP2A 2XVAA 3NW9A 2YR0A 3TMAA 5LQRA 3C6MA 4F84A 2IGTA 2OY0A 3GJYA 5LQCA 2UYQA 3DXYA 3NMUF 4Z2YA 5EZQA 3SSOA 3GRYA 2AOXA 3HM2A 3D2LA 1KYWA 1WY7A 3A25A 4QVKA 4CKBA 1JSZA 4EKGA 1N7JA 3UJ8A 5MHTA 5FA5A 3LBYA 2XYQA 1G60A 3C3YA 3E23A 3G7UA 2XYVA 3LGAA 3QV2A 5FULA 2C7RA 1P1CA 3GU3A 3RW9A 5FHQA 2OB1A 4OX9Y 3T0IA 3VSEA 1NV9A 2PX2A 2PBFA 1JTFA 2PT6A 4IV0A 5HILA 2AOTA 5DPMA 2ZWAA 1YZ3A 1SVUA 3FPHA 2O05A 5JUWA 2IH2A 1D2GA 3ID6C 4YV2A 3R9XB 1ZGJA 3T7TA 3O4FA 1O54A 2ZIGA 5EIWA 1YZHA 1XDSA 5HEKA 1TPYA 2NXNA 4GEKA 5EQJB 4MWZA 4PGGA 4Y30A 4GOOD 5FHRA 5B1SA 4EKIA 5GIOE 3T7RA 3U81A 3G2OA 2IFTA 4E2ZA 2R3SA 3LDGA 5ERGB 4YUZA 1FJXA 2FPOA 3GCZA 3EGVA 3GRRA 1HNNA 5K0EA 5BW5A 1FBNA 2UYOA 5T6BA 3JWGA 4EVIA 4KW7A 3FUXA 2HV9A 4IV8A 2ZZNA 1D2CA 3OFKA 3UJCA 1SKMA 1BHJA 3NWBA 1RI1A 5FADA 4XUCA 2YQZA 1XVAA 1Q0SA 3FUVA 4PYOA 3TR6A 4DZRA 5DWQA 3MAGA 4ER7A 1I4WA 2IDJA 3C0KA 5HZMA 1G8AA 2AOVA 3HVHA 2B78A 3NJRA 1QAMA 3PT9A 2HWKA 4WVLA 2ESRA 4C03A 5DX0A 5GM1A 2H00A 2VS1A 2YXDA 3RIEA 2YX1A 5EG5A 2ONYA 3LL7A 3EVAA 3I58A 3KR0A 1R8XA 3G5TA 3OZRA 5E9QA 2G72A 2P3LA 4QDJA 4E33A 2IH5A 3IHTA 3HA7A 1B42A 2AS0A 2P1DA 3P2IA 3BWMA 3EVCA 2JH8A 3G2PA 3B7PA 2PY6A 5EMMA 3V8VA 3LCVB 1KP9A 3QOXA 4KVZA 1OR8A 3ME5A 4AZWA 5GM2A 4KWCA 4EMSA 4GOND 2VDVE 3FRHA 3OFJA 4A6DA 2CMHA 2WA1A 4OQEA 5LQUA 1L3IA 5LR6A 2HR1A 4C06A 4OQDA 3DTNA 2AOTB 1YFLA 5K8VA 5LQJA 3REOA 1QAOA 2ZZKA 1FP1D 4PYKA 2N47A 3EVZA 5T67A 2YTZA 1AQIA 3P9KA 4AZVA 4FZVA 3L8DA 4M38A 1R74A 3DULA 4P7JA 5K0NA 3CVOA 3LX6A 3C3PA 3EEYA 3BWBA 2P3OA 2JHAA 4PONA 4RVFA 2IDKA 3H2BA 3UJ7A 3M6XA 2GAFA 4DF3A 5EVJA 4E31A 2IH4A 3O31A 3HA3A 3HCBA 9MHTA 3KQVA 3HP7A 5G02A 5EEHA 1YB2A 4YUYA 1TW3A 3SSMA 2AOUA 2P7IA 3IEIA 2Z6QA 2ZTHA 1XDZA 3WSTA 2AN4A 5IKMA 3HCCA 3TQSA 2UYCA 3LDFA 3BZBA 3DMFA 4C04A 4YV1A 4MIKA 5FUBA 1KR5A 1NW7A 3KPYA 3TOSA 4HRAA 4FSDA 4OBXA 3FRIA 3AWIA 3CGGA 3GNLA 3TM4A 3GRZA 4HG2A 3AY0A 3KQMA 1R8YA 3SR4A 2VDWA 3BGDA 2PSSA 2JHPA 3PFGA 5LQKA 2OZVA 4NECA 1KIAA 2PX8A 3EMBA 1G8SA 1JQEA 5P8WA 5CVJA 2ZBRA 2GH1A 3R24A 4QTUB 5M5BA 1R18A 2C7QA 1F3LA 1KPHA 1WS6A 2PLWA 2WA2A 3P97A 3M6UA 4PWYA 3MHTA 3NVKI 2PX4A 3P8ZA 3LKZA 4QPPA 2EX4A 3VC1A 3OZSA 5GWXA 3BT7A 4PYLA 5K01A 1JG1A 2KW5A 2B9EA 1WG8A 2AOUB 3G2MA 3KHKA 2B2CA 2ZFUA 5DTMA 5DXAA 4F86A 2B25A 3DMHA 5DTQA 3ANXA 4E2YA 4HH4A 3PX2A 1UWVA 4R05A 3EVGA 1T43A 3PVCA 2PJDA 2NP6A 4C4AA 2IBSA 3SGLA 3F4KA 3MQ2A 3CJTA 3CCFA 3M6WA 3S68A 3GWZA 2PXXA 4FGZA 2QRVA 3FTCA 3NTVA 2BM8A 2FYTA 3Q87B 4OBWA 4R8SA 1SQGA 4ZTBA 4GQBA 5K0BA 3K0BA 2ZWVA 3DXZA 3UJ9A 3B3FA 4YMGA 2NNWB 3EVDA 3EPPA 4WXHA 1NW5A 2PGXA 2BZGA 4OA8A 5E9WA 4X1OA 5E2BA 1SUSA 3V97A 2IBTA 1Q0TA 1QAQA 4R6XA 2CL5A 2GS9A 4X60A 3UJBA 3FYDA 1AF7A 1SQFA 1VP9A 3UZUA 2ZZMA 2E5WA 2UZ4A 3SMQA 4LECA 2EG5A 3FPJA 3LSTA 2I6GA 2P8JA 3M6VA 4H0NA 4HGZA 4U7TB 5HOQA 1U2ZA 4LG1A 2YXEA 3KPUA 5DSXA 3CBGA 4YUWA 2VDUE 3CC8A 5EOVA 3KPVA 1EJ6A 3MTIA 4ER0A 4C05A 3LCCA 3Q7EA 1UIRA 3I64A 1KPIA 1VLMA 3TRKA 1R6AA 1VQ1A 4G56A 4PIPA 3IV6A 1X1BA 2NXJA 2V7EA 4FP9A 5DM2A 4BLVA 2NXEA 3KKZA 1BC5A 4OA5A 5K0GA 2HTEA 2VP3A 3OCJA 1O9GA 3UJAA 3EVBA 3FTDA 4RTKA 2YUIA 3GIWA 4E2XA 3RODA 3I53A 2GB4A 3UA4A 4RSRA 3GRUA 3HVIA 5CCBA 3G8BA 4LWPA 2DPMA 4C07A 1AQJA 5CVVA 1XXLA 5H02A 3B5IA 4FR0A 2PXAA 1L3BA 2AR0A 1INLA 4GOLD 3THSA 2Y1WA 5GIPE 3UA3A 1PRYA 2IIPA 10MHA 4M37A 2C7PA 3NDJA 2P40A 4HSGA 1VBFA 5EIFA 3JWIA 3VC2A 2PWPA 2Y1XA 2ZVJA 3UBTA 1RI2A 5C9ZA 3G5LA 2VZ9A 2PVCA 3FUUA 3KQTA 5EKXA 5DLYA 1SUIA 4PYNA 2JH9A 4CXMA 1L1EA 2K4MA 2QY6A 3LHDA 4YMHA 5KS2A 1IY9A 1YF3A 3FTFA 5D1NA 4BLUA 4CTJA 5E8RA 1RJEA 1KXZA 1NW3A 2AVNA 2AVDA 4LWOA 5BP7A 3GO4A 3KQPA 3HA5A 5C0OE 2WK1A 2ZULA 3G8AA 2FHPA 2AOWA 4AZSA 3M70A 3EEOA 1DCTA 1P39A 1EG2A 5EMKA 3ER8A 1H1DA 4RTJA 4C08A 2H1RA 5K0JA 2ZIFA 3M4XA 4FS8A 2P3QA 3G88A 3E7PA 1JTEA 5E8JA 1G55A 5HIMA 4DCMA 3OU6A 1G38A 1EIZA 5CUQA 5HIJA 1NW6A 2BR5A 4RTSA 2BR3A 4L7VA 3BWCA 4KDCA 5ICCA 4V0QA 3DMGA 3EVFA 3FPGA 2I62A 4E2WA 5EKUA 3MGGA 3FUWA 4Y2HA 2F8LA 3P2KA 4RTNA 5HIIA 3LDUA 4PYMA 4CWAA 2V74B 1NT2A 2A14A 4GUAA 2ZW9A 5KYGA 1BOOA 5GINE 4RTPA 2QM3A 2H11A 4ER6A 2PV0A 4PYIA 4ER3A 5KVAA 1NV8A 1XJ5A 4BY9E 4PCLA 4AX8A 3M33A 2BH2A 5FWDA 1FPQA 1PJZA 2HMYB 3BUSA 4EK9A 3LECA 3UWPA 1P1BA 2O0LA 1UFKA 2ZIEA 2QE6A 3OU2A 4O29A 5FWAA 3MCTA 5GP1A 2OYRA 2G70A 3DLCA 3HCEA 5F2OA 1VIDA 3AXSA 4GC5A 4YV0A 1EJ0A 2Z6UA 5E1DA 2OPBA 1M6YA 4ER5A 5JR3A 1QYRA 1RI4A 3HVKA 5E9JA 3ELUA 3FYCA 2G71A 4QPNA 1NE2A 4E30A 4QDKA 3O7WA 4GBED 2ZLBA 5E2AA 4FSXA 3SSNA 2G8NA 3AXTA 1L9KA 3G89A 5DX8A 4ATNA 5KQRA 3E8SA 2OO3A 5LSAA 3A26A 1N7IA 5FA8A 4B17A 2JG3A 3BGIA 5U4XA 1G6Q1 4XCXA 2NXCA 2FK8A 5CIYA 1NW8A 2ZSUA 4BLWA 3P2EA 5ICGA 2ZBQA 3KR1A 3DOUA 1JR4A 3AJDA 3HCFA 3OU7A 4IKPA 5EPEA 4U7PB 2P35A 2G1PA 5FQOA 1MHTA 5K09A 1NBIA 3B89A 3KQSA 3R6TA 2OBFA 3DR5A 1R00A 1F38A 2GA9A 2B3TA 5DRTA 5E1MA 1X1CA 5K0LA 3FTEA 5D1HA 3DP7A 3BWYA 3KQOA 3OPNA 4R8RA 3PFHA 1EAMA 2PX5A 3EMDA 1KYZA 3HEMA 5CVDA 2XBMA 3GDHA 5HFJA 1VE3A 1SG9A 3CJRA 1O9HA 3EGIA 3KQQA 5DM0A 5EGSA 5HIKA 3MTEA 3GXOA 1RI3A 1YUBA 3TFWA 1WZNA 1MJFA 1X19A 3KU1A 2CWWA 4M7RA 4FT4A 2IPXA 3HNRA 5IH3A 2IP2A 1TW2A 2DULA 3CKKA 3NWEA 4PYJA 2NP7A 3MERA 1VPTA 4JXJA 3ORHA 5E1OA 2OXTA 4MTLA 3KQYA 3K6RA 5DRYA 5KQSA 4RV9A 3P9IA 5EMLA 3A4TA 7MHTA 1L3CA 3C6KA 4RX1A 2ADMA 1JG4A 5CVEA 4QQNA 4CKCA 5CD1A 4PINA 4PCAA 5DM4A 4RTMA 2ONZA 4KDRA 5EEGA 1ZG3A 3OE4A 1M0EA 3FZGA 1QZZA 2FCAA 2XVMA 1JSXA 5DM1A 3LBFA 1HMYA 4RWZA 3SX0A 4DM3A 4DMGA 4DQ0A 3ERCA 1DL5A 4HC4A 1M6EX 2EJTA 4X41A 3PTAA 3KR9A 3IYLW 4RYLA 2P7HA 3LPMA 2BR4A 1I9GA 2YVLA 5EMJA 3P71T 4KRGA 1IM8A 3BKXA 1XCJA 4FT2A 1JQDA 1RI5A 3HTXA 4K6MA 3LKDA 3TM5A 1Z3CA 4X63A 4PIMA 5FTWA 3B3JA 4MQ4A 4YUVA 2ORED 3KPWA 1EQAA 2PKWA 2OB2A 4R6WA 1WXWA 1NKVA 1ZGAA 4RTQA 2Q41A 3JWJA 4PGHA 3EGEA 4XUDA 1KHHA 2ERCA 3QOWA 5DSTA 1YFJA 2AN3A 4DA4A 5DT2A 1BKYA 2JHCA 3TKYA 4UOEA 4QQKA 2ZBPA 1IXKA 3ELDA 2LD4A 3UJ6A 2PWYA 5DTRA 3A27A 4RVGA 4YUXA 3FUTA 3KQWA 3KR2A 1I1NA 4DKJA 4RVHA 2CMGA 3FPFA 5CVUA 1RJGA 1XTPA 1Y8CA 5DX1A 2R6ZA 3PB3A 4P7KA 5F2NA 2QYOA 4PYQA 4EQZA 2FRXA 1NBHA 3TPZA 4BP3A 4GF5A 1AV6A 1D2HA 3MB5A 4RTRA 1X1DA 3R0QA 3A7DA 1X1AA 5LQNA 5BXYA 4P7FA 3ER9A 2NYUA 3EVEA 2P41A 3DUWA 1JG3A 3BGVA 2OKCA 2EJUA 3PS9A 3I5UA 4POOA 5EHGA 2AN5A 3T7SA 5ICEA 1ZQ9A 3GRVA 5FQNA 1VP3A 1DUSA 1ZHFA 2ZCJA 4HTFB 4GOMD 1V39A
chains in the Genus database with same CATH superfamily
1ORHA 3QPAA 4Q0MA 5ILOA 1VXRA 4YRFA 1BFUA 1H6CA 3LPCA 1OTXA 2I29A 3UT5A 4A2WA 1GDTA 2NZ2A 3ON5A 2ZEJA 5FWXB 3ESYA 5AOAA 1NMSA 4B44A 1KERA 3BJZA 1LI4A 1NXSA 1OYYA 3DOCA 2Y1DA 1O96A 1ZXLA 3KEQA 1DAIA 3L43A 4FE3A 4IIBA 3G2NA 1E60A 1Z0IA 3SVZA 1ZH2A 4BXOA 4E1AA 4IFEA 5I4IA 5KWVA 5DYYA 3T6KA 5K0CA 3KSAC 1Z56C 4UE2A 1I8TA 1NNSA 2GAAA 2GRJA 4MCJA 1JPVA 3JAKA 4LY3A 3LL4A 4ANFA 5C7OO 5IKPA 2YKGA 2IZ0A 3ESXA 1JHXA 3VHXB 3RVNA 4ZVKA 4B4KA 4YQFA 5MF6A 2ZRCA 4J1TC 5K2OA 3OX2A 3PWKA 5F33A 3DYIA 3F7MA 4PBSA 3I45A 1RTKA 2JRCA 4MUEA 4QOHA 1NXXA 4N5LA 4AYXA 3MG9A 4Q6BA 1DOZA 3VPDA 4D1YA 4QLBA 4BNZA 5JPCA 2Z83A 4BMVA 4JFAA 4H59A 3ZJVA 2ETVA 4F3RA 1LNQA 8ATCA 4TXNA 4WFKA 4W7SA 2YRWA 1QK5A 4G37A 3P0JA 4M1EA 4W9NC 1BD3A 3X0DA 2W90A 1DO2A 2WICA 5LZ2A 2G9RA 2AKAB 3AVPA 4GPAA 5B6IA 1ORTA 3TLJA 4B6QA 1JIXA 3WR5A 1W36C 3TEMA 4AUKA 1AT1A 1T0JB 2YR0A 3IAM6 3DOHA 3E4DA 1GU7A 3N2LA 3OEHD 1ZZEA 1PK7A 2A5FA 4XVUA 1XAGA 1ZIPA 3T15A 5DTIA 4BBJA 3UWOA 1KJNA 4TUYB 2AOXA 1P18A 2ZREA 2WYOA 3GPBA 4YC7A 2PSFA 3SIXA 3TIIA 4CKBA 5BSVA 7REQA 1QQ7A 1ZUIA 4PZLA 4D3XA 4BEWA 4AMBA 5EHQA 4C4RA 1XJQA 2WP0A 4L8VA 3FR8A 4WKBA 1K1EA 1XPJA 4C5CA 3QPCA 5BOSA 3JQCA 4L0DA 4F5WA 3DFFA 4YP9A 3VH2A 2WI8A 4S1VA 1FFWA 1UK8A 2XKJE 5LL6P 1TZBA 1AX9A 2F9FA 5FFMA 3DEYX 4DCCA 2ZWAA 3G0CA 3IAFA 1WL8A 3KJXA 4CEHA 2AMFA 2AC7A 3T7KA 1QPBA 5ICMA 1DMSA 2QSJA 1DO0A 1GNPA 2R1ZA 2ZJ0A 4TLAA 4AY4A 4YFYA 2R7MA 5HEKA 5CHEA 4KAXA 3IUMA 4UAUA 2CYCA 4Y2TA 3GPIA 4DCVA 3FRJA 2OQRA 2XVYA 4LDQA 2VQ6A 5B1SA 1EU1A 3KD2A 2QG6A 4XSHA 3OZFA 4OFZA 4UNNA 1RLOA 2FPOA 3H9GA 3QX3A 2QJOA 3Q10A 1DRKA 2WUGA 4M6WA 2V6IA 3A2LA 1NN5A 1PCXA 2BZ0A 2C2WA 1X77A 1D2CA 4AJEA 2IW1A 3PI7A 5DLQC 4DYHA 2PWZA 1EK0A 3RSOA 2B8WA 1TF5A 1ONSA 2V9PA 2WJ6A 3LY7A 4N47A 3ZUPA 4CT4B 1SBQA 1FFDA 1NNLA 2XE4A 1GPYA 1XD9A 3MELA 4KXWA 4PZ0A 3BMOA 3UXMA 2EFCB 5BOSB 3KQLA 2Q4EA 1ARZA 1JT2A 1NOIA 3MJTA 4MGYR 4WVLA 3R8XA 1O4WA 4BUJA 3U3RA 1UJ4A 1WTCA 2VS1A 4M0UA 3SHQA 2FF7A 2XQVA 4G1VA 3RVRA 2OHIA 3LLCA 5CR9A 4B48A 5JJIA 2V5AA 1LFAA 2YMLA 4J0DA 2J0EA 4D02A 4JP1A 5BSTA 1KA9H 2HDNB 2HU7A 4WKPA 1KBOA 3E5HA 3FVTA 1KP9A 2COKA 2X9LA 3FCAA 2CBXA 4ZD6A 2QU8A 2NSLA 3QPDA 4E5MA 1C0IA 3PHIA 4B34A 3FROA 4OQLA 2IRWA 2ZYDA 4W5HA 1KGDA 2OYSA 4RLSA 4ZT3A 1CFZA 2BKLA 3GLQA 5AJHA 4A2PA 3ZHYA 4J7XA 3VNQA 2FUEA 1N8TA 2HBYA 2NWQA 5C5CA 4RJKA 1J06A 1PFUA 4FZVA 3EH2A 4R40A 1N4DA 1P3Y1 1PSWA 4U2CA 4Y0AA 3BD8A 3AVVA 3GDOA 3NBKA 2EYQA 5HKOA 3EEYA 3BWBA 4A73A 2QZ9A 4UBMA 2RGBA 2IDKA 3TIGA 1LX6A 3PC2A 3HO8A 5KKAA 2G9NA 4E31A 1FFCA 1X9HA 3GJ4A 2C99A 2AFIE 4HUJA 1U0JA 5JO9A 3V4OA 3WNCA 3PTZA 4C3ZA 4F60A 4LYJA 1U0GA 5CDGA 1IAQA 3V1YA 3MMSA 3NM4A 2JFYA 2GHQA 3R7DA 3T4XA 3PUJA 2Z2JA 4OIMA 4WCDA 3CBQA 2XA2A 3B6MA 1EUYA 1Z5ZA 1ZVJA 2NVBA 4OP1A 1PJSA 5J5AA 2IXBA 1JDPA 1A76A 4HDRB 4BO2A 1SG0A 1VC2A 4AVYA 5EPUA 2PANA 3VSCA 4PXSA 3RG8A 5CFPA 3H7AA 1CR1A 1UAYA 3E9NA 4GPD1 4PO9A 4Y0NA 4ZU1X 2F17A 3CIOA 3SPXA 4D42A 4YMUA 1WP4A 5YASA 3HWRA 2N1BA 3EQZA 3A11A 1YHNA 2IXTA 1YZTA 2QAGA 4XR4A 5F52A 2FX5A 5K7SA 3BCHA 3CZ5A 1YIAA 3AKCA 2XNCA 5HUHA 4PYLA 3A37A 2FG6C 3E9MA 2BEJA 2VZ8A 4OHUA 4RJLA 4X5OA 2KJQA 3ETNA 4ZZ2A 3X2SA 4H6PA 1NWCA 2O5VA 4WK4B 4BQSA 5T8KA 3RYIA 5HFAA 2BT4A 3CNBA 3OSUA 4LZLA 3PX2A 3NDBB 1Q22A 4U2FA 5A62A 2RJOA 4E51A 4GOJA 3ZY6A 4JSRA 3OKCA 3VNRA 1E1CA 1UKZA 3RJZA 1VRWA 3QF4A 1WULS 4XTRA 3N7TA 1PQUA 5J1TB 3UCXA 1VLZA 2BM8A 3TKLA 1D2AA 4JB3A 4P5PA 3ZS8A 5KB3A 1K27A 4N18A 4O4JA 4Q9NA 1NUUA 5K0BA 1PL7A 1L7DA 2PO5A 4X1IB 5FIUA 3UJ9A 3EZ9A 4HUQA 5GTDA 3FOAA 2PUGA 2YHAA 3PU6A 3I62A 3UMJA 4BE7B 4IFTA 4NOMA 1XAJA 4N7RA 1LW6E 1D0IA 3LCJA 1D2MA 4FOOA 5CG2A 2KBFA 4NDAA 2QZ4A 2XADA 1GWNA 3NRBA 4BGUA 1DMRA 2IHUA 1LEHA 2BRUC 3AT1A 1NC1A 3GMDA 3LF2A 2HJVA 3FZEA 2UZ4A 2J08A 3LBNA 4QBGB 3RRZA 1RZ3A 2XT9A 3QE9Y 1UR5A 3TJMA 3UH1A 1GCAA 4R81A 1WD7A 5JECA 1B8UA 3KVRA 5JY1A 3RBVA 2X8WA 3AQ4A 3BERA 1E1KA 4G9EA 2IHNA 1KPIA 2FN7A 5AP9A 5CM8B 5BSHA 1VQ1A 3B3AA 3IV6A 4HPWA 2ZITA 2V7EA 5DNYB 4DLSA 4M8NE 1K5DA 5JAUA 1AF4A 3O82A 2EARA 2C0PA 2VHZA 1CR4A 3A3PA 3KX2A 3SQOA 2DBZA 3BK1A 2VRCA 4RSRA 5DJ5A 2KQUA 4RM2A 1OX4B 1MRSA 5BY2A 4ZEWA 4B33A 1VE5A 4DCPA 1JRLA 1XVLA 2Q9CA 1NUHA 4HXGA 5CLIA 4BOYA 1E5TA 5K6AC 2DFNA 4W5QA 2XIQA 2BKUA 4PLYA 5FTMA 2JI8A 2P0AA 4DYVA 3UAZA 1U2TA 2TSYB 3L40A 3OHPA 4WPGA 3IQIX 4TYWA 1JEDA 1TK3A 4KACA 4FBLA 4ALJA 3G23A 4WNCA 2QD4A 3FUUA 2XDAA 4PNPA 1V11B 5CMLA 2J46A 3EIHA 3WGHA 4B3IA 1M6HA 1NAIA 2JVJA 4O33A 3RHSA 3VYUB 1VCOA 3HEAA 3IIMA 3FDJA 1LV7A 3ZWXA 2C97A 5H82A 2OCDA 4HFJA 4XB6B 2W2MA 3ZNPA 5ARCA 2VXYA 4LWOA 1RHKA 3LOPA 2JI7A 3CGWA 4UMEA 4AS1A 1QOQB 3DTVD 3LQ1A 5G1NA 1CUHA 1P62B 4QHYA 1MC8A 2FHPA 3CN7A 1R8QA 2HHLA 5IVKA 1PV1A 1XTTA 1M8PA 3Q7TA 4PAGA 3L1VA 1W5BA 4GMXA 1K68A 2YZGA 1SOVA 1RAGA 2NPFA 5DGHA 1X2EA 5IVDA 2Z9DA 4FFDA 1G8PA 3L7OA 1D7AA 2O3QA 4TSRA 4YJGA 5E8JA 4C2UA 3SYNA 1KEKA 3R8FA 2VJQA 2OLJA 2WU8A 4JKIA 4F04A 3UGJA 4Z53A 4U6QA 4W63A 4BNVA 1OASA 5BYKA 4LZNA 2C96A 2I4IA 1QHSA 3GZJA 3JQ9A 2H2DA 3JYLA 4M6WB 1VRVA 3D5TA 5DEIA 2I62A 4X6UA 3SBOA 4O8CA 1WF6A 1FDIA 4EI8A 3LDUA 2I2DA 3NHZA 4M7PA 1P5JA 2DTDA 4IICA 1N75A 2HY7A 1VHTA 3AR4A 5L45A 3OZUA 3ZHXA 1RYEA 5DT9A 4P1ZA 5KMGA 4KDFA 3L1HA 4JEMA 1SKYE 3LVQE 3NP7A 3SS8A 3E27A 1GM5A 2B36A 2PRJA 5SV2A 4EK9A 3T3EA 5E3IA 1J4AA 1P1BA 3COSA 3MWYW 5B7PA 4I4TF 4P33A 3QHQA 4KAJA 1CZKA 2C4MA 2PMFA 3CO0S 1OPXA 5IBPA 4EZEA 4Z1OA 6NULA 4LWQA 3STXA 2A5JA 1LQ2A 2IXFA 4KYUA 4JI4B 2I65A 3EXIA 1QDLB 4KGVA 4XD2A 3TLKA 4C4ZA 2WM3A 3FYCA 3SHOA 4CCAA 3LVBA 5DP1A 2A9KA 5LWQA 1DTSA 4XQCA 1MN6A 2Y1KA 5TPZA 2WHPB 2XW6A 1HDEA 3BE4A 2WWYA 2G5CA 1ZY2A 3G89A 4PG4A 4Q7QA 2H1IA 2BMAA 3O3NB 3BGWA 4CETA 1GARA 4TL6A 1SPBS 4MW2A 3LUHA 1GEGA 4UUBA 5ALQA 3ZDYB 4LFAB 1M83A 3B1WA 4B17A 3ZD9A 2JG3A 1R3UA 1E3WA 3PXUA 1XYYA 1F2UB 3BGIA 3KJFA 1WNFA 4P54A 1EFVB 4EHAA 2P9FA 3BA1A 3ICCA 5B7GA 1E2PA 4IXNA 5L6MB 2CFTA 1WVGA 2GZRA 2ZJZA 3DE7X 3HQ4O 2QTAA 3O8BA 2WG0A 5FD8A 1LVHA 2B0CA 1JDNA 2O8NA 3H5WA 2EFEB 4G8DA 4MUXA 2Q7DA 3RS4A 4LGYA 1C9KA 1RQPA 5IJ0B 3Q7RA 1AV7A 1DCMA 2A8YA 3GR6A 3GOHA 5J5VA 5K3AA 4CT0A 2FEAA 4ZO6A 3DHEA 2BE9A 5ELMA 2ZVDA 1Y6RA 1JU3A 4LX8A 4DIKA 3LC1O 5DCUA 1V2HE 1C3JA 3G5AA 3TIXB 2W98A 2IGBA 4XM2A 3TINA 1P5FA 1P72A 4FT4A 4KYIB 2HBRA 4KKXB 3ZDAA 1KFEB 2DULA 3RSLA 3QKSB 1DDIA 1GGJA 2VF8A 2GPSA 1VPTA 1J07A 1YRHA 1CQJA 1N3YA 2JKZA 1UEXC 3O3MB 3QLTA 4MZDA 4RPJA 1YB4A 3QZUA 2IV2X 3L3BA 2WTNA 3ZY5A 4D4GA 4YRBA 3NANA 4ZCPA 5E6RB 4JJ4A 1IBKB 2Q6KA 3LXMA 4E6EA 1M0EA 2WV7A 2OD7A 2RGEA 1QZZA 2FCAA 4KFUA 4PEVA 3PHGA 3SX0A 3I3OA 3L9XA 2FSUA 3LVRE 4FIZA 4QGSA 1Y8QB 3W1EA 1Y4AE 2QAGC 1O2DA 3IYLW 2A92A 1ZW1A 1ZEJA 1TE2A 3SC4A 4BPRA 2CNOA 1YS9A 5KPJA 1SHLA 2DUMA 8LDHA 1YI0A 2GN0A 2VDPB 1T35A 3IBFA 4FYHA 2A5LA 3Q1KA 1JKJB 2FR8C 2XUDA 5ECWA 4DAOA 2BSAA 3RFCA 1UC5B 2VT6A 3N8HA 4X63A 2XXAB 1DQNA 1WUJS 2ACKA 5DOVA 1YDEA 4LZZA 3PXEA 1JXQA 3PC7A 4PSUA 1DE0A 4QPDA 2WJGA 1ZGAA 1PDVA 1YQEA 4BS9A 1OREA 2ZE7A 2BIFA 4M3NA 5KJFA 5H3LA 2ZR8A 3QU7A 4QUKA 1K92A 5DT2A 5EXSA 5FUMA 4F4HA 3DLTA 3IBSA 1UZLA 3THXA 1PI3A 3R0ZA 4L4ZA 4PX2A 1I4TD 4I7EA 4XLTA 2Z95A 4MYCA 1IULA 4IIFA 4RF3A 3KZNA 1T9ZA 4BGEA 2GJAA 3MPOA 2CV1A 1OGIA 2HQBA 2HSZA 4HGRA 4DQDA 3FPFA 4NVRA 4U1RA 2XRZA 3VX4A 2C2KA 2IYRA 1BDJA 1TEVA 3LT1A 4PYQA 5GVRA 3BA6A 2OE2A 2GD6A 2JA2A 4UTZA 1ST3A 1GPJA 2JJ2A 3JQBC 5JVDB 5JXWA 2R5NA 1HE4A 1TB4A 2BEWA 2AG5A 5EJ2A 5HWSA 1JJVA 2O0KA 3D7MA 4QOEA 3J7AC 2W48A 3JU3A 4IF4A 5DLPA 3WKAA 5FX2A 3WDLA 2WAXA 3LGXA 2QLMA 2BMVA 1FX0A 1ZNQO 3IVMA 4BP1A 4DC0A 3AFNA 3W90A 3BXHA 1RWPA 8ABPA 5I3CA 5FCDA 3R3VA 5AESA 1EAYA 5JVDF 4DA0A 3GZNB 2JD0A 3O4RA 1O5TA 3UMCA 3G2KA 4CIVA 3KAKA 4Q1DA 1GU1A 1R7RA 1RJDA 2Z6AA 1C1YA 4NBTA 3SJZA 3KKEA 3EISA 3T7CA 4Q1EA 1PGPA 3TSAA 4BTEA 1FSGA 4WOCA 2QPLA 1L5YA 5A1JA 5LNK6 4LJ7A 3ZVNA 5F4BA 2HBZA 2GFIA 3NJ8A 1B6GA 1ESZA 2VRCD 1JU4A 3NVMB 3OAAD 1CY8A 2OCLA 1T24A 1MXHA 1FNCA 3M2PA 1ZUHA 1IVNA 4GKAA 4IJ5A 4NNOA 3D54D 4XX0A 1ZUNB 5ESRA 1DP4A 3VTFA 3QBDA 1QYCA 1GD1O 5I47A 3HNOA 2G7MC 1KGSA 2DFLA 1E5DA 2DUJA 4QLOA 4YJHB 2GFQA 3VUFA 3RTGA 3W04A 3PFIA 2G80A 3ZOZA 3W5AA 1IJEA 3OLWA 2XYRA 2GN2A 4OP2A 4BBAA 3VR1A 1KNQA 3MLBA 2DB3A 2WYHA 5EIAA 3RANA 1ZD2P 2XQGA 4M36A 3R5TA 4P0TA 1TJNA 1J56A 2QP3A 4G5FA 2EBWA 5BMVF 3UTCA 5C8YF 1LBSA 1XEWX 5CAEA 3TGLA 1WOMA 2ZIXB 4KUHA 2GLUA 3S99A 1GFWA 3NW9A 2Z2KA 1MORA 3OQNA 1KEEB 1ZOOA 5JQGA 2OOKA 2GD1O 3GJYA 4H6VA 2ERXA 1GAWA 1SIBE 2HF2A 2ZOSA 5CDYA 3DXYA 1M34A 4DLBA 3V48A 1QHHA 4BWGA 4RDXA 5IDXA 5LPNA 4O2AF 1DIBA 1ZK1A 4MITA 1HDXA 4J07A 2ANCA 1YZGA 2VP9A 2IPAB 1EG7A 5TMDA 3BEOA 3OA0A 4XGNA 2DBRA 2AN9A 2XYQA 4LJ4A 3AINA 4LOIA 4WK2B 2XYVA 2XSZA 3NAGA 3QE2A 1P1CA 1KOGA 5D5PA 3P2JA 3BTSA 4H27A 2WUVA 4MW1A 1ETHA 1DARA 2FMFA 4QDXA 1JQBA 1VKOA 1JTFA 1TUIA 1FFEA 1OLOA 2M6LA 5AW5A 3EPHA 4RJ2A 3EEIA 1YZ3A 2H07A 3F7OA 3INNA 3TTXA 4BMNA 1M0WA 2NVWA 2VYCA 3C1OA 3K16A 4HEHA 1YKSA 2WW8A 1T2UA 3R0JA 5TQVA 1KDOA 3ZE0B 1RE1A 1YZHA 1Q95A 4RSGA 4KE8A 3IVRA 3LKBA 5KVQA 2VXBA 2DKNA 4X1YA 4JUAA 2JH3A 2V7TA 3HB0A 1IM2A 3C87A 3BZUA 1X94A 4H6XA 1RPJA 4EPWA 3EJ6A 2VEOA 1NR7A 2WUFA 1NZJA 4K26A 3ZGXA 2WFMA 2UVPB 2YJ6A 4R7TA 1GTSA 1UT8A 5H80A 2ZZNA 2QP4A 1JFSA 3RUFA 2FRDC 4YCCA 1UJ6A 1M8KA 2JKYA 2GUGA 3W2HA 1FSSA 1PNRA 3RSQA 1NGSA 3QLUA 2O5RA 4RL4A 3GCWA 2DFKB 4G1BA 3RH0A 3U1BA 3OWOA 4MAMA 1IDN1 3AUTA 3C45A 4GZ3A 2WYIA 5AVZA 2FZ4A 5HZMA 1ZCFA 3PCRB 4C03A 8OHMA 1EH5A 1EQUA 5GM1A 1A9PA 2PFSA 2YXDA 2A3RA 3HU5A 3O47A 4EHLA 3N2IA 3Q2IA 5CNJA 5JRZA 2GCOA 1YC2A 3OJEA 4ERNA 3HHEA 4QDJA 2IH5A 1XDDA 4Q16A 1WHTA 2P2YA 1XZEA 4W6ZA 4BQNA 1EB8A 2R751 4EHFA 4DV0B 3WLAA 1V9CA 1Z7YA 3O1HB 3OPYA 2FWNA 4AZWA 1G5HA 3U6KA 1WD5A 1LLDA 3OFJA 2QRQA 1NVAA 2Z3WA 3F6EX 3AEUA 4I9GA 4OQPA 1F1JA 3H5VA 3MWFA 1B6SA 4RO0A 2PE5A 1N2HA 2TYSB 1WLYA 1E0JA 1BXRA 3A6KA 3DE2X 4QSMA 4L78A 4S2EA 1OFTA 1SD5A 4ZANA 5BSMA 4D0NA 4DEYA 2ZZKA 1QG4A 1KH3A 2O2IA 2IVFA 3KOOA 4GRAA 4R8MA 1YWGO 4Q9LA 5EFZA 3GLGA 4A5SA 4DIOA 1ZD9A 3USCS 2Z30A 3EPKA 1H0RA 3CWQA 4RIGA 4OGGA 2YH2A 4Q3DA 1KFJB 1G20B 2OILA 5IJZA 5H70A 5KX5B 1PNVA 1TQHA 2HU5A 3H2BA 3QP9A 1O95C 1JEOA 2HGZA 2JW5A 3ZCXA 4JI1B 3HCBA 1XTSA 3QVLA 5KNBD 3RVBA 3AHDA 3HGTA 1EM6A 3D1VA 1I3CA 2D1RA 1AQ6A 1Q2UA 1ZI6A 3ICWA 1GRVA 2EL7A 3ANMA 5COAA 5DGCA 3T95A 1Y8ZA 4Z4IA 3LQ2A 3LDFA 3MD9A 3AEKB 3TLXA 4NBSA 3OZDA 1QFMA 3D3KA 1Y3BE 1MO2A 2AHRA 2GN4A 2EFYA 3NJ4A 2DQZA 4GW3A 4HRAA 4IDBA 4N5DA 4F7WA 3BSFA 4XPIB 5SY9A 2GX6A 3SR4A 1R8YA 2B5WA 1YGPA 3EXFB 4BO7A 4P7BA 5A0FA 5JADA 1K6JA 1N6LA 2G9UA 5AW9A 2J3KA 1FUIA 2OCGA 4URZR 3RGWS 2D6FA 5IZ4A 1JKXA 5CVJA 2FX3A 3OOJA 3QYJA 4V0KA 1JFFB 1I6KA 4UNQA 1E3TA 3M6UA 4LRSB 3INYA 2VH1A 2PX4A 4OKNA 4RS3A 1T36A 4JP5A 3AF5A 4NX2A 2XTNA 3FMPB 4JL5A 2XYHA 4Y18A 3BT7A 1V1RB 2GBGA 5DNDA 5EAIA 5BUQA 5ERYA 1SXJB 2X2OA 1NXQA 4L85A 1GGVA 1TYDE 2G07A 2ROQA 1NQUA 3GAZA 3WWPA 1XEFA 1DQSA 3ANXA 3GRCA 3K6SA 3FM9A 4HH4A 4NE2A 1UCFA 3VVCA 2Q6IA 1LJ8A 3V1TC 4Q39A 3TQRA 1NJ1A 5BWCA 1H9BA 4K3UA 3DB2A 4EPTA 3V00A 5BT9A 2QRVA 2FYTA 2M6SA 3G1UA 3AR3A 3NU1A 4OBWA 3UUEA 2R96A 3D4LA 4ZOCA 4JB8A 1ZGCA 5DM70 3K0BA 4G86A 2WTAA 4PG7A 1EGAA 5G53C 3WGNA 3LLVA 4A8PA 5G2OA 1KYTA 2AE2A 4FEAA 2QKYA 2Y0BA 4RKWA 4X60A 1J2TA 1UM9A 3FYDA 2E4WA 4U9IS 2XLCA 1Q1AA 4G5SA 5ED4A 4QGFA 4C7XA 1HURA 2ZZMA 4QU8A 4ZICA 2WD8A 2QMEA 3I73A 4IXWA 4LRUA 4J8PA 4UEKA 3TDKA 2D2XA 3U7HB 2CJWB 5H68A 2P8JA 3IQEA 4WK0B 4FU0A 1U6IA 4JBYA 4CLHA 4D2IA 1W2HA 3NPMA 1KJIA 4DCNA 3LU1A 2IQ5A 3M2TA 4REMA 3V7YA 4HNTA 3T61A 3LH5A 3LCCA 3B70A 4IVRA 1PTJA 4KWIA 5HXAA 3NV7A 4W5JA 4Y6QA 4DBZA 1ZP6A 2F67A 4CM6A 1IFXA 3K9CA 1G17A 1UC8A 3MCAA 1VA5A 1U0HC 4EUFA 1YIDA 2NXEA 4XQ0A 4EA7A 1Y0BA 3OKAA 5E6RA 5D7NA 3KWLA 3PRHA 4RTKA 4RLQA 2YUIA 3GIWA 2EKZA 4CMEC 1CJSA 1MNQA 4JUBA 1AGRA 1NMXA 1E1MA 4O3MA 3BEDA 1WCYA 3ITEA 1BROA 1OTHA 2WEKA 4P35A 2G5TA 1SCQA 4RF2A 3MT0A 3D7SA 1RQ2A 4PU0A 3JRNA 5DLDA 4I6GA 4ECEA 1ZIDA 3GBPA 5AM2A 1E0DA 2F1RA 1KO7A 3GUCA 3SYRA 3GGGA 1IIRA 1A1SA 3UGKA 4F4IA 4BNIA 3CKLA 3JRWA 4KQ1A 3UBTA 1WUYA 1FYDA 3QELA 1GUAA 3SLGA 1BN7A 1J9GA 4JD5A 3T0GA 2VTBB 3QLVC 1SUIA 4WXMA 3N6XA 3RQSA 5KJ1A 1T5LA 3KE9A 1Z0AA 4TWAA 5CCDA 4D8UA 3BD6A 5KS2A 4R71A 1A4XA 4G4SO 4LBVA 4UATA 2I91A 3PPIA 6GPBA 1PLKA 4BPBA 2C03A 1A69A 3DV9A 1RJEA 2FE1A 5CH5A 2P9JA 4OJQA 1JF8A 1NLUA 2VTDA 3DQQA 1XJ0A 4RBNA 2BGGA 1A0OA 3BMOB 5J43A 4OI1A 1U0OC 2BGKA 3IRVA 3SDBA 1CHDA 3NTUA 3B2EA 3C8UA 4M87A 1D1QA 1S4QA 3R5SA 3BHJA 4DLWA 5AI4A 2GN1A 4JXZA 1C4WA 3D1JA 3WIOA 1CQZA 4WN3A 1JSRA 4GZ5A 1IATA 1T5DX 1CXZA 2PMEA 3D7NA 6AT1A 5L4NA 4M49A 3KYCB 4IMJB 2GK4A 3WV4A 5AW1A 1GGHA 1JLMA 2XNSA 1L5MA 4OQNA 2YV3A 5LP1A 3EVFA 1ZJYA 5BR1A 4K7JA 3N8IA 3NHFA 2Z9BA 4ND5A 3RIXA 1K63A 1OJ7A 5KYGA 2ZW9A 4HQLA 4J1QA 3U3ZA 1UK6A 3FNIA 3RT7A 3FE2A 4N6NA 2CVFA 2GHRA 1Z0SA 3S6JA 4ZZ1A 4P93A 4PFJA 4E5KA 1HE2A 5BV1A 1PP4A 1QG6A 5HK9A 4ARZA 3D8NA 1BIFA 3SNHA 2RONA 1W4LA 5H1YA 4GX1A 4YAKA 1FUUA 4OLFA 3F74A 1GYQA 3QEMB 4HQFA 3U7RA 5A4IS 1KAQA 4CKCB 3H2ZA 5BWOA 1HYHA 1VIDA 5AM1A 2Z6UA 1KJ9A 1NM5A 2CNNA 4KU4A 4PX3A 1ZN8A 2EZ4A 1JEEA 2J87A 2O0JA 2GEDA 3LA8A 4F6RB 3HVKA 4MEBA 2Q2WA 2PLAA 3AVOA 5EUCA 2DTXA 2IEDA 1T6NA 3IPCA 1ISHA 1FA9A 1O6CA 4AM8A 3CQ9A 3TFOA 1BOFA 4TRMA 4X7PA 1EDZA 4A26A 3JARB 4JVSB 4H4EA 1QRAA 4JNCA 2BFPA 3QBVA 1W0JD 5JZOA 3IJEB 1DU4A 5FFFA 1NBMA 2GXQA 3NAMA 2P90A 3IA2A 4Q18A 4U9UA 1N2SA 1ZGBA 5AVJA 4Z8XA 5G41A 3IXQA 1JHMA 1USIA 2J3JA 4CG0A 5AOCA 2P6RA 4XCXA 1GTZA 3CLRC 1UMBB 2O1XA 3C98A 1DPGA 2NSJA 2CC2A 2EDCA 2HK9A 4JHXA 3H1TA 4HYYA 5LD2B 4UW9A 1EFPB 2Q6VA 4AULA 2QENA 1BRMA 4ZXFA 1N8NA 1WSWA 3O95A 1QIHA 2GA9A 3ZWDA 3LHIA 4TSFA 5K3DA 3N76A 4MVJP 3UJNA 2DXIA 2QLFA 3EVTA 4UCFA 3Q8MA 3GLHA 3ZHSA 3S40A 2OUIA 3KDSE 3PQ3A 1NMQA 2ZT8A 1QTIA 5IBRA 5L4SA 4NJEB 5LZ5A 2J6CA 3OQMA 1QRRA 2UUOA 4MWSA 2Q7XA 4PFKA 3WLJA 1YRBA 4N76A 3GYBA 3H0EA 4CMGA 3L1KA 1D1TA 2Q3BA 1ZOLA 2YFYA 1KOJA 3PFFA 5B37A 2RGUA 3HNRA 5JAPA 1KQOA 2NZXA 2WD9A 2R11A 3QQPA 4HZUB 2H2IA 4IRUB 2JZOA 4F4FA 1A82A 3RTDA 5FWXA 5A5EA 4YP0A 3WQQA 2F2TA 3K0CC 3ITKA 4JOQA 4NV1A 4J9UE 1ODTC 1NFFA 4I8XA 1XLVA 4NR0A 5J1SB 5DE3A 4DXDA 5CBPA 1M6EX 1TJPB 1SCJA 2OT3B 1P4HA 2QZZA 3INTA 1IBLB 2XD9A 4A1OA 1BFKA 4WZAB 1W46A 3MAAC 3WBJA 2NO6A 1XDBA 4J7CA 3EFEA 5J2TB 4X6XA 4FT2A 2H4FA 4OHXA 2XTMA 2WWHA 3NTRA 3ZVLA 4ZZ0A 3CZPA 4K6GA 1B16A 3WGOA 2UXBB 4XKJA 3MT7A 1ZMRA 1Z3CA 4TTVA 4Y3UA 1KAGA 3VDQA 4KFSA 3AL0C 1EWRA 1SC9A 4MPPA 3DE5X 1QZTA 2GKOA 1JHUA 2C4KA 3NHPA 4FCTA 3OCCA 2JNWA 3SK0A 4K9NA 4IDGA 4D9JA 4YRAA 2DKFA 3VR5H 1L6RA 2H2AA 2I7DA 2NT4A 2Q41A 2WZQA 1EA5A 2A4MA 4ITUA 2GESA 3QOWA 4MUJA 5JPDA 2ZUWA 3GZNA 2H4WA 4LXTA 4N1AA 4KXYA 3Q9NA 1EXNA 1PFWA 1Q83A 2YWRA 3ZHCA 4D98A 3M82A 2JZNA 4K6FA 5TQ0A 3TVTA 2GM3A 2IYAA 2RHLA 1ESMA 4QUIA 3KYDA 2QM7A 5CB4F 3SS9X 2MYUA 3AUSA 2HLNA 4DKJA 1JUDA 2G8LA 3QM1A 1C0PA 1XTPA 5ULLA 2CSXA 1O5OA 1MXFA 2Z98A 2QYOA 3OF3A 1E0SA 4OJYA 2ECPA 3RYIB 3DLPX 4HLQB 3NOOA 2XNDD 4CDRA 5BUCA 2HK7A 5IARA 1E7MA 2WQZA 1PJ3A 1ODFA 4INJA 5AVTA 3K31A 1CY2A 4MI3A 3O8NA 4L4YA 2NMVA 1AMOA 3CH6A 2ZATA 3BX1A 1EVZA 1Y9ZA 2Z1MA 4TWRA 5CEJA 1OKKD 1HZJA 2MYPA 1SD2A 2E6KA 3O38A 1V39A 4BFXA 2ECOA 3R23A 4X8MA 5EC8A 2ZB4A 2QRKA 3WGVA 2Q3JA 4AO6A 2KYRA 4PLTA 2WU4A 3JWHA 2HQOA 1IN4A 1W19A 3NH6A 3KEFA 2MTBA 3V8EA 3P26A 5KX5F 2BJHA 3A0RB 4P9NA 4ZC1A 1V5FA 2QRNA 4V2UA 4I5EA 5EIEA 2D00A 3GEIA 2MYNA 2JJ2D 3PGMA 4QBHA 1WBJB 4ARIA 2CKDA 1XCLA 3AUUA 4JL6A 3UJDA 4FHEA 1OXMA 2POQX 3FFBA 2Q07A 1QVAA 4Q7MB 5JCJA 1HH4A 3SBEA 3UMRA 4OX9B 3ORQA 1ESDA 3WO0A 4ARUA 3MTQA 5B1IA 3UXHA 4DWWA 3P4YA 1G3MA 2BM9A 1WM1A 4I3HA 3MTAA 5K03A 8MHTA 4DUZB 3L4SO 1ENZA 2O2DA 2C7OA 3T1HB 2ORYA 5EZYF 4PNEA 2AXNA 1LDGA 1L4KA 3LRXA 1B0AA 3VV3A 5IAEA 2HMSA 4MW7A 3FFXA 4WEOA 4JS0A 2F3UA 3D4IA 4GC9A 4IMRA 1X8JA 4YXWD 4CF5A 1QQBA 1OX4A 2IUSA 1RCUA 1P1JA 5SZJA 4F85A 3WZMA 1JEYA 2RGNA 1JFRA 2ZYSA 5LIPA 2OKGA 3LWBA 4QU0A 2C9YA 3P9XA 2X6QA 1JMVA 4GWLA 3UW1A 2IGTA 2OR3A 1IY8A 1O03A 2Y9PB 3EYWA 4K9MA 4AU1A 3ZE7A 3ZE6A 7YASA 1E99A 3C14C 4GP7A 1I30A 3IEXA 4Q82A 2FPMA 2DWUA 3M34A 1K5PA 2ICAA 1UBUS 4W1SA 4ZTUB 1BVHA 4UE6A 2GHTA 1OMOA 3LUGA 3WGGA 4DEVA 3DKPA 3V8PA 1O6BA 3I2IA 1BE0A 3ST7A 1U3VA 1QJ4A 4NV3A 4YRMA 2JARA 4K6CA 1QVWA 4EY8A 3WLPA 1CJBA 4KRYA 3GGJA 1VBKA 2W6ZA 1U1IA 3KJHA 1NULA 2O6HA 1YBHA 1SQ0A 2BI4A 2PBFA 4X3PA 2WJ4A 3BD7A 2AOTA 5DPMA 3GP3A 2YINC 4M22A 1YBMA 4LXQA 1X86B 3B2QA 4G41A 2H65A 3LHKA 1AKMA 4JC4A 1Z5NA 4P4SB 1ZGJA 2TMGA 3R0VA 5JNSA 1F2UA 3FH0A 3N74A 2BEKA 1SO8A 1UDBA 4GL4A 5ALEA 1YNOA 4M76B 1T9GR 4IO0A 1I3NA 4UVHA 1XYGA 4TXMA 4AWAA 3DUFA 2IY7A 2WT9A 4D45A 4BO9A 3X43A 2AFRA 2IFTA 5AUOB 1R6VA 4JR1A 1N36B 1O89A 1J42A 3DAGA 4FUQA 1C7IA 1M2KA 4F3KA 4PWZA 1UINA 5IZCA 2YJTD 4UUAA 1WXFA 5BW8A 3VYSB 5KWIA 1U2EA 1QZXA 4CLOB 1VMAA 1XZLA 2BKAA 5BQXA 1HE1C 1SKMA 1W1IA 2PEZA 4UDYX 1M67A 4IJQA 1G42A 4L95C 3TRDA 2AK2A 4D82A 4IR7A 2FPIB 1XVAA 1XB2A 3MWDB 1VMDA 1JH9A 1XZNA 3H2SA 3AX6A 1Y1KE 2NZYA 3H4VA 1PJ4A 3OT1A 1MLDA 3VVLA 1G8AA 3QEOA 1I5OA 1REQA 4L73A 1ZCZA 1C9JA 4S05A 2ZTVA 3TUZC 3HACA 1RBMA 5EJIA 1AKEA 4JJIA 5EG5A 4KSBA 4ZI3A 1ADFA 1AN0A 5HYVA 3EBLA 4PC2A 1RNLA 2WZDA 2ZRBA 4Q7KA 4JBLA 3SZUA 3PNSA 2XDQB 3EVCA 2G3YA 1T8RA 3I01M 3K20A 4KBYA 4QAQA 5FNVA 5KYVA 1TA4A 2X1LA 1TT7A 3H1BA 1Z22A 1H6AA 1R15A 2HZBA 4KVZA 1W5TA 3TLGA 1S89A 3L7DA 1R4ZA 3IT1A 4MB2A 4FQ8A 3EHDA 4QNMA 1FNBA 4UD2A 2IX9A 5F1PA 1EVEA 1GNRA 2DF8A 1X87A 2OVFA 2WVAA 1JZSA 3EXFA 1Y80A 2X1VA 4FOLA 4L2IA 5IT5A 2JEYA 4C06A 1L7BA 1TYBE 2AOTB 4YMSA 3M3DA 1JKMA 5K8VA 4IVNA 1M1NA 3T38A 2KHZA 4KWHA 1WF3A 3K71B 2GTHA 1GL7A 2HMUA 4JNKA 4CNBA 2AEFA 3KL4A 3FKQA 3M4ZA 1E9CA 5C1DA 1RYBA 2JIBA 5LYYA 4HY3A 1FJHA 4O25A 4MP3A 4DCOA 4NBKA 5IHXA 2BGUA 1YRAA 2BF7A 1E5QA 2WE8A 4UVIA 3L1UA 4RSMA 2IH4A 4P36A 5EVJA 2O9JA 4Y2YA 5HMMA 1EVJA 3EGDA 1I3MA 4B3SB 3PDWA 2VAVA 1YB2A 1SKAA 3H8JA 3KZVA 1L5NA 3UB4A 3C3KA 1S2NA 5JG7A 4YEDA 1E8MA 2AOUA 1SK9A 1QR6A 1PZFA 1W0KD 3I4FA 3L7NA 3LLUA 1CY4A 3AY6A 3MS4A 5D6NA 3WSTA 4N8DA 4M8SA 1TCUA 4OXQA 5J2UF 2BMEA 4DRZA 1KO4A 5D85A 1NW7A 2L18A 1O6ZA 2JGJA 5B3KA 1BSVA 1G1MA 3WLIA 6ADHA 1ZFNA 3O73A 3SC2B 2X4DA 2VUSA 5HE8A 2MSEB 2NO0A 1VLJA 4NXMB 3TDMA 4L51A 3TTUA 3A2KA 3CS3A 1Q5PA 1PWHA 1OXBB 1VI2A 1JQEA 4NENB 5I7EA 4E15A 1BU5A 3UXYA 1U90A 3OPYB 4Q4AA 1F7VA 1KYQA 2Y68A 4EVQA 1PHPA 3LTNC 3ZGYA 3H9EO 1EB9A 3TF5A 2OXRA 1IONA 2CK3A 3ES9A 2VPIA 3ITDA 2LW7A 3EDCA 1JHQA 4G5GA 2A0UA 1NRJB 3ND8A 3R76A 1XLTC 1C30A 4BX2A 2ZE5A 3OKPA 3HBNA 1N0HA 1YJAA 2FFQA 1H05A 5DTMA 2C1XA 521PA 3T9EA 4YMLA 5JDCA 4AY2A 1I1HA 2QRLA 4TV9F 3ICOA 4JLWA 2GSWA 4JASB 1XNQB 3DZGA 4P22A 1UWVA 4U7HA 3RSZA 4B3TB 1EK2A 2VQSA 3PPWA 1ND5A 4RIHA 2INGX 3NR2A 5AVKA 3DHWC 4EYGA 4QT4A 3Q12A 1Z74A 2V6BA 2ZB2A 4B3JA 4FHGA 2OQVA 3CEHA 2PU7A 3FTCA 4KI7A 1AQYA 3CKMA 3MB8A 4K05A 4WADA 2LIVA 1R8JA 4FE4A 4OM7A 1D1PA 3H5AA 3UMGA 3DEIA 3OLYA 1OYOA 1I7SB 1GTVA 4HNQA 3C3MA 3HJHA 3SKVA 1E58A 3SIPA 3ZUGA 1JDSA 1CB0A 1L7XA 1V3UA 4QUDA 4BKOA 2IBTA 1CYDA 5L3SA 4TUYF 1E79A 1VIAA 3OWXA 4R2LA 1R88A 1H93A 2UUCB 5L8VA 2FPGA 2J3EA 2W2VA 4D79A 2I7XA 3OI7A 4LECA 4DRXB 1G59A 1A5ZA 4O3FA 2BFWA 2DFVA 4I66A 4F91B 2OHXA 5LIRA 2ALJA 2PD4A 2RHDA 3KPUA 2V65A 1GR1A 2QHXA 4D3ZA 3CBGA 3KQNA 5BSRA 3WGTA 2BTEA 4ER0A 4P4UA 5CURA 1V4VA 3GFFA 4RMHA 4TWZA 5MN6A 1WMDA 1OXTA 2HCJB 2QPAA 2W0SA 4LF8B 5EJAA 4Q3AA 3AIKA 1SHJA 4BLVA 4OA5A 2JIOA 3Q2KA 1DX4A 3C8HA 1YD7A 1P1HA 1Q17A 2DPLA 1V8OA 2R1UA 3CRRA 5TEVA 1EXDA 2P9GA 4JYCA 2YN0A 3NHMA 5B1DA 1Q74A 1DBQA 2VHQA 3WKDA 3GF4A 4G1UC 2JBHA 5A5VA 4AI6A 1AKYA 2X9VA 2Y2VA 1AQJA 1XXLA 4RFVA 1D6JA 2Y0PA 4RPIA 4R31A 3AR8A 3G8CA 2O8CB 3TBKA 4N7JA 4TT3D 2GYVA 2GF2A 1TK9A 1OZGA 3PR1A 4QXMA 5EIFA 1CEEA 4NV0A 1CEXA 3DM5A 4OL9A 1BMQA 4JXXA 2AXPA 3PEVA 3JATA 3LVFO 4FHZA 4EUKA 1QGAA 4IXTA 1GN9A 5ADVA 1KMNA 3FOFC 1FYVA 5EWMA 2JH9A 3ISTA 4QHTA 1VJGA 2ZAMA 4E3WA 4NMHA 3PC3A 4M2LA 2QD2A 1M6NA 3PV0A 3P1JA 1QIGA 3NALA 4KR3A 2R4TA 1NOJA 1R12A 1FNDA 2WJWA 1OXXK 2C5GA 2XMQA 1VFPA 1Z2EA 4V0MA 4ENRA 1EG2A 1J8FA 4YWHA 1BE1A 3K32A 1B8VA 1NI3A 3EASA 3PKZA 1HTBA 2P3QA 3D43A 3PIDA 2WPDA 4R9SA 5LP6A 3R3UA 4H16A 4LOJA 2BTOA 2A9VA 2YWJA 2HTFA 3BRCA 4IDHA 4DCMA 5A9RA 5KVCA 4J94A 1NPTO 3CF2A 1WAMA 3O1IC 5A0VA 1C0KA 1T9AA 1EKXA 1SCAA 3PNKA 2C3UA 4JXKA 3U39A 2YHBA 1U6JA 4K40A 2B4QA 1W9HA 3O4IA 4NOJA 2WDZA 4JBWA 5HIIA 4MK4A 2A14A 2RHCA 4GUAA 4YR7A 2P6OA 2H1SA 1DXYA 2AXQA 2PV0A 3Q0IA 3RRMA 3PP8A 3SQNA 4NNPA 2JLYA 2Z6VA 3KWMA 2PXHA 3FYHA 4UVGA 2OORA 3D4PA 3IQFA 3JVUA 4IH4A 1TJ3A 2NAFA 5AVUA 1DB3A 1F9AA 1UFKA 4FCWA 4MUBA 3ZH9B 4YAFA 3DF9A 4KN9S 4WBNA 1U0EA 4U0KA 3SEZA 4G0XA 2FFRA 2N0SA 3F6YA 1Z6QA 1NVXQ 3TLEA 4E5VA 4YMVA 4ZMSA 2OAP1 3PPXA 4XQGA 3TW6A 3L8ZA 4NFLA 5BNTA 1QIKA 1G21B 1FXWF 1TVKB 2P0YA 4KG7A 4CV2A 4QATA 1XVVA 3D81A 3T3IA 5A0TA 3AIMA 4N39A 4G63A 4BWYA 3B9QA 4ZXPA 1PQWA 1WX1A 1GQ2A 3IOMA 2JGIA 3E8SA 1Z4IA 2VP0A 1QFXA 2UUAB 1NUTA 1Q19A 3IR5A 3COVA 2C2YA 3ROQA 4YRNA 4HXYA 4RENA 1SXJE 1TCBA 3H84A 1WLSA 3J7TA 3WQHA 5GAJA 1GAJA 2QEQA 3QE3A 2V1XA 2VDQB 5L3QB 4DQUA 1PEAA 3M81A 5IAJA 3MBKA 1IK4A 5FYQA 1LC0A 3HCFA 1P77A 5EESA 1GCGA 5FYDA 1E2UA 5FOTA 2H5JA 4FXOA 2GF9A 4WFQA 5DTJA 3B89A 2EP5A 3KTOA 2RARA 3E03A 2C9ZA 4BQFA 5G3ZA 3DJYA 4LJLA 4RGQA 1R0XA 1G8MA 1AGYA 5BO5A 3DFKA 4F92B 1O97C 4RD0A 3AOEA 3DTTA 1T91A 1MJNA 5DISB 4BKMA 2R25B 5GOTA 4B6OA 1ZN9A 2AKEA 1XTIA 4V0SA 3TFWA 2G08A 1EWQA 1WZNA 1THMA 2ES4A 4LV8B 4IIGA 1ZCBA 3DVAA 4B2PA 3FF1A 1D4ZA 5BW4A 4IV5A 1R0CA 2R8ZA 2A5GA 2EZ8A 1DADA 4FYKA 5CCEA 4HVCA 4NZPA 1VIYA 4RV9A 4ZYZA 5EMLA 2NM0A 1KHTA 3F2IA 2ZM6B 1Z47A 4RK6A 1LRJA 3H5TA 1BAPA 4A03A 4AX4A 4KP7A 5F9HA 4PCAA 5DM4A 1F12A 1Y7LA 2ONZA 2QZPA 2XOKA 5HQJA 4TPKA 3PRKE 1TU4A 3CNOA 2GYUA 4G23A 1HMYA 5CA0B 5JD5A 4ISBA 1BWRA 4HC4A 2YICA 4MWBA 2H29A 4YROA 3VNBA 3W5UA 4PFSA 5H7XA 3I42A 1XL1A 1Q16A 1RJWA 4N9WA 4WCVA 4N65A 4RACA 4FFBA 5DIFA 2JLSA 1MHPA 4QOGA 5BV7A 3IVAA 5M3BA 7ABPA 2DWCA 1QFYA 2F8MA 3S2FA 1YOBA 2CE2X 2W6MA 4IH1A 2R8XA 1I7QB 3OA2A 2PKWA 1JEJA 4LZJA 1X8LA 4BDSA 4LPKA 1JJFA 4I6JA 1PZEA 5KKCA 3AUKA 2ERCA 4RGYA 2HEGA 3OM0A 3A1WA 3QY0A 3WRXA 2QMOA 2JGLA 5I9MA 1J8DA 4BRWA 1JBKA 5GZ1A 2E7ZA 1RBQA 2YWBA 2PWYA 1ZR4A 2XWQA 1A71A 1GY8A 2D2IA 3OY7A 1WXIA 3BMNB 1ESEA 4NS1A 4RVHA 2HEIA 4PG5A 3WL3A 1F0PA 1Z28A 4KQHA 2VXCA 3RRJA 3FIJA 4IHJA 3PB3A 4P7KA 1NAHA 4YMWA 3U9LA 1U7TA 2B1JA 4JDUA 2WF6A 1FQWA 1NBHA 5DBFA 2DZDA 3SKYA 3TLGB 4BP3A 4XYEA 4UQLA 3ZXUB 2J9FA 3GVHA 3ESDA 2HA3A 3K9FC 2AEEA 2RGGA 4IDCA 4UHEA 3E3MA 4XJVA 3VU0A 4CLRA 3AR2A 4OXXA 2V9CA 3A1EA 2D0DA 3K5WA 3U09A 2W42A 2EJUA 3NGLA 2AN5A 3KXLA 1FMCA 1ZQ9A 5AKIA 3RAFC 3UK0A 4ZT7A 2WWGA 4N49A 2YIMA 2WU1A 1WZUA 2UZIR 3B7WA 1QH8A 3Q40A 3MCVA 2JGAA 3D6NB 3O91A 1W59A 1QCCA 2NADA 4B32A 4GGPA 4YWJA 3STYA 3Q9LA 1KDPA 4O4JB 4P31A 5KINB 3QK7A 3MXTA 1SUCA 2GM5A 4YCLA 5AUQA 1NFRA 3LW7A 3W5SA 1NVBA 3JYNA 5MN5A 3HVJA 1ABBA 5JEEA 3WGYA 3ESBA 1ZRMA 3KP1A 3QVXA 4KEAA 2RCYA 5I9IA 3DCJA 3OE5A 2DEUA 3C7KA 4IW3B 5ESDA 1JJ7A 4QLAA 1MZPA 3A3NA 1G3UA 1NKTA 3A3KA 2O1SA 3FOBA 3U4CA 3COJA 4E08A 4DCGA 3BFPA 5F98A 2VOJA 2IOYA 2XNKA 3UFXA 2CNWA 1IUKA 1LLUA 2Z5FA 5GZ6A 4PLZA 4EB8A 4HNUA 3T3HA 3BILA 2XQIA 4W9NA 2PLRA 2ZYHA 5CFNA 1ZJZA 4Y1FA 3R6DA 2PAAA 4PAWA 3EARA 5CA1F 3DLIA 4KO2S 3IQWA 4A3SA 1BGWA 3K6KA 1H65A 2DUUA 4RPLA 5DNWA 4C9BA 1UL1X 4G81A 4IUBS 2QR5A 1X38A 4LS3A 1I24A 4Q66C 5K05A 3MRXA 2FK7A 3G2QA 3OQBA 3CJQA 4ZOLA 4B5KA 3TMAA 2KM1A 2GO7A 3CEJA 3Q9SA 1UPTA 3RABA 4BN0A 4C1BA 2Q1WA 2O7VA 4NU0A 3EC7A 5EUMA 2G9VA 4KJZA 4OHMA 2CGEA 2W4MA 4RHXA 5FLEX 3V3KA 1VHJA 1ID1A 4G89A 1ZW6A 2SKDA 2WKPA 3B2NA 1Z45A 1CWUA 3ZGLA 1C50A 1AS3A 2FEXA 1M2WA 4K9DA 4AIIA 5BUSA 2VA8A 2OL4A 1V47A 4PTLA 2WU3A 3FTNA 4GYYA 3O4JA 1GQQA 2QV0A 3IS3A 5DGIA 3L7LA 4OX9Y 2YWEA 1GZUA 3U4HA 3AKDA 4N8EA 3TXXA 2UZ1A 2C2ZA 4KVFA 1GKKA 3L02A 5H9WA 2I8AA 2YN2A 3W3AD 3L79A 5KO2A 1XP8A 2P30A 4CV1A 5A06A 1QIFA 3FSGD 4TKUB 3B82A 4MCIA 2RGNC 3N2ZB 5EWMB 3WJ1A 2O5EA 2TECE 3GFVA 3KSRA 1JILA 5JSHA 4TRRA 3R8CA 1ABFA 1EHCA 2FSGA 4I9UA 1KYVA 5A1TA 5B7NA 1H2FA 5I48A 1VLVA 1BDIA 2XGSA 3L0CA 3AVWA 2F3RA 4JBGA 2W11A 4N0MA 2DE0X 3B6IA 1XFAA 3QGMA 5MFZA 3E7DA 1OFUA 3C3DA 1NRWA 4LHSA 4CYMA 2PSDA 4OAOA 4RKEA 3BL5A 2HV9A 2VC2B 4DJTA 4BMZA 3U80A 3VI3B 1TQ6A 5K8TA 1BHJA 2FRVA 2J9RA 1P4SA 4B3FX 4PY2A 5JSYA 3C8MA 2VLBA 4P3YA 4JLVA 3EA5A 4MRMA 2DCMA 3NXSA 1WE2A 1KVQA 2I8CA 5A04A 1Q0QA 3VVMA 4YXFA 4AZ0A 1W4BA 2J85A 4KBGA 3TAUA 4MI6A 2IXDA 2V54A 3LXUX 1XOIA 4LMBA 3W4JA 2HWKA 1E6KA 2ESRA 2X22A 4D0LB 2BLNA 1IXRC 1SKBA 5LB4A 1QP0A 4TYYA 5DLEA 2MINA 2VK4A 2BSXA 4WCFB 4B85A 2ZQ5A 3LIIA 3STHA 4DMKA 1O77A 5DCLA 4ZI7A 1T8WA 1OAAA 4EG3A 4IDAA 5CYPA 5F5XA 4HQOA 4E33A 1QIJA 1WMFA 2Q27A 3IHTA 4O4IB 3GLVA 4FYIA 5F3RA 3SJCA 1CT9A 4EPXA 1II0A 3OHMA 4MP6A 1IYZA 4WUVA 2QTWB 2XRYA 2HAEA 1SIWA 1KDTA 4DLKA 3VNUA 1Z12A 2AFHB 4IPTA 1YCDA 2VUHB 3PGA1 3M4NA 2ECKA 4CDGA 2GCEA 3FFAA 1W0KA 3DUFB 2C7GA 3DTNA 1YFLA 1OA0A 4S12A 3WS7A 5DB4A 2P9TA 1N0IA 3F5DA 4ZOLF 3Q15C 5BOVA 3VYVA 4CEJA 2ERYA 4OFBA 3PRYA 2D54A 3W1WA 1XXHA 1G41A 3ELBA 3RRXA 2HQSA 2VNAA 3W7VA 1DKLA 3TLYA 3TW8A 1Q50A 1TVCA 3MUNA 4U9HS 2EBFX 3CN9A 3IA7A 4QDUA 1MENA 1ORRA 2NN3C 4LVOA 4QU9A 2SICE 4C0BA 4EA6A 3CPSA 5ADUS 4ZEXA 1M9NA 3GRPA 4A8TA 4YVFA 4DB4A 2XBUA 4K1XA 1N0WA 3FHTA 4N8SA 2JFGA 4YUYA 1GXSB 1Q21A 1YDFA 1KP3A 3V4ZA 4JJ7A 2ZTHA 4JI0B 1Y3FE 4JUFA 3AILA 3F5FA 1EDDA 2GBIA 2NYRA 3JSXA 4PICA 3TQSA 2HJGA 2W37A 2ZANA 3PENA 4J0CA 3REQA 2JI6A 1K0FA 3QH4A 3ZU3A 4XYMA 2EDAA 1QYXA 1YRQA 2C4TA 5KYYA 5IK2A 3TM4A 1ISMA 3JX9A 1P29A 1SAYA 1LWNA 3P9YA 3P9QA 1NNI1 1I0LA 3R3JA 4J4BA 2H8KA 1JI3A 1KIAA 4CG3A 4G07A 1G8SA 2XH8A 3IKTA 4JODA 5EIHA 4Q9KA 5K5EA 4Q00A 5LMNB 4IGFA 4LNUB 5EKSA 3LXRA 1ZU4A 4N0DA 3MK31 1N3BA 2G36A 2G04A 2G5PA 2PIDA 4E7PA 4G0QA 4PRYA 1HDCA 4ESOA 7GPBA 4WA7A 1EIWA 5K01A 2KW5A 4XLLA 1IEWA 2HH9A 1KVSA 3BIXA 1NF8A 5FUVA 2B25A 4F6LA 1D8TA 5DTQA 5TPZD 2EP8A 5AK6A 5C2JB 3GGPA 2ZUBA 1NR5A 3FX2A 3TZHA 4BGIA 2O2HA 5BSKA 3UG7A 1DX9A 5C8DA 2G77B 1EP2B 1R9MA 1U0NA 2CHFA 4Y9TA 3ULKA 3WWEA 1OZFA 2EEZA 1JDTA 3JXEA 3S68A 3E18A 3A9VA 2DRIA 4MX8A 3WB0A 3RV3A 5C51B 1NYLA 2EWMA 3CPEA 5E7JA 1QTRA 3I4LA 3T5BA 4B43A 4IG9A 4O4HB 4V0NA 3RC8A 4HDNA 3IO5A 4M0EA 2QSYA 1L4LA 4UJ3A 4Q4LA 1YBAA 5JLAA 4C30A 4BWFB 2VUIB 4FYJA 3EPPA 5I9BA 5E9WA 5JTUA 4CM3A 3R6WA 1NMYA 2DPHA 2HA7A 3V97A 2YNMA 1A9XB 3NOXA 2X8AA 4OXKA 4FEGA 2BGJA 3TL6A 2IEZA 2GN8A 4FPXA 2H3HA 2VAXA 1RC8A 4I4TA 1T9CA 4L5BA 2OZLA 1E6CA 4JP8A 4NFSA 1WB6A 1CQIA 4EZIA 2E5WA 4B3GA 3ACDA 5JQWA 1J6UA 1KYIA 4IS2A 5BQ3A 3N6VA 4KHPB 1A5SB 2YCBA 4U7TB 2B5VA 3DJFA 1Q7GA 1UDWA 4MEJA 3U9TA 4TRJA 3VJMA 4G5XA 4KLRA 4QX6A 4ETNA 2FOXA 1E1LA 2ZRMA 3ECCA 4GD3Q 1BG6A 2C5HA 3L1IA 4NEQA 5HUQA 5JARA 5JAZA 3FPLA 4CF4A 1FS6A 4Q21A 4PIPA 3FOWA 1Z62A 2E85A 4BUCA 1C3XA 5K0GA 1I3LA 3NV9A 3WAGA 1NVGA 4HKTA 4QQRA 3WK7A 4DRXA 2JBWA 3EVBA 2A94A 5BYJA 3AUJB 3P0EA 3IOBA 3Q8KA 1SEVA 2OXEA 2HRRA 3FI0A 4DN6A 5DWDA 2I4MA 3ABZA 5LMCA 3PJGA 1O6GA 3N0WA 3IAUA 1VHDA 1RAAA 5H02A 3K70C 1PV4A 4YRRA 1MF7A 4A23A 2QG4A 3DTVA 4OSPA 3PZBA 5IXYA 1FZQA 2ZVQX 4L8YA 5TVGA 1SK8A 3Q6NA 4KRFA 4B80A 3PIRA 1N6PA 3CX7A 4TTIA 4B3HA 4KO4S 2JASA 4IQ8A 4LV6A 3S28A 3VC2A 5KYWA 3DT8A 1ETUA 4DJAA 1Y63A 3KT6A 3K2IA 3ZQ6A 2AD5A 5B3JC 3B78A 1BYIA 2G09A 3FW1A 2VZ9A 2GAJA 3TQTA 5BSUA 5J2TA 4G25A 3SFVA 1SA0A 2AL7A 3OIUA 4QGHA 4GX2A 3O9VA 1S3GA 4MKXA 2X5NA 4REQA 4TV8A 4Z6KA 1NW3A 3OVMA 4Z8YA 4WBXC 2X0FA 2ZYWX 2ZULA 4FMDF 3NHKA 1VJRA 2ZP1A 1M34E 3EMKA 3RTEA 4IZIA 5C80A 3M70A 2XDYA 3AK4A 5JAOA 3JAKB 3HJRA 1Y1QA 4B3XA 1F4PA 3I9MA 1FLAA 2MR5A 2C8KA 3N9IA 4RCZA 4BQOA 2R1VA 2M1XA 3DDNA 1HV8A 2IWRA 4AY6A 4PLHA 4M1TA 5HIMA 1E6UA 4M9SA 3TG2A 3H6HA 3H65A 4INOA 4R1SA 3EPJA 4TS9A 1OGJA 1ZD4A 2EBUA 5IP5A 4F97A 3LWZA 3LP5A 4DV5B 5DM60 2I2WA 2OK7A 4MIEA 2JIZA 1E18A 3MGGA 4HWOA 4JZYA 2QGNA 1YJCA 2V3VA 4CWAA 1C9NA 1ORVA 4N41A 1VKRA 3IIKA 3OKFA 4HDSB 2D1TA 1WHTB 1JEYB 3B48A 4LVCA 2V7PA 3IDQA 3PQ4A 4OAPA 2ZAGA 1D03A 3M6IA 4PCLA 1P5ZB 221PA 4UHKA 4E7OA 2JEZA 1FPQA 2GCOB 3DNMA 3UAOA 1WY5A 3L01A 2PX3A 4MGKR 2Y6VA 5K3CA 3PXXA 1YQUA 3B5JA 3ETJA 3KOYA 2VQEB 1G7SA 4HEQA 5HCNA 4DV7B 1FVOA 3W5CA 5L51A 4E2WA 2Y6UA 4ROTA 3T7TA 3WB1A 5JISA 1W8IA 4JB0A 4LOLA 3LSYA 4ALMA 4G1EB 1CUIA 4BLQA 4Z7NB 2OPBA 5INTA 1UOEA 1QYRA 3HKEA 3Q7SA 3PF9A 3GA7A 3NNDA 1H1LB 4MZXA 1MV8A 5CH8A 2X7XA 4JCCA 1XNRB 3ZQUA 3LUDA 3SE7A 3QVUA 2ZT5A 5ELLA 2ZLBA 2W6OA 3K0CA 4JN6B 4U02A 4V0ME 5ALIA 4EI9A 3H4TA 2EFHB 1Q3TA 2X13A 3HBFA 4Q19A 2ISCA 3FGOA 3TLBA 4L22A 4RZIA 1B3RA 1O08A 1GGMA 3DC7A 1E9FA 1QORA 3NS7A 3OWHA 5PNTA 5U4XA 2NGRA 3ZCVA 2W58A 1UC9A 4HAWA 1L5HA 4L50A 3QEMA 5CFQA 5ICGA 1N1GA 1NL3A 3AZOA 3H9UA 3DOUA 4KQ6A 3AJDA 3T5CA 2P9BA 2CLCX 4Z86A 3O8OB 4A2CA 1QF6A 5JLJA 3JR3A 3QVOA 5FQOA 1YZQA 5JS2A 2HREA 4EW2A 1IZ7A 2EZ9A 3AFGA 2ZPUA 3EDMA 4IWYA 2UXCB 1H9CA 1IBCA 2ZSHA 3MWEA 4DV3B 5K0LA 4G0WA 2QN9A 1Q0HA 3EIEA 1ZD3A 5F9FA 3KQOA 3K0AB 1K75A 4TTAA 1TIBA 3KCNA 2CFRA 1G2PA 1SIOA 1XAHA 1XZQA 1QX3A 3CYFA 3LE8A 4GXQA 1K88A 1VE3A 4LRXA 4WZZA 1F2TA 3GP5A 1NP6A 3NAZA 1HDZA 1D07A 3MQFA 5HIKA 4AZ0B 2PIAA 3R5HA 2YBDA 4DR3B 1Z8NA 3U60B 4JJEA 1OXUA 5AJUA 4F9GA 3DW3X 4M7RA 1XGKA 4BP8A 5IH3A 3T34A 2QM8A 2GPJA 2O8VA 3HJAA 1RYHA 3DDCA 4E4YA 5IWCA 4GDMA 1FXWA 1WUHS 3RC3A 4HS9A 3KQYA 5IN5A 3DV0A 4F2GA 1LJUA 3SZLA 1E7WA 2J5XA 1W0CA 1YQXA 1RM4A 1D7OA 1ULHA 1SVSA 3MVEA 2PL5A 5TEWA 3HXTA 2AZDA 4M0CA 4JC0A 4R5MA 3FZGA 2FX2A 2QMZA 3D3WB 4MS3B 1SKQA 4CMCA 3CVVA 3ESAA 4HDCA 4OKSA 2WNHA 3C6BA 1WEHA 3UPUA 3H9CA 3MLEA 4S04A 2QK4A 2WYWA 4QDTA 3TX2A 4A36A 4DDVA 3HADA 4HLUA 3OF5A 4WTOA 2OGTA 3JQ8A 5L3VA 5IJXA 2FMUA 1YMUA 4CNQA 2XEXA 3DR3A 3BKXA 4B3DA 5IHPA 4BRZA 3BE5A 3NEAA 1JQDA 1RI5A 2BEUB 2JS7A 3GJSA 5TSDA 1JR3E 4CCWA 4FK8A 1PBNA 4R2HA 4NQZA 3EE6A 5HF8A 2WTBA 1XG5A 2HJ9A 1J39A 3CEMA 2GZ1A 2VJOA 4IGKA 4N40A 4BNDA 3QU4A 1R9JA 4RH3A 1HKHA 3JWJA 5DNAA 1TL7C 1A2KC 4AECA 5DSTA 1P19A 1A7KA 1VSBA 1BKYA 2CLOB 2JHCA 2X41A 2NU6B 3ASZA 3F6CA 4R1QA 4RMNA 5CLGA 3DKVA 4LE1A 5FRDA 2CSUA 3ZDRA 1S7CA 4C6RA 2RH5A 3AFOA 4YY3B 3RUPA 3H1EA 4NOKA 4HYTA 3A27A 4IUYA 1SNYA 2DH5A 1WKVA 2X42A 3BJEA 4GQAA 4D99A 3I0MA 1YTLA 4XIJA 3WP0A 4LTDA 5CNIA 1PEDA 1THZA 1VIVA 3OUUA 4A0HA 2IX3A 3PEWA 1SBNE 1UOOA 1ZM2A 4ND2A 4C7OA 1CUFA 1HETA 2P4EA 4R83A 2JLCA 3AP3A 4YAJA 5DIZA 3ROZA 4YREA 2C77A 3IDAA 3MJDA 2AEMA 3N5CA 1BX3A 3O8RA 2NU9B 4WK6A 5SYNA 1OE0A 3TOVA 1TQ2A 2Y1OA 3I5UA 3PS9A 4CV3A 1GHTA 3DGEC 4RKRA 4GX5A 3K73O 5JMWA 3RVLA 4XQEA 2IEAA 3NORA 2VTKA 2E5FA 4LJSA 4EOGA 1IBSA 3S8YA 1BA2A 1N2OA 1PJTA 1PJRA 5C3MA 1H3FA 5FFNA 3A7EA 3DM9B 3IOCA 1N5MA 1SVOA 3O1JC 1JDVA 1K6EA 1T26A 3BB1A 2IWHA 4BNHA 2I2AA 5AVWA 4U7GA 2XCUA 4J49A 3QJYA 4CQMB 2IA5A 5ILGA 1IHPA 2FN3A 4WN9B 1N5JA 1FFGA 2DX7A 2OCIA 4M1ZA 5ENDA 3WAKA 5ALVA 2HUPA 5LQDA 2X3FA 1DHTA 3PLAE 4M9CA 1I01A 5C9ZA 3T1VA 4DBLE 3BRSA 5TGDA 3MGKA 1G18A 1GPBA 1VG0B 1WSAA 2W6JD 3U4QB 4FM9A 3QEAZ 3UB3A 4KPEC 4WD3A 5DEOA 3RSFA 2O07A 3CSDA 1VIMA 3TB6A 4AS3A 4ZO8A 4BASA 2NU8B 4ENQA 2QIOA 1TAGA 4ERXA 2PRYA 3GN1A 3H5IA 3INGA 4YJFA 3DMDA 5GONB 2O5CA 3NHAA 1JXAA 4JUCA 2I54A 1OHHA 3FSEA 1C9DB 3CNHA 3SNKA 2QX9A 3TAXA 2XYPA 3UAVA 4QODA 3ZS9A 2OSBA 1US8A 4L28A 1WXXA 4MQMA 1ZVQA 4BNWA 3UB2A 4CCSA 1RWKA 2X8BA 3I6BA 4L4SA 2W00A 2EFJA 5CH3A 2DQ4A 3DMRA 3TPCA 5EERA 3SQWA 1ZBDA 2XXAA 4V24A 3QVJA 2WABA 5COQA 1IG3A 1NN0A 4X7RA 2UYGA 2DLDA 1TNDA 3JD0A 5B6PA 3U0VA 5IBCA 1YOVA 2CFOA 2DHDA 5EVCA 4F84A 5CITA 3U7JA 1Z6ZA 4NWIA 1SN7A 3L7AA 3PK0A 2UYQA 5L4LA 3NMUF 4WKCA 4KX5A 1FW8A 2LE0A 3CM0A 1IPFA 1YU6A 3SJAA 3A32A 4ND6A 4LYYA 5EZ5A 1DXQA 1N7JA 2ZPTX 2GPBA 4HDQB 4N7BA 3RRFA 5FA5A 3UV6A 4MKFA 3WK5A 2NX2A 9ABPA 1AKWA 1QVZA 2FPUA 5FULA 4QTXA 3QV2A 1XA4A 3GH1A 5IYZA 4DDMA 1SR8A 1Z83A 5BN4B 2GPTA 2A57A 4GZ6A 3UWMA 1JR6A 1A27A 1GTJ1 1P9NA 3GT7A 4IV0A 1X92A 3N1UA 5JRJA 1P4RA 2NV6A 1Z5PA 2VFAA 1X7DA 3WLHA 1YU9A 3I30X 5I8PA 1X3LA 3CX6A 2AR7A 1S7GA 2NZUG 4YV2A 5A3JA 1PQYA 1TFRA 4D5EA 4E6PA 4NKRA 2WP8J 4B71A 1SVIA 2G0AA 2ZI6A 3ETDA 3N2KA 3Q11A 4IAOA 5HM8A 5M7EA 3E53A 5EQJB 2CBGA 3COWA 4NCIA 5D3KA 5FHRA 1A77A 5CDFE 3LCMA 4D80A 2WHEA 5IYZB 3TWOA 4DLTA 3I76A 5L7YA 4OQ4A 1GNLA 4TVKA 2V9ZA 3AU9A 3D6VA 4UFNA 2PUCA 1QKIA 2ECQA 4G5OA 1DWPA 1LKZA 3I72A 3UMSA 5L7TA 2BUAA 3CMCO 2WMOB 2G9QA 2VO1A 3FMGA 4Q37A 1H8ED 3UC5A 3AV3A 3DAFA 4LOKA 2QBYB 1DC5A 4XUCA 4EY5A 2C42A 5B2EA 5JWOA 4ZP1A 3BMQA 3ZK7A 3CVWA 4H7HA 3DWEX 4ZO4A 1I4WA 2IDJA 1H2YA 3BCSA 4J7UA 1UUFA 5F7ZA 2VDLB 5IK2D 2XRFA 1O57A 1N6NA 1X1TA 2HSEA 5JC1A 3LXXA 5LDDC 1RXCA 3ETHA 3PQ2A 4NF2A 3W6PA 5HZHA 1XU7A 1V5WA 3PFBA 4GI1A 2OGWA 3WOVA 5FUQA 2H63A 2H1VA 3LQYA 3GUHA 3H16A 3M4JA 1O95A 2CHUA 3GCGA 4PO1A 4WJZA 4WWHA 2EIHA 1KEWA 4Z1MA 2VHXA 2QSUA 3LG2A 4DNOA 3A06A 4Y8VA 3C6YA 3SI7A 3DV2A 4K2AA 2PKYX 4C29A 4UOQA 3PCTA 4A4DA 2SBTA 1BXZA 2VDVE 5D01A 1YR6A 1Q3KA 2WA1A 4R1PA 1BCSA 3ZY2A 4WE3A 1EFHA 2CVOA 2R7NA 2P2DA 3BZWA 4WCFA 1EBUA 1WJGA 2BM1A 4INZA 1NSYA 2IZZA 2BFCB 2NTYC 1SC3A 4PYKA 1YB1A 2DBVO 3F2VA 4TSKA 4ICIA 3V4FA 2D2VA 4B7XA 5A9SA 5K8IA 1FMFA 4FEEA 3L7YA 4EYEA 2C3YA 2I8LA 4JBNA 4PW0A 1X74A 1FLVA 4TYQA 2Y2UA 3OT1B 1MG5A 4XJXA 2HX1A 2CF6A 4B9EA 5AUPB 3LHSA 3QWFA 1LBQA 2PRKA 3PC4A 2XGGA 4GH5A 3H8WA 1M1ZA 5EP1A 9MHTA 3KQVA 2IPOA 3QBEA 1VCIA 3KHSA 1ZNZA 3D5QA