4OXWA

X-ray structure of a designed cisk-px domain
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
106
structure length
106
Chain Sequence
MKVSIPDFEKEGEGKSKHVMYKIKVKTGGEEWAVYRRYSDFYWLHKKLQQRYPELVPELPPKKWIYSALDEQILEKRKQGLEKYIQRIVSHPVLANDELVVSFLQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords designed CISK-PX domain
publication title X-ray structure of a designed CISK-PX domain
rcsb
source organism Synthetic construct
molecule tags De novo protein
total genus 30
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2014-02-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1520.10 Alpha Beta 2-Layer Sandwich PX Domain Phox-like domain 4oxwA00
1OCUA 4HASA 4OXWA 2WWEA 4PQOA 4P2JA 2REDA 3IQ2A 1XTEA 2REAA 4IKDA 4IKBB 2ETTA 4IKBA 3HPBA 4ON3A 1OCSA 2I4KA 2YPSA 2V14A 2RAIA 4PQPA 3FOGA 2V6VA 1KMDA 3P0CA 2CZOA 2RAJA 2AR5A 3LUIA 2RAKA 4AKVA 2DYBA 3HPCX 4PZGA 3DYTA 2CSKA 1KQ6A 1GD5A 4AZ9A 1O7KA 1XTNA 4P2IA 4BGJA 2L73A 1H6HA 2IWLX
chains in the Genus database with same CATH superfamily
1OCUA 4HASA 4OXWA 2WWEA 4PQOA 4P2JA 2REDA 3IQ2A 1XTEA 2REAA 4IKDA 4IKBB 2ETTA 4IKBA 3HPBA 4ON3A 1OCSA 2I4KA 2YPSA 2V14A 2RAIA 4PQPA 3FOGA 2V6VA 1KMDA 3P0CA 2CZOA 2RAJA 2AR5A 3LUIA 2RAKA 4AKVA 2DYBA 3HPCX 4PZGA 3DYTA 2CSKA 1KQ6A 1GD5A 4AZ9A 1O7KA 1XTNA 4P2IA 4BGJA 2L73A 1H6HA 2IWLX
chains in the Genus database with same CATH topology
1OCUA 4HASA 4OXWA 2WWEA 4PQOA 4P2JA 2REDA 3IQ2A 1XTEA 2REAA 4IKDA 4IKBB 2ETTA 4IKBA 3HPBA 4ON3A 1OCSA 2I4KA 2YPSA 2V14A 2RAIA 4PQPA 3FOGA 2V6VA 1KMDA 3P0CA 2CZOA 2RAJA 2AR5A 3LUIA 2RAKA 4AKVA 2DYBA 3HPCX 4PZGA 3DYTA 2CSKA 1KQ6A 1GD5A 4AZ9A 1O7KA 1XTNA 4P2IA 4BGJA 2L73A 1H6HA 2IWLX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OCU A;  4HAS A;  4OXW A;  2WWE A;  4PQO A;  4P2J A;  2RED A;  3IQ2 A;  1XTE A;  2REA A;  4IKD A;  4IKB B;  2ETT A;  4IKB A;  3HPB A;  4ON3 A;  1OCS A;  2I4K A;  2YPS A;  2V14 A;  2RAI A;  4PQP A;  3FOG A;  2V6V A;  1KMD A;  3P0C A;  2CZO A;  2RAJ A;  2AR5 A;  3LUI A;  2RAK A;  4AKV A;  2DYB A;  3HPC X;  4PZG A;  3DYT A;  2CSK A;  1KQ6 A;  1GD5 A;  4AZ9 A;  1O7K A;  1XTN A;  4P2I A;  4BGJ A;  2L73 A;  1H6H A;  2IWL X; 
#chains in the Genus database with same CATH topology
 1OCU A;  4HAS A;  4OXW A;  2WWE A;  4PQO A;  4P2J A;  2RED A;  3IQ2 A;  1XTE A;  2REA A;  4IKD A;  4IKB B;  2ETT A;  4IKB A;  3HPB A;  4ON3 A;  1OCS A;  2I4K A;  2YPS A;  2V14 A;  2RAI A;  4PQP A;  3FOG A;  2V6V A;  1KMD A;  3P0C A;  2CZO A;  2RAJ A;  2AR5 A;  3LUI A;  2RAK A;  4AKV A;  2DYB A;  3HPC X;  4PZG A;  3DYT A;  2CSK A;  1KQ6 A;  1GD5 A;  4AZ9 A;  1O7K A;  1XTN A;  4P2I A;  4BGJ A;  2L73 A;  1H6H A;  2IWL X; 
#chains in the Genus database with same CATH homology
 1OCU A;  4HAS A;  4OXW A;  2WWE A;  4PQO A;  4P2J A;  2RED A;  3IQ2 A;  1XTE A;  2REA A;  4IKD A;  4IKB B;  2ETT A;  4IKB A;  3HPB A;  4ON3 A;  1OCS A;  2I4K A;  2YPS A;  2V14 A;  2RAI A;  4PQP A;  3FOG A;  2V6V A;  1KMD A;  3P0C A;  2CZO A;  2RAJ A;  2AR5 A;  3LUI A;  2RAK A;  4AKV A;  2DYB A;  3HPC X;  4PZG A;  3DYT A;  2CSK A;  1KQ6 A;  1GD5 A;  4AZ9 A;  1O7K A;  1XTN A;  4P2I A;  4BGJ A;  2L73 A;  1H6H A;  2IWL X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...