4OY3A

Crystal structure of the helicobacter pylori mtan-d198n mutant with s-adenosylhomocysteine in the active site
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
230
structure length
230
Chain Sequence
GQKIGILGAMREEITPILELFGVDFEEIPLGGNVFHKGVYHNKEIIVAYSKIGKVHSTLTTTSMILAFGVQKVLFSGVAGSLVKDLKINDLLVATQLVQHDVDLSAFDHPLGFIPESAIFIETSGSLNALAKKIANEQHIALKEGVIASGDQFVHSKERKEFLVSEFKASAVEMEGASVAFVCQKFGVPCCVLRSISNNADEKAGMSFDEFLEKSAHTSAKFLKSMVDEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the Helicobacter pylori MTAN enzyme reveal specific interactions between S-adenosylhomocysteine and the 5'-alkylthio binding subsite.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Hydrolase
molecule keywords Aminodeoxyfutalosine nucleosidase
total genus 87
structure length 230
sequence length 230
ec nomenclature ec 3.2.2.30: Aminodeoxyfutalosine nucleosidase.
pdb deposition date 2014-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4oy3A00
5F78A 1JDTA 3OPVA 1ECPA 2A0WA 1V3QE 4YMLA 1A9RA 3BJEA 3DDOA 4WKBA 1PF7E 4MCIA 5K1ZA 1V2HE 3FOWA 1RXSA 4P54A 1T8WA 5B7NA 4MCHA 3QPBA 1Z39A 4KN5A 5CCDA 3NM6B 3T94A 3OZEA 4FFSA 2QDKA 1K9SA 1RXYA 1Z5OA 5CCEA 2QTGA 4TXJA 4R31A 3PNSA 3FWPA 1YQUA 5CYFA 2QSUA 3ONVA 3EMVA 4BMYA 3LBAA 5EUBA 4WKCA 1Z38A 3UAVA 4TTIA 3NM5A 3UT6A 4F3CA 2Q7OE 1TD1A 1T8YA 4G41A 1M73E 1PK7A 4QATA 4D8YA 1Y1RA 4ECEA 3DP9A 4F2PA 2RJ3A 2A0YA 3PHBE 4TXHA 3OOEA 1B8NA 4G89A 1PR2A 1TGYA 4PNPA 2QPLA 1Y6QA 2XRFA 4TS3A 3PHCA 5KB3A 1LV8A 1ULAA 1A9SA 4D8VA 4YO8A 5IU6A 1VHJA 4K6OA 4LKRA 3NBQA 3KHSA 4TTJA 2AI2A 3UAZA 3ENZA 3IEXA 4DAOA 2OECA 1PW7A 3KU4A 2QTTA 1T0UA 1CG6A 4DANA 2B94A 4D8XA 4GLJA 5EFOA 4OEHA 1SQ6A 5IFKA 1A9PA 1PWYE 1K27A 3K8OE 4NS1A 2HSWA 1RT9A 2ON6A 3LGSA 3OZBA 4L6IA 1Z5PA 3FAZA 1U1EA 2I8AA 3OZCA 1CB0A 1B8OA 1Z37A 1PR0A 3DF9A 4TYMA 2P4SA 4EARA 2AI3A 4QEZA 1PR1A 1OTXA 3KVYA 3OF3A 3C74A 3EUEA 3GGSA 1NC1A 4DAEA 4BN0A 4F3KA 4OJTA 1JE1A 4JWTA 1VMKA 4BMXA 1OVGA 4F1WA 4L0MA 1ZL2A 4GLFA 4I2VA 4EB8A 1Y1QA 5B7PA 1OU4A 4RJ2A 2AI1A 5ETJA 2GUWA 1PKEA 1V48A 4R2XA 5EPUA 4TXLA 2OXFA 4DA7A 5CYGA 3EUFA 1Z33A 1QE5A 5CXSA 1V4NA 1JDUA 1ODIA 3UAYA 3UAXA 4F2WA 1TCVA 4OY3A 4NSNA 1NC3A 1RXCA 1PR5A 3IOMA 1Z36A 1U1DA 4L5YA 4WKPA 3PNPA 2IQ5A 4D98A 4DARA 3FB1A 3O6VA 1PBNA 4TXNA 1OV6A 4DABA 1U1FA 1JDSA 3MMSA 1ULBA 4M1EA 4M7WA 3LA8A 1RCTE 3EEIA 5DK6A 1WTAA 1T8SA 3U40A 4DA8A 5CXQA 1V41E 1NW4A 3P0EA 5FAKA 2A8YA 3KVRA 3ODGA 4L5AA 5F77A 1ZOSA 2ISCA 3FUCA 1T8RA 1C3XA 1JP7A 1N3IA 4M3NA 1K3FA 2H8GA 4U2KA 1ODKA 4YJKA 1JE0A 1Y1SA 3UAWA 2A0XA 2BSXA 1Z35A 3DPSA 4DA6A 4BMZA 1RSZA 4NY1A 3OCCA 4TS9A 4QFBA 2OC9A 3E9ZA 3OOHA 3MB8A 1SD2A 1JPVA 4GKAA 1YR3A 5F73A 1A9QA 3KVVA 5B7QA 4G8JA 2PGAA 4QARA 4LNHA 4LDNA 4E1VA 1JDVA 1V45E 1Y1TA 4WKOA 3E9RA 4UC0A 1U1GA 5F76A 4JOSA 2AC7A 4LZWA 3BGSA 3BSFA 3GB9A 1ODJA 3P0FA 1U1CA 5F7JA 3F8WA 3E0QA 3SCZA 3KUKA 3K8QA 4PR3A 5F7XA 1I80A 3O4VA 1YBFA 5B7GA 4YNBA 4X24A 1LX7A 3FNQA 1RR6A 4TXMA 4OGLA 5I3CA 1OUMA 5F7OA 1LVUA 4WKNA 4QAQA 2HRDA 2OC4A 1ODLA 1PR6A 1Y6RA 4MARA 5F7ZA 4R2WA 4TTAA 5JPCA 1SD1A 1RXUA 1PR4A 1Z34A 1A9TA 4LNAA 1JYSA 3NM4A 4D9HA 1JDZA 1VHWA 3DJFA 2HWUA 3D1VA 1TCUA 4OGKA 4GMHA 4IP0A 1XE3A 4OF4A 4QASA 2HN9A 1FXUA 1TGVA 1PK9A 3BL6A 1SJ9A 3OZDA 1YRYE 1A9OA 1OTYA 1A69A 4DA0A 1RYZA 1Q1GA 1G2OA 1RFGE 4JP5A 4H1TA 5C80A 2I4TA 3TL6A 4L5CA 3INYA 1Z5NA 1VFNA 1YQQA
chains in the Genus database with same CATH superfamily
1DU4A 5LNK1 4JLNA 3FDJA 5G3YA 4TX1A 5TT0A 4JLUA 3C43A 3SXUB 3BRWD 2WKRA 2A0WA 4K8OA 3OMWA 1HYHA 2XEXA 4JROA 5EUCA 4KFSA 1EXNA 5KO2A 1L7RA 3OE7D 3KQLA 3M3PA 4CGYA 4AQYB 1JHPA 5IZCC 4GQIA 3QF7A 1BFDA 5ALSA 3RAEC 2VJPA 2A6PA 2GEVA 3MRTA 5IK2A 2NSJA 3A10A 4RE5A 4HWRA 4YREA 1KQNA 4EATA 1GQSA 1PO7A 3LUBA 5JCOA 1ZGZA 2D1QA 1XR3A 2H07A 2YY5A 4AKIA 1VPDA 2QT9A 3QMMA 4X3PA 1HMYA 4HATA 4C4AA 1QIGA 2IPLA 3HADA 4JOQA 4RZ2A 1RPJA 3VNSA 1C4KA 3WTCA 5B7NA 2PFSA 1WETA 1M2VA 2YWCA 4UFPA 1H6BA 1U7ZA 3KQPA 3LC0A 5GONF 3I9MA 1KDZA 1TO2E 3U6KA 3G9XA 4G5OA 2DBVO 2O9JA 1SCUB 1CV2A 3AH8A 4JFRA 4E4TA 2R6HA 3LY8A 1U0FA 2I3DA 1XDWA 3OZXA 4LGMA 4FKBA 3AW8A 2NU8A 4BRZA 5JC8A 3CEAA 3HN6A 2YOFA 3U1TA 3W7VA 1TB4A 3RTGA 2JGMA 2VO1A 5KTPA 2P5YA 3TGLA 2B7BA 2ZBPA 2ZWAA 5JARA 2YS7A 221PA 2GESA 3CNLA 1QDLB 3SDSA 2XKKA 2PO7A 2QPOA 2DHRA 4Q9NA 1JGTA 3PJDA 5D86A 4I1SA 4DL9A 1N2EA 1R66A 2QRHA 1KI8A 4EKNB 4AQ7A 2OOKA 4FDMA 3HUTA 1FUUA 1DAHA 1OT5A 4ZEVA 1EGHA 3GVIA 5EWJA 2Q2VA 2C7BA 2C58A 4JGIA 3TLYA 1DADA 5K09A 2I7VA 4IZ6A 5DX1A 3S0JA 1G8SA 2IGBA 3DZBA 2O8DA 5CNKA 1RHQA 4RD2A 2IS2A 3RV3A 3FGPA 2OXRA 3H4MA 3OU2A 4C7KA 5CEJA 1VTKA 2RIRA 4IM7A 2FX5A 4HRAA 1NQTA 3CJRA 3U3RA 1TZ2A 2IH5A 3E05A 4OREX 2O8NA 3P2OA 1DARA 1I6KA 4QYMA 1XZDA 2LE0A 3UK2A 1OI3A 4Y9DA 1CCWA 1ZN2A 3D0QA 3T7DA 4CKCA 4ZCRA 1LNZA 1TRHA 3EXHB 3INNA 1R4ZA 2IXAA 4KGZA 4O4HF 5LCXA 1XVIA 3C7KA 1Y8AA 3E9DA 4J2TA 2O54A 4E2ZA 3LM8A 1S2NA 8MHTA 3HGQA 1QGZA 2ZI6A 3PHJA 4OQXA 2B6NA 2HK8A 1EE2A 2QAGB 4U02A 3WLTA 2Y1EA 4O5AA 1Y6QA 1YRLA 4ZOEA 1AZLA 1Y9JA 5KMGB 1B0AA 1ZWKA 2H52A 2OILA 2Y67A 5HIMA 1JLSA 1KJ9A 4GLBA 2QKYA 5E2IA 3QE2A 3VRHA 2B30A 1IBMB 1QHNA 2NTVA 2V7EA 1G19A 1T0IA 2GPWA 4EG3A 5HNKA 3KL2A 1J8QA 1NUAA 2P6PA 2I34A 4OOEA 4IHAA 4R9SA 1VHJA 3OLYA 3R20A 3NR2A 4GR5A 5P8WA 1PHRA 5JW6A 1NTOA 3TD9A 1SKYB 2EYQA 4FM9A 3ANLA 3B3AA 2V1XA 2YUTA 4YXWA 3E22B 1UDXA 3AEUA 1E3IA 2GM9A 3E70C 5ESXA 1J6UA 3I5YA 2POCA 1XP5A 1PX0A 4L72A 3G5MA 3JTEA 4AF7A 3GLGB 2V1UA 3FSRA 2P6NA 1N1MA 2VDJA 3FROA 2VEOA 4OB6A 4QX6A 3WZMA 1GIAA 1BVYF 1EVZA 1GA6A 1MJFA 2FF5A 3BFKA 2ZANA 2P9EA 2VKTA 3O03A 4KO2S 5F2KA 4DR7B 5DCWA 4YRZA 2ZGVA 1N4DA 3MA0A 1KSHA 3AJEA 1YR2A 3CZCA 2VDRB 5DMHA 4FB4A 1KDPA 2EZ8A 3OQOA 4AS1A 1CQXA 1CY8A 4TMTA 3VYTB 5K6RA 1NV9A 3O1HB 3UK6A 1I4OA 1KTIA 2GD2A 5ER9A 2EW8A 3ZCVA 4YP0A 2XXJA 1GG9A 4DZTA 2BLNA 2WP8J 2JCVA 3A6KA 4Q4CA 1X15A 1WLSA 2AC4A 3ETEA 3HKBB 2MYUA 2EF0A 4JD5A 3RQSA 3LGSA 4I9NA 3WADA 3ZK7A 1Z5PA 4W1SA 3TVYA 2O3RA 3TR6A 4LRQA 2JLXA 5JJKA 2V9ZA 2ZIUB 2L2QA 4MRNA 1Y6GA 5L3RA 1NU6A 1ZBDA 1P73A 1PR0A 2COKA 1PEAA 4CHGA 4YI5A 1KXJA 3F7TA 3RRXA 4RD1A 2AG5A 3PR2B 4F46A 1Y8ZA 3G9TA 3WZLA 1OU0A 2QNRA 3D3WB 4REMA 4TMWA 2O7NA 2BMJA 3GA5A 4FLFA 1R0SA 2IZOA 4PM4A 5HUQA 1LS6A 1IOVA 1VHDA 1SVMA 4XVUA 4DCUA 3JALB 2SCUA 1PJTA 3H7AA 3RAJA 5FFFA 2ZJYA 4YMWA 1TQ6A 2BCEA 2FSUA 2YYZA 3AO0B 5JZMA 5F9HA 3LK7A 2GCPA 3UJ7A 4Z54A 1N0UA 3LWZA 3RBVA 4E11A 2IP4A 3D81A 4NDAA 5G53C 4UU0A 5MFZA 1ONOA 2AIRA 2GPBA 5FA6A 4BFLA 5CFLA 3OICA 3BM5A 4EPWA 3R6GA 4KHZA 1ONSA 3W2HA 3VI4B 2JBWA 4DIBA 1GPH1 2YXNA 1CUHA 3Q3JB 2IODA 4MQUA 5AW4A 2OEPA 1YFLA 5MGNA 4AUNA 3E81A 1HEIA 1NF2A 1AKQA 3RRJA 4BEVA 1DFHA 3FLMA 3G2HA 3KHTA 1YHNA 3QMPA 4IR7A 4WN9B 5DTIA 4PTLA 4PRLA 1X87A 3OPQA 2MMGA 3KZOA 1VMKA 1LU9A 5J1TB 3T61A 2J0EA 5CGZA 2JI7A 3REQB 4CLOA 4KWEA 2HU5A 4FUTA 4PLHA 4LYJA 4BLOA 2RHCA 1QQ6A 1RACA 4IFBA 4M8IA 4N9QA 5C46F 1WV0A 4JXZA 1KYVA 2I6GA 3AR5A 4TQUS 5HK8A 1C0IA 3TD2A 4DSZA 3HFRA 3UBTA 2AFIB 1V2GA 3SQMA 2B92A 1Z15A 1G8KA 3CZMA 4Z51A 1X39A 2EBWA 2YIMA 1O97C 3AGPA 4MV9A 1U0EA 3W3AA 3VDXA 3SU8A 1LS1A 3VZBA 4E32A 5A4AA 4QG3A 5K99A 1VKNA 1RJEA 2JIMA 3TCXB 4B6FA 3GLFE 3ABSB 3EBOA 2JLYA 3EAFA 1N5DA 3A8TA 2ZBUA 2QW1A 4Q4AB 5G40A 1YBHA 1SVNA 3QM1A 2YWRA 2F3UA 1CT9A 3ASZA 3ADOA 3V97A 3DV9A 7REQA 5JMTA 1SVWA 2I4IA 2HA3A 5BSRA 4FE3A 5UKDA 4RBNA 1CERA 3DWEX 3JPWA 3P4XA 1T0BA 1YS4A 1N9ZA 1ZBQA 1JJVA 3KQVA 2YWXA 4M1OA 3WWZA 3ZDDA 3HXMA 5C4MA 3H5IA 3ZWXA 4RYDA 3HCPA 4U8HA 5DASA 1ZR2A 5L7TA 1H9AA 1QYWA 4PRKA 4WZZA 2WYUA 2H17A 4TV8B 4FS8A 5JNWA 3H6HA 1OFIA 3LOUA 3I52A 1C4XA 4ETWA 1XZPA 1BOFA 2C9BA 4H6VA 2IZ6A 1SHTX 4FFVA 4QLBA 4TL9A 4NBLA 1E3DA 2ZM5A 3PPWA 1ESNA 3NBZC 1E1MA 3AQIA 4Q15A 5LWHA 3CGWA 1XD8A 2AX3A 2I4LA 3AF3A 1VFPA 2F9FA 2FSVC 1EX1A 1X1DA 3EGXA 1G0NA 4Y1FA 5HMLA 1X7YA 2O3JA 2P2NA 4NXMB 4LGCA 1E59A 5IUKC 3MOGA 2VT3A 3DL2A 3RFTA 2FWRA 5BSEA 1QIKA 4DEXA 3ITKA 1Y89A 1MC8A 3PGA1 3HRKA 4C5CA 5DPMA 2BFOA 4I9GA 3CUYA 4EW2A 1X1TA 4V39A 3U40A 1KJZA 5C4IA 4WNYA 1GAEO 5E0KB 3LH5A 4FNMA 5TQ0B 1M34B 1JBQA 2B8WA 5D85A 4BFTA 2Z56A 3CLRC 1XYYA 3BXFA 3TQSA 3THWA 3USCS 4G07A 5DHFA 3SFTA 3MWYW 3VFDA 2Y99A 3AEUB 4Z8XA 2YJ5A 1V41E 3KZVA 4F11A 3DHVA 1MO5A 1NW4A 3CCFA 2CFOA 2MMCA 3JZDA 1OOEA 1IEVA 2AJBA 3R44A 3VOTA 3TLAA 3KS9A 4KBFA 1GUYA 1O9HA 3PGJA 5EYPA 1ZEJA 3M49A 4G3XA 4GE3A 1XMJA 5T3UA 4DLSA 5AVSA 2Y1OA 3IMFA 1DAPA 3QE0A 1AUVA 2C2OA 3FUCA 4C7OA 5B2EA 4RLQA 3GRUA 4CUJA 2PG3A 1C3XA 2HQ1A 4TTRA 2WD8A 1DMRA 2QRQA 4C0SA 5A5VA 4YLYA 2O5CA 2NIPA 2PBFA 3FDXA 1SKMA 3ONDA 2ZIGA 1Q21A 1CS0B 2PUGA 3EIFA 4UW9A 2WJZB 4W7HA 2BAGA 2NZVG 2A5YB 5TXGA 3UAWA 4NWIA 4I1IA 2VSNA 1EFRD 3BIWA 2V7BA 4TV8F 1DKQA 4RVNA 1DRJA 2VQSA 3PC8A 4OQLA 1X42A 1EUDA 2BSXA 3H65A 2ZJ4A 5FUVA 3IAFA 2AFIE 5BUQA 2V5AA 1K4MA 3F0TA 2P9GA 1L4KA 3AFIA 3AKCA 1Z0AA 2XWJI 2CKMA 2GWRA 3C16C 4GZ3A 1AKWA 1Z7GA 5JD5A 1P2GA 4IX9A 5EGSA 4IMPA 1DUVG 5IJWA 3N07A 4N7BA 3MB8A 3UJAA 1Y0BA 1SD2A 3BK1A 5E6SB 2EX4A 2NO7A 2ZSIA 3V3TA 2HHAA 3O8OA 2UYGA 5FCDA 5KNDH 2AOVA 4PZZA 2W9XA 4BWFB 3SM3A 5H5JA 3C6YA 3BC1A 5LLSA 3LKVA 4LVOA 1JDPA 3QFFA 3VVCA 4B87A 2QAGC 1OHHA 1XQ9A 2PSHA 3HKDA 4BYMA 1QH0A 3TX6A 1HDIA 1EM8B 1RWPA 2ZTUA 2A58A 2ONZA 4G1BA 3PX2A 3MJCA 4WXHA 4ARZA 4KO3S 5BO5A 3T3EA 4WKOA 4ER7A 3BWXA 4EVQA 3G0HA 2F9MA 1U1GA 2FOLA 3BRCA 3OMXA 4IJ5A 4EMBA 3U44B 3RK4A 4LF6B 1G55A 1U7WA 2DUJA 2P5TB 1MA3A 4IH4A 4UTXA 4QU8A 4D9MA 3KEFA 1QQBA 2AG1A 5DOZA 4F38A 2O8FB 4Q12A 5C7IO 1I1OA 3CA8A 3OQIA 3PNLA 2XIQA 3Q3VA 5ERYA 3BQ9A 3SXJA 1EX9A 3AFOA 1QTQA 4KDEA 4ESVA 1JF8A 1R5JA 1YR7A 2X22A 3BXOA 4V3CA 5JXIA 2R68A 3AIIA 2QX9A 4N0QA 3W7BA 1DOHA 1L3CA 3OOSA 5H3LA 2JAHA 3TNYA 4X1IB 4JOCA 5AJWA 1P9WA 3N0TA 1SBZA 4N47A 4D8WA 3MJHA 2BMVA 5JR3A 4H1VA 4JU9A 3MCAA 2I2DA 5ESWA 3YASA 1P33A 3U7QB 4P80A 1QRSA 2X40A 2PS0A 3IQGX 2NO5A 1PK8A 2H00A 4WCFC 2CK3A 1RWVA 2PKQO 4Q18A 1IAVA 1XZQA 1QMGA 3K3PA 4MYRA 3WLAA 2IEIA 5EIOA 1UKZA 4Q34A 1Q12A 3JWHA 1L8LA 1P44A 1NGSA 1PWZA 4A6DA 2G9VA 3HS3A 5D51S 3D2CA 7REQB 4NPAA 4FSHA 2BE9A 2O0MA 2QRLA 3QW4B 3OQPA 3ITNA 4L9WA 4W9NA 2CV0A 2NO6A 2VWQA 1ZUNB 4MULA 3ZS8A 1MAUA 3HEBA 3OU6A 3PZBA 1FP1D 2BHTA 4X93A 2IE0A 3PYMA 5E6RA 1JEDA 1K88A 4KXNA 3RRNA 1FDOA 1Z4KA 2GB4A 4PZDA 1V8DA 4K2AA 2ISSD 5TC4A 3LBNA 4D9IA 3GLFA 1QVAA 4Q03A 1QYDA 5DTJA 1GZ3A 2J85A 3BQMB 1YL7A 4Y6QA 3KZXA 4HN4B 4JASB 4J4TA 4ZT6A 2L19A 1Q77A 1ID8A 4KGVA 4KR2A 4IP0A 4F7DA 2I2AA 3A3YA 3H2BA 5HF5A 4HVAA 2NZUG 1BD4A 5EA2A 3U0BA 5IRCD 2ZDGA 2JGDA 4CM1A 4MJ7A 1ZH8A 4BXOA 3KDSE 5L3QA 2D06A 2C78A 3IMGA 2G1UA 2AUNA 3STTA 3D43A 1A9OA 1JXMA 1SBHA 4CJXA 3H2ZA 4RVDA 2P41A 5HCNA 1BQ3A 1NVXQ 2QQ0A 2LW7A 4HKTA 1RYZA 4PAQA 1Z8NA 2PD4A 3GRYA 4H7JA 4QYSA 4P0PB 3BYZA 4DY4A 1VYVA 5ICMA 2WJWA 1LRJA 2QN6A 4C3ZA 2GF9A 4RTKA 5DSTA 4M8SA 4KTTE 1NF3A 1RI4A 2PRYA 2C07A 1C7IA 1K9VF 3DMTA 4PNZA 4PHFA 5KDLA 5JNVA 1R6VA 4WDQA 1LBQA 4C3VA 1HFKA 4U5QA 1E94E 1KSFX 3RVBA 5CDUA 5HR5A 1ATZA 3T1YB 4CG1A 1YQQA 5AK4A 1Y8QA 2P2YA 5HUHA 5JAZA 1QKJA 1X1RA 2Q28A 1DO8A 1P80A 2VN8A 4NJEA 1YI1A 3DF7A 2D8MA 3KKMA 5A9TA 4I1PA 5IJAA 3CNHA 2JDID 3CVOA 3JS5A 4NK5A 3B3FA 2W6JA 3R3XA 4YRPA 3PRHA 3T9CA 3JZMA 4S1OA 2E2WA 4ITUA 2FEMA 3DDHA 6LDHA 4L8FA 5BOSB 3KXKA 5AXCA 1KERA 4X1IA 3WLFA 3V1UA 5CH3A 1EHIA 3P2JA 1ZWLA 1L5FA 2H92A 4WN9A 2JBHA 4TN5A 4BE4A 3S3TA 3QUBA 2P6UA 3SF8B 1N34B 4FLEA 4JBWA 1KKMA 2J4FA 1RC1A 4URWR 5EHZA 3NEPX 1ZESA 1G4UR 2J7KA 3LDHA 1RZRA 2AN1A 3P19A 1I7LA 1C2TA 1WPXA 2XCUA 5F3DA 1R74A 3ZI7A 4M9UA 3K0FB 1D2GA 3I2HA 3OETA 5I9LA 3LSYA 4MDHA 2Q1UA 2PZJA 3CPJB 2WUGA 2O06A 3CG4A 3KQWA 2FOIA 2I6SA 4L4UA 4P4SB 3W5IA 3FYHA 2D4AA 4QUKA 1Q20A 2KW5A 5FBLB 1I5OA 1UPTA 5CB8A 1QQ5A 3EBPA 5BVGB 3HLKA 3I9KA 1DAEA 4N49A 3SQOA 3IKVA 1NQOA 1QQAA 4BTVA 4FWBA 3LBFA 1D2RA 4RENA 3AHEA 1CUSA 1MXHA 2BOVA 4RK4A 3ZTWA 3TLMA 4NNPA 4TZ0A 4KPYA 2V4ZA 1QGYA 1T2CA 4CODB 2CMFA 5ERGB 4JVNA 4LE1A 4P7FA 3F5FA 3PE3A 4F5WA 1B6TA 3ESDA 2ZPUA 3H1PA 4ZC8A 4J75A 4YP5A 3B5IA 2VF5X 1BEZA 2PZLA 3EXHC 3BVPA 3I8SA 4YR9A 5ES4B 3IQIX 4BWYA 3ZHZA 1NKTA 4NDNE 3S8YA 4H6PA 1ZGAA 2MINA 2JIRA 3FNRA 1Y1RA 2QTZA 2VHQA 1TT7A 1OIXA 3CU5A 2XUOA 1JAXA 1GTSA 4P34A 2GCEA 3C24A 2A7XA 1TQ2A 5LOVA 4ZYXA 4L4YA 4AAYA 3OIGA 4EY8A 1U6JA 3T9AA 3LYUA 2A0UA 2IOYA 4R2IA 1EA7A 2G9RA 2CMDA 5E2BA 2IXFA 3TBHA 3TNDA 1GKKA 2B99A 4BNYA 1LH0A 1USVA 2OZEA 5FOSA 4CG0A 4PS1A 4C6RA 4EZEA 1KE2A 2AWNA 3OZWA 1M1XB 3QJ5A 3NHMA 1ZGBA 5J4VA 1M2JA 2HLHA 4ASUD 3KKKA 1AJEA 1G63A 2UU9B 1RQ2A 2E4XA 1ZHOA 2VLIA 3MTBA 4XWAA 2Q1WA 3UQZA 1G2IA 1LW7A 2OMKA 1VMDA 3G0IA 4XPIA 5I7WA 1Z6ZA 3WA6A 1YMUA 4IL5A 1LDMA 4KLRA 3LLCA 3Q12A 4MV6A 2ECFA 2CMKA 3CSDA 5DW0A 2IIPA 1ZM4A 2WTBA 3IQZA 4W7SA 5IU6A 4B75A 4A15A 1B7GO 3B5EA 3ETHA 1JIXA 2OORC 3EPLA 3OTWA 5LZ2A 3ESXA 4DMLA 2WIJA 3UAZA 2Y77A 3NGMA 1K6MA 3ZI4A 1ZM9A 4LXQA 4M0LA 3B1KA 4NULA 4XB6B 4AJIA 3LVQE 1GKUB 1OFHA 4TSFD 5HP4A 2X0NA 2VK8A 5D3KA 3E3MA 1U63A 3KU4A 3NZEA 2VZLA 4TQ9A 4RM3A 1YULA 4IJMA 3W8NA 2AH5A 3DEFA 4DLKA 5AW7A 4RV4A 2FDCA 2ZXFA 1ZS9A 3DJYA 3EHDA 4D9BA 2PV7A 2WF7A 3IHKA 4KN6A 5DSZA 5ILGA 3BF8A 1GQFA 1LTKA 2BP7B 2F8SA 1RBMA 1NJGA 3IEVA 5CB4B 1G7TA 4NCXA 3D6VA 1DBQA 3FR7A 4R0VA 1KMQA 1LSUA 1N2SA 1ZIPA 4LHXA 4GWGA 2QWXA 4I36A 3VAYA 3CRW1 3H2JA 1RKQA 4RU1A 4PXSA 4B6OA 1QOPB 5IAJA 2JHAA 5DE3A 2O48X 2X1HA 2PQ2A 2ZRKA 2D0IA 2L42A 2HQOA 4U4AA 5GWXA 2AN9A 1B8PA 2BN4A 5C0OE 4KIJA 5CT6A 1W5SA 1S1CA 3AEZA 2WVHA 3E7FA 3KC2A 2M6KA 4D3FA 3ZHYA 1ICEA 2P3LA 3B1FA 3DE6X 4LYAA 5DOVA 5ERXA 4ZKEA 4E7PA 1S0UA 2I33A 1QPGA 4MW5A 3F67A 5B4TA 2ORED 4D0SA 3H5RA 3EHEA 4WFQA 5BN5B 1OX4A 1R0CA 4QBFA 5E1OA 1OTXA 2GO1A 3KO8A 4JQZA 2CLLB 5B1SA 4E5DA 5IFLA 1B23P 3CKMA 1C1YA 5A5DA 1HO3A 5HE8A 2CJPA 3D8SA 4XZ3A 3SC3A 1D8AA 2B5OA 3QH4A 3T7IA 1IBRA 5DGIA 4LY3A 3RW9A 3A2NA 2W93A 2G88A 2F9LA 3V4FA 2V6IA 4KHPB 2ECQA 1KRXA 4B46A 3RVLA 2LCFA 4XX0A 4D43A 3KYDB 1ZGJA 5ALYA 4H0FA 5D1HA 3B8HA 1CR0A 1V35A 2HGZA 2VP4A 3P9ZA 1R8QA 1C1HA 4KXXA 1AK2A 4P3OA 4CKWB 4PIMA 1G6OA 4Z9BA 2JJ8A 3V1KA 4MUYA 1RKBA 3PEEA 1KZGB 1THTA 1PWEA 2IEYA 1HSZA 4TT3A 1KJYA 1M6YA 1GPMA 1REQB 4QTXA 4UDXX 5ALKA 3W9BA 1K4YA 4S0XA 4DPLA 1N9KA 5FBHA 2YUIA 3SPXA 1F8XA 4C08A 2FPLA 4G4SP 2GBIA 2Z2KA 2ZTMA 4OYRA 4PYMA 4LQLA 1ZN9A 1B2LA 2WG2A 2JLRA 4X91A 3ZD8A 5ALVA 1JV2B 3VR3D 3D6UA 3QKIA 4FMDB 4MLDA 1RS0A 4RGBA 4Q3BA 5FOWA 4YRMA 2FF7A 3I2YX 4ZT2A 1N5IA 1TAQA 5G1OA 1CIJA 4B6PA 4QDOA 3PR1A 2Q07A 5AI8A 2PSJA 3V4SA 4DREA 4DQXA 4WHMA 3TRFA 1W19A 3HWRA 5EUQB 3DGEC 5FUXA 4AJEA 3R5JA 5F9MA 1GPNA 1OASA 2WWYA 1Z6GA 1NA5A 3GELA 3LMKA 1OBOA 1JQ3A 4OQFA 5H80A 3SYLA 3BRWA 1V7CA 5HIKA 3ICQB 3IILA 2R751 2VUHB 4INJA 2OBFA 1PAUA 1U7PA 4PWZA 2K6GA 1G3QA 3LPMA 4RK1A 5CPBA 4JP8A 4ADSG 4R4JA 3SLRA 2FPGB 4AZ3B 2UZIR 1RAFA 3AQ4A 4C7JA 1JAIA 3PYLA 3QBDA 3R0QA 5DHSA 4EM6A 5CFPA 2L18A 1FNBA 1QE3A 1VM6A 2GZAA 4AW9A 4M0FA 3ZW7A 5I6DA 2GK4A 3S1AB 4JKOA 4RK6A 5JZVA 1FQWA 3B13B 5IKXA 1XDZA 2QTHA 5BNTA 4KB5A 2IHVA 4MXDA 1Z36A 3KEGA 4Q7JB 3UGJA 1VYTA 4MAAA 2I54A 1W6UA 2ZRCA 5FPQA 5LDGA 4EUSA 3LUKA 3N7TA 2WU4A 1GNLA 1RDFA 3U48A 5D5PA 3GNTA 4QOJA 4TVOA 3KTDA 4X7PA 4ALJA 1UPXA 4OUDA 5EE1A 3DOJA 3T4PA 5IW8A 1GTG1 1SUPA 3SOZA 4HTFB 1FYFA 2Q3JA 2QI9C 2ZUCA 4MUGA 5AW6A 1XROA 1CVIA 1DHRA 1Y3FE 1ZUNA 4XEHA 3RUPA 4ZQHA 1X19A 1A9XA 5THXA 3N2EA 2X9LA 5DK6A 2HT1A 1NFFA 2VRNA 4DJEC 2WIGA 1ENZA 3PUXA 3WK8A 3N86A 2ZYIA 2RKWA 4FCCA 3MWLA 2J5RA 4JIMA 2I87A 5CLLA 1BWSA 5KKCA 5M34A 2XODA 3IRVA 3E7WA 4EKIA 1TF5A 5A0FA 5T4EA 4PHGA 1NBHA 4ARVA 3ANMA 4FX2A 4QULA 4WGFA 1WBBA 2X8JA 1G5HA 1PNTA 3BMQB 1EUYA 3TXXA 1JW9B 2ATCA 3UMVA 1G6HA 1CETA 2BHSA 4P35A 4MJXA 1OI4A 3KOXA 1MG5A 5LVAA 2Q3CA 4AZVA 3DMHA 1LRKA 1MNAA 1BMFA 2QIOA 1DTSA 1E20A 2Q6LA 3IELA 4F93B 4CQJA 3G1UA 4GSLA 3A0UA 3L8EA 1L7EA 4ZREA 3ILXA 3I0NA 3UXYA 2XNHA 1F6WA 2H4HA 2Q9BA 2XUJA 2OPHA 3QPWA 1F38A 1KRHA 2R79A 1NHGA 1UJBA 2RHMA 3BD8A 5FA5A 4JLDA 1UAGA 4URVR 1RYHA 2OFFA 2LD4A 2M9MA 1BFUA 5TPWB 3DOEA 3ONNA 3NHSA 4PGFA 4PLZA 4CLHA 3T7RA 1YDMA 1TW2A 3DTVB 5CA1B 2Z09A 4ZYTA 3CVVA 4DR5B 4IF4A 1ODKA 3GVXA 1Z0JA 3RYIB 2Z0MA 4XB2A 4I9FA 3E2PA 1E2FA 1ZI8A 5AHXA 5HZMA 1JT9A 3T99A 1CIVA 1NLMA 5M29A 3DHNA 4JJZA 2O52A 3KB6A 4WUTA 2QMQA 3KL4A 3OFKA 2B9EA 2RE8A 1BDHA 2HGSA 4JQSA 1E6KA 2X4GA 1YBAA 5EESA 5FPHA 3MT9A 5B1IA 4XYLA 3IUMA 3PQ8A 2ID4A 2A1TS 3VI3B 2OPBA 2RK4A 2PX8A 4MJ3A 3I09A 5CVVA 4G1FA 2YRWA 4JLBA 3JQBC 4NY1A 5JT1A 1SG0A 3CX7A 3L7CA 4CLEA 4RKQA 4Q4JA 2I99A 3QWIA 3KR1A 4O59O 1XNQB 3EEQA 3GNSA 5HS4A 3HVIA 4MCJA 1U9IC 4XWOA 2O4CA 1RQGA 5KOIA 2AX4A 4HR7A 4BTLA 2JHCA 2OFWA 5H7XA 1TPYA 2ZYVX 1H1TA 4LQDA 4DMMA 1U3GA 2BEWA 2WD9A 2XMZA 1NY6A 1J06A 3NHKA 1UDBA 1DJQA 2JK0A 1RXIA 4KR0A 4HWKA 1M66A 4D9JA 4LF5B 2FPIA 2GEUA 2O8VA 4FI3F 2XH8A 4F3YA 1I2BA 1Z17A 4JL6A 4ZOLA 1HXHA 1P39A 1X9GA 2E4VA 2R84A 4U9HS 1PT7A 3RNOA 5KNDA 6ADHA 3C7CB 5I7SA 4ZEXA 3R8FA 2UV8A 1ABEA 1WMFA 2FP4A 3SDZA 2WE8A 2JFZA 2YVQA 3N3BC 2AC7A 1L4HA 4AWAA 1XN1A 1J0EA 4OA8A 1EAMA 4X95A 3MRXA 1BKYA 1R8JA 1ZOOA 2PRKA 2BV3A 2X3YA 2RHHA 2XBLA 2H1IA 4AX4A 1XJWA 3GCGA 2C42A 4X61A 1FFWA 3MT0A 1IMJA 1UWVA 4Q47A 4M9ZA 1JSCA 2G1AA 4WVLA 4OTZA 5L7YA 3UV7A 2ZRAA 3GFTA 3QU9A 1JB1A 3SS7X 2VZ8A 5BVHB 2DCMA 1QVWA 3A1DA 3ASUA 3NIWA 1OXTA 3O4VA 1MAWA 4MS4B 1AS3A 5B7GA 1C50A 2Z8ZA 1G66A 3U56A 3MELA 1B26A 1BJRE 3G9QA 2D2FA 4FVTA 4NVRA 1U9JA 3HCRA 3SEZA 3C5CA 2B4AA 4JVOA 4LZOA 5I9NA 4JB0A 3EUWA 4HNHA 3RANA 5BSFA 2H63A 5HJEA 4LZNA 1UWKA 1POXA 3ZJTA 1VSBA 2XQJA 4MARA 2FZVA 2CCJA 3BJRA 3BTSA 2BFEA 1SD1A 2WAOA 3MCZA 1NQWA 3NJRA 3AEQA 4D8TA 1DGQA 3NLLA 3R0JA 4FJ1A 4FZRA 4IEFB 4JX9A 4XUCA 3VZCA 1C0EA 3F8TA 4CV0A 4J9VA 4LOIA 2ZKIA 3UOWA 4C2AA 5DULA 3SOPA 3EDMA 9GPBA 1JHXA 1CSEE 4DCOA 5KCZA 4XSGA 3HV2A 2REQB 5JAHA 2DQYA 1GZVA 1R5NA 1VPEA 2C3MA 2JDIA 4L5IA 1UEXC 4OBWA 5NULA 3RVKA 4XKJA 1I2ZA 1KJQA 3I73A 1OAAA 1UBSB 1WPQA 2NZ2A 2R2GA 3AB7A 3EZFA 1HLPA 1I4EB 3DXFA 1XJ5A 2OAQ1 1D2CA 4IVQA 2PTHA 4LJ4A 3L5OA 5FUQA 3GT7A 4XD7A 3NXKA 2PIDA 1PU2A 3AI3A 2C9YA 4FBMA 1G21E 2XCIA 1IHXA 2DPGA 1PK9A 4W1PA 1C8VB 1ND5A 3FMGA 1U2PA 4FW9A 5TQJA 4ZJPA 5L7WA 2VLBA 3ZD6A 1EDOA 3QVGB 5TQ2B 3ASYA 2QMOA 1JIJA 4RJIA 1KEKA 2I3AA 4Y2TA 4YJ3B 1DAGA 1Y8QB 2GLUA 1WF3A 1Z18A 3T4UA 4I0WB 1H4QA 5JDIC 4HNQA 1E4EA 1HTWA 2W6CX 1CUBA 4RF4A 5C8YA 3QGMA 4DDKA 2IY8A 3Q9UA 5CFRA 1TTPB 1RWOA 1ZIOA 5KNCA 4L0DA 3VUFA 2X0IA 4YCMA 1ZCBA 2EKLA 1LBHA 1CWUA 2WE7A 3P94A 5EP4A 1F0YA 1S9DA 2C94A 1HC7A 1UFRA 1G8FA 4MGIR 1NUQA 1WPRA 2A33A 2X9GA 1POWA 2Y6UA 4UDNA 1ZUIA 3ED1A 4Z3KA 4Z4CA 3D7LA 5AW8A 3GMSA 4I7EA 1AQ6A 1PD0A 5L3SB 2VR1A 2I4MA 3ZOKA 3MJVA 1WZEA 4A1OA 3G5UA 4OAOA 5JSUA 1YRHA 4R9UC 3D4BA 2ZYGA 2EYUA 3MTAA 4UJ3A 4J43A 3ZHVA 4BFZA 3W9SA 1IN8A 3P2EA 4YMSA 4KODA 1OWMA 2OHGA 4W8OA 5IDWA 4D02A 1GSHA 2DWPA 3KSAC 1FJXA 4CCYA 1Q95A 2D3WA 2QBYB 1X0XA 2OY0A 1II8B 4BLWA 4D9GA 5DRYA 4W5RA 2UYOA 1L5YA 3G68A 1SUIA 2IHYA 5ALDA 2XUIA 1DIHA 2D00A 3NP7A 4BX0A 1K7XB 1OTHA 1FTYA 3I5AA 2PNJA 5DBHX 3T15A 3U4CA 4GIBA 4I5DA 1BZYA 5H02A 1GGKA 2GBLA 4HH3C 4D56A 5JAQA 2IUEA 2YV2A 1KPGA 2O8CB 1EFRA 1N2ZA 5U4XA 3TEFA 2QMHA 5LP6C 5KINB 5D00A 1V7PC 3RSSA 4BQNA 5FI3A 2C7OA 2OGZA 4BBPA 3AI1A 3OM0A 2XPCA 5ED4A 4OXIA 4KRXA 4NH4A 3WJ1A 2H9IA 3TKAA 3VOAA 4RK0A 2ACWA 3FWZA 3PPIA 4COOA 1FL9A 3VZSA 1XTSA 3PZRA 3KLBA 2OMEA 4C6TA 1DAIA 4HN9A 1V8PA 1YQ9A 4G4SO 4EHNA 1VIMA 4MQLA 3QU7A 5DLYA 1OH8A 2GSWA 1E18A 3G9ZA 1DKLA 3OQMA 1O4WA 1PGOA 2C88A 4X0EA 5AKXA 5KU1A 2WD7B 2JGRA 3VO1A 2EFGA 3T1QA 1V95A 1UMDA 1J1ZA 5F1PA 1SPBS 2I78A 3RVDA 4DJJA 3LU1A 2R7MA 3ABIA 4MOWA 5CW2A 3GJ5A 4GZLA 1SC6A 3A1VA 3S44A 3PKIA 4FYKA 1T1GA 1ZEMA 1FUIA 3KZCA 3ME5A 2C00A 4GKBA 4YRQA 5FA8A 3ZLUA 4BLRA 1QP0A 2GCOB 2MHCA 1KBOA 3K35A 4BO3A 2I67A 1AH2A 1TTHA 1RFLA 3EDRA 1E2KA 2EXXA 5KU7A 1IATA 3QIAA 3DXZA 3C15C 5C1DA 1W4LA 2QN1A 2N0SA 3L8DA 3OE7A 4H35A 5FTNA 1C2YA 2FOXA 3F7NA 3ZE6A 2HQSA 2H7VA 2VSXA 4B76A 3R7WB 2ZIXA 2P3SA 1GGMA 4BZWA 4TLAA 2FW6A 1P9LA 3ZWOA 2FW1A 3NDJA 3LFUA 2BM8A 3DE2X 2A0YA 3K6KA 1US8A 3PD1A 4MV5A 2HMUA 3KBBA 5K3CA 4UM9B 2SBTA 3D3NA 2BCJQ 3EARA 1JHAA 1H2BA 3DAOA 4W7IA 2ST1A 4G89A 1U02A 2ZR9A 3D4NA 3R5FA 4G8DA 3D4LA 4EL0A 1GU7A 4RHTA 4IFIA 2R8PA 4EUEA 3OI7A 1MA0A 1SHZA 4X6YA 4ZRMA 5BV1A 3S1SA 3I6BA 3PEYA 1YCHA 2H4YA 2BKAA 2Z2ZA 3KUCA 1UDRA 2H5JA 1YR1A 3FF1A 5KVAA 1ECBA 1XP8A 3ND9A 4DSUA 1ZVVA 3ROXA 4IKPA 1EVKA 1YS2X 1L4FA 4WTOA 1ZK1A 3UAOA 3URMA 4ZZ0A 4J3NA 4OM7A 1J0BA 2QL7A 4ZOQI 1YR8A 4XM0A 3TPZA 1WXIA 2CVPA 5G4KB 3WFJA 3QPCA 4JI0B 2H9AA 1VL1A 3U3XA 4A03A 5A3QA 3QP9A 2VCEA 4AUMA 1JB9A 5T6BA 2CXRA 1QPZA 3R9XB 1TCCA 4HHEA 2I7CA 3L6RA 1LPBB 2IH4A 3GN2A 1AHNA 1I0IA 4GE0A 2XTNA 4GOND 1VQ1A 4GRIA 1H9BA 4LBVA 2ADMA 4DANA 1YA6A 1EFCA 1NE7A 3IEIA 1U8FO 4WLVA 1K6EA 3Q7EA 1SCIA 3R3SA 4MVJP 3L7NA 3HK2A 1Z08A 1ZVJA 2GSDA 4B3TB 1J09A 5FEUA 2Y8EA 4RVGA 3DWIA 1CS0A 1PFWA 4LBZA 2WHPA 4GM4A 2GHRA 4DRYA 2P2ZA 4KNYA 4RWZA 4AKSA 3ZN2A 1KZ4A 2HV8A 3NWEA 4LOJA 1J8FA 1WY7A 1UFQA 3KVNA 4WZAA 3ND5A 1EVEA 3CH5A 4QL3A 4R1MA 5M5BA 2PL1A 2PGDA 1JMYA 4DG8A 3RSFA 1BVUA 1D09A 2AMLA 3OLCX 2WA2A 4KQHA 1EG7A 1P4RA 1QKKA 2ERYA 2JIOA 3HNRA 2JCGA 3TQCA 5DTEA 3ZCXA 3QVXA 1JJAA 3ZOZA 1KOGA 4O63O 2HY7A 2X7JA 3N39C 4XGIA 4AK9A 4DYHA 1B15A 3ELUA 4L6IA 2J59A 3PA6A 4V3BA 3SKVA 4ARAA 3VR4H 2FR8A 2I8AA 3WJ2A 4E6PA 4DNOA 1ZY2A 3OPYI 3PICA 3BMOA 1LZKA 3G5TA 4JEUA 4F5DA 4GS5A 5JANA 3JVVA 4QEDA 1A5AB 2QZ4A 2O7RA 1RQXA 2GKSA 2ZUVA 3FMFA 5KVQA 4GECA 3R74A 3RKRA 4EARA 2JVIA 4F4CA 3IRUA 2KBFA 1MAVA 4YQFA 1Y82A 3OQBA 5IXJA 4D26A 3FSGA 3O38A 5BVGA 3MMZA 3P9IA 1BOOA 1CDOA 1ZM7A 1TYCA 4F92B 1M34A 3GLKA 3QHQA 4FKMA 2F59A 4YRIA 1WD5A 4BLQA 3LXRA 3CZRA 1U0NA 3KVYA 3GAZA 2DBQA 4B0PA 1QB7A 4IXTA 1WNTA 3A9WA 2FSGA 2VJNA 1NASA 4PZCA 1V8FA 1K8YB 3L7OA 4HDMB 2O2ZA 3K70D 1Z2EA 5CVUA 1NNEA 1C8BA 4Q9HA 3QA3E 1SXJC 3WLMA 1LBEA 4PO8A 4S1PA 3EA5A 2OE2A 2QV7A 4HD8A 2BR3A 1EI9A 3DW3X 1JE1A 2W6OA 4JWTA 1Y4SA 2EAUA 2R6JA 4AF6A 3W4KA 4M1YA 1L8AA 1UM9B 3UV3A 2DLCX 3TLGB 2J48A 1OY1A 1GPBA 2IVFA 4G23A 2GHQA 3H4TA 1G8AA 1KY2A 4YP7A 1XDGA 1Q50A 4EEKA 3QKTA 4I1VA 4L9SA 4S12A 5GIOE 1Q3TA 1NJ2A 1KDRA 1ZL2A 5JZSA 2IEAA 2N42A 4TS4A 3WGYA 1EX7A 5D3MB 1KAGA 1W25A 4RJJA 4Y9SA 4ENUA 4AZ3A 4CKEA 1Z7YA 3WA7A 3BB3A 3FVRA 4R16A 1NI4A 3JR7A 3LIPA 4JUCA 3IURA 1ZZEA 4ZPJA 2VQEB 2QTNA 1BXGB 3JV7A 2PH1A 3RDPA 4LCJA 4QKQA 1Q19A 1W1UA 4UEJA 5K3FB 3SN6A 4CF7A 5EZQA 3G0DA 5C81A 3C14C 1CU1A 1N57A 2ZB3A 3FVWA 1H2AS 4QFCA 2NUTB 2JJQA 4BKQA 3N6RA 2QR3A 2C2YA 3ANSA 4Y18A 2FX2A 4UMEA 5G0VA 4LXHA 1K97A 4YJ3A 4GYKA 2KM1A 1KL7A 1KO4A 2ZJ7A 1SXGA 3KSDO 2JAOA 1XVUA 4U2EA 4IIYA 4EJSC 3SJBA 1Y8RB 5A9SA 1DKNA 3SEFA 4FQ5A 4ND8A 5F1YA 3REGA 2FKNA 4MQFA 2FPMA 1ZW1A 1D9ZA 2GLXA 3KSRA 1OV4A 3KSBC 3G7SA 2EDCA 3F3SA 1P5RA 2I1WA 2RB5A 4QNRA 3WRXC 4EFMA 2EW1A 3KSMA 1SWWA 3L1KA 4FHDA 1B43A 1RWKA 1XD9A 2YXPX 3RRZA 3Q7TA 3KB8A 3ZWNA 3QQPA 3TLZA 2E5LB 4PQFA 2W2XA 1DQZA 1WTCA 3IJRA 4BNHA 3H5TA 5A06A 3H75A 4DCPA 3O6VA 3PE4A 3URKA 4CL0A 3C5WP 3FM9A 4OGGA 1YO6A 3L1JA 1Z73A 1GUFA 3PXCX 2O8FA 4TMKA 3PGXA 3RKSA 2XIJA 2EKDA 2X2OA 1NVWQ 3GLHA 4GW3A 6NULA 1P9NA 3LA8A 3LVRE 2OYSA 4KXYA 3EEIA 4M99A 5HIAA 4G01B 4XB1A 5A3SA 3QKUA 3AG6A 5FB3A 4KQIA 2OZKA 121PA 3MERA 3BIOA 3T0FA 1SUDA 3KPWA 5ELXA 4OK3A 2VHXA 3MTIA 4QO7A 1XCPA 3OE4A 4KE6A 4PC3A 1U31A 2H2GA 1UWLA 5KYVA 2NVBA 4M83A 1OWLA 3SBXA 4DA8A 1X7ZA 4EJSB 1B14A 2Y3IA 2YH2A 3HZRA 4I14A 1QGUB 1EHCA 2JB9A 3GHHA 3IMKA 1XHFA 1MDFA 4JUFA 1G21B 3HB5X 3Q88A 4OH1A 2O0LA 2AR7A 4X66B 3J7AC 2EKBA 3SICE 2XKBA 1PFKA 2DH5A 2HSEA 2PZMA 4RTRA 4OAPA 2C3UA 3PNBA 4OI2A 2NXNA 5BT9A 2PCJA 3WRYA 3N58A 2AJTA 3O21A 4K1LA 2FFHA 5CBKA 1HNWB 5CFZA 1UC9A 4FFBB 4ND7A 4H0NA 2OHHA 1XCJA 3U39A 1RYBA 5C2JB 2VRWA 3X1JA 1WMEA 1I3LA 4MMXB 4K87A 2C5FA 3B60A 4CT5A 2F55A 8ADHA 5FULA 4URYR 3QIVA 1MQAA 2WLSA 1KDTA 2EQAA 1JE0A 1EZ4A 1JEQA 1LJLA 1VYUA 2II6A 2PK3A 2ZIFA 2C3YA 1QO9A 4EFLA 2VAWA 4PZ0A 3D8RA 5LZ4A 2AF3C 1HFEL 5E6UA 4PR0A 3BMNA 4HH0A 1TCBA 4HJXA 2PZBA 3Q7PA 4B0OA 3AEYA 4IXWA 1RXEA 1XNHA 3NTUA 1I30A 1VECA 1BXRB 4PC2A 4NG4A 1DKPA 1FZTA 1IDN1 4MUJA 4E08A 4EG8A 1MABA 1V11B 3HSKA 3JVUA 1AU9A 3MD9A 5FDFA 1HQKA 2J3HA 3HNOA 3NWJA 5KVSA 4J2OA 3WWCA 4IKEA 3N0XA 4BAZA 3V9PA 3VGPA 5EJ8A 4XPIB 1HR0B 3DLHA 2F64A 2R97A 3BIFA 5K8IA 4N3CA 4PFKA 2HUNA 4JY7A 4WNAA 3CM0A 1D04A 1NONA 4IOJA 1EGAA 1HOXA 1N0VC 3NETA 4V2IA 4QHSA 2QVYX 3GAFA 4TTVA 3T3DA 3WIUA 1G4HA 1T3LA 2VJMA 2ZK7A 4OO3A 3T7CA 2CGEA 1TQ4A 1ZFNA 1NMQA 2C0PA 2NUAB 4I55A 2N1BA 4AMGA 4OP1A 2NWQA 1O8BA 2O6LA 4Q4HB 3ZXSA 4AJ9A 2PJRA 2PL9A 4MICA 3ZZ1A 2QMEA 4XOIA 1G8HA 1QLHA 2BY4A 1WHTA 2WINI 1JHOA 1CS4C 4URFA 2O3SA 3ZWCA 1XQ6A 1TK2A 1DP4A 1KY3A 2NMVA 2H1RA 1YB5A 4P0TA 4ZQFA 4M76B 3FLEA 5JS8A 2P11A 1VBFA 4HVLA 5C1BA 4HDRB 2NO1A 3PNKA 2DJ5A 3EDYA 2FG7C 2G7MC 5EEGA 2BFFA 1TJPB 4BP1A 1D2HA 2DECA 5ENVA 2YJ4A 3RUAA 4DEVA 2GBPA 1X3SA 4BDSA 2ESRA 1G9TA 4PAWA 1LD3A 2V5VA 4IHJA 5JCXA 4DV0B 5CVEA 1W44A 2AD5A 2VG8A 1ORVA 4WI1A 4JJIA 4YJGB 4ZQGA 3TPFA 2X0KA 1NN0A 1R6TA 2H2FA 4FHCA 4L22A 3FYUB 1RE0A 3UUEA 2ODAA 4GC5A 5A0TA 1UBHS 2Z08A 5KNBD 4FFOA 2O14A 4JDPA 4LRWA 1VBMA 3KXLA 3CMCO 3QVOA 4M1ZA 4OMFG 2HXGA 1QVRA 1WUJS 2E82A 2G6BA 2XUKA 3OZGA 4WSOA 5JPIA 3TL3A 1N2BA 3K6RA 3DOCA 4B6QA 4AZWA 5LQMA 2E4UA 2IPXA 3K5PA 4MX8A 4X8HA 3I8OA 5D7NA 3K53A 1PRYA 3BXXA 4TYPA 2GJ4A 3DMNA 2N3ZA 5HKLA 4PPGA 3G8DA 2OD7A 1EFVA 1UJCA 3BHIA 1NVTA 1UJ6A 2GZ3A 3DC2A 2IIBA 3MFYA 1QHGA 1NYLA 4NL4H 4XFDA 5IBPA 4IWXA 4B71A 5C35A 5HSGA 1XNRB 4B3RB 2ENUA 1MPTA 2NAFA 4JBNA 3UK0A 1K7EB 2XGJA 1FLAA 5AJVB 3IPLA 3NM4A 3N8GA 1RP1A 5K0GA 3RYCA 4KE9A 2BF4A 5DXAA 2DQZA 1M74A 5DLEA 2W2KA 2CFCA 3WAGA 2J33A 4DLXA 1BG6A 3AHGA 4QGBA 1E6WA 3JWGA 2JFUA 3X43A 4UUMA 5REQA 3W4IA 3DDNA 2XW6A 1XAHA 3OIDA 3MYRA 2B37A 4ITVA 4R1NA 3WG9A 5FWNA 4HGRA 1QYXA 2CL6X 4R2LA 3L06A 3P52A 3KOWA 1DC6A 1YU6A 4EITA 3PQ5A 1IJKA 2IL1A 5A71A 3EVTA 3WQRA 3ZE1B 2W6IA 4Q02A 1OTYA 1FW6A 1SKQA 3D6MA 4IDGA 5AI0A 3H5WA 4CETA 3BORA 1QG6A 4PZPA 3TG8A 2UXBB 1E77A 2X6TA 1GQOA 1JPUA 1AQJA 4CMGA 4EI2A 3VXKA 2P4UA 2R8YA 1ORDA 4H3VA 1UMCB 3GJRA 1KMHA 4IDQA 1A5ZA 4B32A 4FFNA 1M2OA 2YWJA 1AQLA 1SZCA 4H15A 3VYRB 4A5SA 4ME6A 4DWJA 2QP9X 4IINA 5ECWA 2FWJA 3TOSA 4F91B 4O4LA 1GO2A 2OV3A 5C1OA 5KEIA 1C9DB 1TC2A 2QQFA 2DWQA 4QDZA 3ZYZA 3EJ6A 1S02A 5TQ2A 2JHPA 1FLVA 4Q1CA 3JARB 1DC3A 4F04A 3DDOA 3C39A 3DFIA 1GY8A 2WC1A 2NVOA 2X5XA 4M46A 3OG9A 4MCIA 3O4IA 5B3AA 3L41A 4X8OA 5TEVA 4Y6SA 4H1HA 1QJ4A 1MIOA 2KE5A 1COWD 3BH7A 1G42A 4LXXA 4UHDA 5IEBA 1QPBA 5SV2A 2IIQA 3P9SA 2P0YA 4GVLA 4XM2A 3F71A 4YJGA 1KVUA 3TLGA 4HNUA 1E2UA 4ZXFA 5A4KA 2TMGA 4NU5A 2PR2A 3QNWA 2O3UA 2QRGA 2WWGA 3QUCA 4LHYA 4Y2XA 4CIAA 3F9CA 1NG9A 3NRJA 1AF4A 1CJTC 1NQUA 4FSXA 3T4EA 2RI1A 4CNBA 4MEAA 3M2TA 4XWTA 3B7PA 2DP4E 2AZMA 3NVAA 5CB4A 4XOUA 3PUZA 3Q7RA 3MTJA 2GDZA 3IIMA 4FXPA 2PTGA 2XYRA 3NJ4A 2WYIA 2CV2A 3T94A 1XQ1A 2IXGA 4A8PA 2BFEB 1RXYA 1ULUA 4DLYA 5LUAA 2JASA 1CF9A 5BN3B 1WD7A 4TKMA 1EFDN 4PNHA 3BK2A 3SHQA 3VKUA 1JIKA 1KOJA 1P6QA 3DFZA 3F5QA 4C0BA 3IDAA 3M81A 4NS4A 4IXMA 1ZA2A 3NIDB 1CVLA 3PRJA 5A05A 1GRQA 3TR0A 5B3KA 3AZQA 5ITSA 1KZ1A 2GCIA 3K9HA 3TRHA 4FB5A 1IUPA 1MRNA 2V9PA 3L0SA 2B1JA 5DNAA 1R15A 4KYVA 4ZZ1A 4OD0A 2EG9A 4WESA 2V59A 3K8YA 4DVGA 3HYSA 4ENPA 1YGYA 4JYMA 3W6NA 2AFHA 4MAFA 1T8YA 1J99A 1RZVA 4UTOA 2FWMX 2W70A 4PFSA 4X00A 5GONB 2C7RA 2R8EA 1UMKA 4FEEA 4MR8B 4RELA 4DV1B 4QATA 2F1KA 2HQRA 3EVCA 4H3SA 4KKXB 4N03A 5T4HA 3UK7A 5CCXA 2G5CA 3NONA 3QEOA 3QLEA 4FOTA 2COEA 4OVKA 1SHKA 2BELA 2D2EA 4A2CA 1SXPA 1NVVQ 4HMQA 1EU1A 3ENNA 4ZT7A 5AUNB 5JMOA 3N76A 2GR9A 1P0QA 4NQZA 2HIAA 2AD1A 1EE9A 2RGDA 4G0PA 4M22A 4C3OB 3P9XA 3CV3A 3TTVA 5L8VA 1D2AA 3EFEA 2RJ3A 2EATA 3N3AC 1WWKA 4KQKA 3VKGA 3PHBE 1R8YA 1WDMA 4K26A 9MHTA 3HRIA 4I8XA 4M0UA 4BTEA 4QOEA 3LCUA 3A4IA 4EJFA 3M6WA 3HMQA 4E51A 4JEHA 1Q0PA 1LF5A 1MTZA 2ERCA 3BEDA 4ID9A 5GM1A 5G4KA 2QPLA 3UHFA 3WGJA 1Z6TA 4LN1A 3R1IA 1KU6A 1XB2A 3DV0B 2CXUA 1T0PA 1RE1A 2CY0A 1QGED 2DPLA 2OCKA 3PHCA 5DBIA 1NUSA 4BUJA 1ULAA 3UM9A 4P3PA 3ZQ6A 2JA1A 1QFJA 3C8DA 1FC0A 4HQ0A 4JVMA 3D6FA 5EWJB 5AWFC 3Q85A 1N3LA 5A3RA 1ZK0A 3TG2A 4ZDKA 2IH2A 3A9RA 1A8QA 1WX1A 4D0RA 3NBQA 1F2UB 5C5DA 4YCAA 4BVEA 2C7QA 1EWVA 4AJLA 3MQ2A 5SYMA 4Q4LA 1GA1A 1NJ8A 2L69A 1LY1A 3FNEA 4EB6A 5KYYA 4EHKA 5BQPA 4DIUA 2EBFX 4MHOA 1NNUA 3ENVA 1L5HB 2FMFA 1ZH6A 1UMBB 1N9GA 2ZXEA 4BS9A 3G23A 1HE8B 1Q0LA 4UHJA 1XLVA 2WVJA 3ORHA 2WT9A 1P81A 4TYWA 4B7AA 1JR2A 2ZJFA 1JFVA 1DINA 3R7WA 1JJ7A 4IDCA 5FBRB 2H6EA 1N77A 5IH7A 4I50A 4E2XA 4MVYA 1ZNXA 5D8DA 1RW4A 1RYYA 1WAMA 3SYRA 4FZ3A 2XAUA 1A1SA 1M72A 3RGGA 2RI6A 2NW6A 2V3WA 5J5CA 4JT4A 4OQYA 4EI9A 4IGEA 2SKCA 4S2UA 4V2UA 1ZXBA 2HSWA 1MQ9A 1NXQA 3FKSD 1YE5A 4PF1A 1Q0HA 5EMJA 2A9FA 2PRJA 3UJPA 1JECA 4BCCA 1GHTA 2E1RA 2B83A 2DBRA 1SIUA 3G5LA 1B00A 3N2ZB 1S96A 1UMDB 2HJHA 2NP6A 1GARA 3OIFA 3HSYA 4QOFA 3CTMA 3E4DA 3TRDA 4HY3A 1CJBA 5CM2Z 5HQJA 1BKDR 3T06B 4ZYUA 2B5VA 3NASA 5DI9A 4ZVSA 3X1DA 1ICIA 2C97A 3KOUA 4KFUA 3V5NA 1L7DA 1UKVY 2FEPA 1EFTA 2ORIA 2YIJA 4OBBA 4L51A 4RZIA 5EMNA 1N78A 4ENRA 5F5LA 2HK6A 1U0OC 3QOXA 5CYOA 4LK2A 3H8JA 1K0FA 4UVIA 2QORA 3ASVA 4QWWA 2ZR7A 3V2HA 2YR0A 5CTAA 2XCLA 3AYXB 2OVBA 1JYFA 3IB6A 1LB1B 3ET4A 2GN6A 3JQ8B 3NVMB 3I2GA 1QM5A 2H85A 4QC2A 1WCIB 4UD2A 4YROA 3KB2A 3UFBA 1WCV1 2Q0SA 3EGXB 1MEOA 2CZCA 3NT2A 4M38A 3FCSB 5J47A 1DJMA 3UVEA 2FWBA 2JI8A 2QGNA 4D25A 4F3KA 1L1RA 1VCNA 2ZAMA 5I7AA 5HA5A 2Q9UA 3D5EA 4B35A 4E4YA 1GR1A 2IW3A 3DOFA 3VR4A 2XVYA 4CTNA 1AS2A 3HEAA 2NYVA 4LI3X 3WKBA 4MQMA 4BNIA 5CDYA 2FWAA 3NALA 1YJBA 3RS5A 3RVJA 5KPDA 3WE7A 3NHBA 1AD2A 5AH0A 4YPOA 2PMKA 1KP2A 1DDIA 4NCBA 2B21A 1XN4A 3F78A 3WNVA 2DY1A 2X2FA 2GJSA 3DTNA 1TDJA 4LS3A 4YVFA 6ABPA 3IP9A 2YVUA 4HWSA 2OHXA 3QXCA 4EYOA 2R1UA 1CULC 2OYCA 4AN0A 3KYIB 2R2AA 1OWNA 1NF8A 3R6DA 4PX2A 2IV3A 4DLVA 1P1KA 3OVMA 1WIWA 3ISVA 1PJ8A 3S1LA 1U90A 4LV5B 4U1RA 4C0QC 3K0KA 4ZK2A 1CHNA 2RGNA 4MYSA 2EHJA 4UZFA 1E1RA 5EAIA 2LRHA 3MWJA 1OC2A 4YAIA 1FF9A 1QO0D 1SVOA 3FPBA 2GM5A 1QE5A 3L0ZA 1HL7A 3P5SA 4IGAA 4IRXA 3MBKA 4JYZA 3QG1A 4MUFA 2UVDA 1AZSC 1YUBA 1GCUA 1Z7WA 3RUIA 2UZ1A 3BWVA 4BJ6A 4BX9A 3LL7A 4E0BA 1O6GA 3TEJA 1XSEA 3IBCA 3N8IA 4CHTA 1JDUA 1ESDA 2Q7DA 1ZIYA 2QYTA 5B1YA 1K7CA 1N4AA 2BBSA 3KJFA 4GT1A 4KH1A 3AEKA 3RLIA 4MWTA 1T9AA 4OXRA 5AVZA 1RJ9B 1K86A 1NJ5A 1AT1A 3MLAA 2PYDA 1J2EA 1SGWA 2GN8A 4L7VA 3ES9A 2XT9A 4MMYB 8GPBA 1GGFA 1L5RA 1YAJA 3BMOB 3HCAA 3NBUA 2PUFA 5H70A 3EWNA 1LPNA 4WECA 4ZI7B 4NZOA 2JA2A 5B1EA 4HQLA 2JG3A 4KMMA 2CCGA 4LXUA 2W2KB 2G6TA 2YFQA 2EGGA 3NPAA 4MVJG 4UAUA 4YASA 2XOXA 3SIWA 3VR5D 4B34A 3F9RA 3TMYA 4DARA 3FB1A 2FSFA 4DLBA 2XJ9A 1PBNA 5A3JA 5J4LA 4IQ0A 1OIWA 5CTJA 4MUXA 3ZV3A 5EMMA 3OSUA 1NSFA 1WXFA 2RBGA 3T7SA 1BWQA 3TSAA 3GDHA 2XGMA 4EH1A 3MMSA 3TJZA 3FYTA 5A7GA 4AMBA 5CU7A 2J41A 4GOJA 2WKQA 4CQLB 2HJSA 1LBTA 1RRMA 2HWXA 1DRWA 1FVFA 4F0JA 5BR1A 1WTAA 1EHYA 3M1IA 2RGAA 4M36A 2PN1A 2WY2D 5LQDA 3R9WA 3I2IA 3JRWA 2ZI3A 3VKFA 1NRJB 1YB4A 3CNNA 5CT4A 4PX5A 5DYGA 4AWBA 2HMTA 4RPIA 3N74A 5A2GA 4LY0A 3DDSA 3HNPA 4LSWA 2V4MA 3E22A 6Q21A 1MOZA 4X1KA 4ZC1A 3W7AA 5CB4F 2SKDA 3P0EA 2HDNB 5EKTA 4JP3A 2RFLA 1AUPA 3EZ2A 1E5VA 1GPLA 1E1CA 1JEEA 4PONA 4PLVA 5DHRA 2ONYA 1PTJC 4M9CA 4ZZ2A 3S28A 5B12A 4HDNA 1F0KA 3BD6A 5D5QA 2NUPB 1UEIA 3LLUA 4Y8VA 4GMGA 4JODA 5LUBA 3EPKA 2PPVA 3VVBA 1FS5A 2UZ4A 4O6VA 1VP9A 4I4NA 5AMXA 3THYA 1GEGA 1FMJA 3ILSA 1LPPA 1WSBA 2HBZA 1CUYA 5ICFA 1O57A 2AOXA 4K1XA 4CIVA 4DJAA 1WP4A 4I50B 3OFSA 4MW2A 4TWBA 1NW3A 2EBUA 3A1NA 5EINA 3MIZA 3TNLA 1X1CA 3G2NA 3K0BA 5AKGA 1KO5A 3PCTA 3NWOA 4PRZA 2BGLA 4MWSA 2BGIA 3D6TB 1FSZA 2AHOA 1KS9A 3DO5A 3MTEA 5BQOA 5LA6F 3VU0A 4CGZA 1QGAA 2R8ZA 3HBMA 3RJZA 5LOVB 3ZV5A 2FSHA 1XTPA 3ZGLA 5CLJA 2EHDA 4V38A 1JKMA 3LLSA 2BEWB 1W5TA 3S2GA 2IA5A 4HB3A 1FUKA 5E3JA 3K0CA 4WACA 3W1WA 1F2UA 3L92A 5J4YA 3GUVA 1EXDA 2QAIA 2R1ZA 2E9SA 1JHYA 4XDGA 5AKYA 1T9BA 2O8BA 4OOFA 2LUOA 4UTNA 5INTA 2AMJA 3WWEA 2AS0A 4MHSA 3RK0A 3BX1A 3E9ZA 4C07A 4MS3A 5KOJA 1MH1A 3AUSA 1XA3A 4S24A 9LDTA 1W7AA 2IP2A 3ZY4A 5JBIA 5AJXA 3S2ZA 4WCFB 2FDRA 3JQ6A 1NBIA 4BVJA 4GBMA 5JASA 3RRFA 4A3SA 1N5KA 4RD0A 4PSCA 4R7GA 3R7AA 1O87A 3UMFA 3SK0A 3C3CA 3OU7A 2VT7A 4JUDX 1H0SA 4EPVA 4YT5A 2F48A 4WJKB 3LQFA 3F2VA 3OZSA 2Q0XA 5DM1A 2PX6A 2JBAA 2F4VB 1XTJA 2XBMA 5ALLA 2BJWA 1M5UA 3Q2IA 4LTDA 2BIFA 2V7GA 1DOAA 2BKXA 1IONA 1DKUA 3PYXA 4NOKA 4OHFA 3DA8A 4Q9LA 1JHZA 2PEYA 1VZ2A 2W2NA 2WI8A 2ORVA 2X76A 4GYJA 1HDEA 2WRZA 2GKOA 1ZSYA 4R1TA 3IOCA 2GCNA 4XVRA 3MTGA 5ARDA 1U65A 3DKPA 2RHGB 1G64A 3BN3A 5J58A 4OSPA 5DI3B 1T5LA 1SG9A 4IF6A 4ITRC 3GVCA 4IEIA 5TMPA 5KYXA 5CB6A 2H31A 1J33A 1AC5A 2FVXA 2QMZA 2QF7A 5DIZA 3IPCA 1ZP6A 5EZYB 4EVSA 5K03A 3QKRB 3T4XA 4B6JA 4LDJA 1OB2A 4NMWA 4PHTA 1LX7A 2I7DA 3IP1A 2H08A 4AXBA 1VIVA 2X8LA 1UXHA 5BSTA 4LWPA 1DRVA 4IRUB 1SCKA 5EMHA 4ZN6A 1JFLA 1USIA 3VX3A 3X1YA 1B2RA 4DEYA 3TNJA 1FPQA 5JBQA 4D0NA 1X7ZB 4EJSA 3AF0A 1DI0A 1HDYA 1GTMA 3L5KA 1NUUA 3E1KA 3AHJA 4OQQA 4R2WA 3B2QA 1T5HX 4TTAA 1GQ2A 5IWAB 3KLMX 1E69A 1PJZA 2GERA 4HEA6 1WU7A 2B0CA 4KVZA 2FQQA 2CHVA 1PR4A 3V1TC 4EGQA 2HTFA 1HZZA 5BPHA 3VU1A 4DV3B 3DOUA 4JWKA 2ADFA 4EA8A 1FEZA 1ZN8A 2PL5A 5AKKA 3RU3A 1HDZA 4EBBA 5DYYA 2B20A 3VAZA 3DZCA 1D1SA 3ANXA 1TTTA 5EWLB 4BE7B 2E87A 3U3OA 3WNCA 1WABA 3GNQA 1ML4A 1YE3A 2OCPA 1OI2A 3EXEA 1SXIA 2FAXA 4M1MA 3LF2A 1YDWA 1VHTA 1WSDA 2FDXA 1BA2A 1J4AA 3ETNA 3W8DA 1A97A 1UOQA 3WISA 2V5UA 4URZR 3CZAA 3PB3A 4FONA 3JWEA 4Y2HA 4MQEA 4D2IA 1KMNA 1WW8A 2OQIA 2VK4A 1IH8A 5IASA 1EH5A 1ZM3A 3BL6A 4YWJA 1T8UA 4YMGA 1I4TD 4EGFA 821PA 5AM3A 3NTOA 1IEQA 2IP1A 2Q1TA 3KDAA 4NYMQ 4MROA 5CP8A 5ALWA 2IDZA 3IO5A 1QG4A 3L8MA 1RRGA 2ALJA 2QX6A 4WXMA 4FYPA 4TYQA 5B58C 1AA9A 2QD4A 4PW0A 3WGUA 4U7TB 4BQSA 5LDHA 1FOEB 1OLUB 3DCNA 3ISJA 2FWIA 4UVHA 2BD0A 4RTLA 4UBJA 1XMXA 3BILA 2HF7A 1EZZA 1B1CA 1LDBA 1FRVA 2A9QA 1QX3A 4NX2A 3U9SA 3ZTYA 2ZBDA 4AY3A 1EK1A 3QITA 4WY2A 4F4HA 4LF8B 2J0UB 3LHFA 4ZCQA 1AKMA 1ZOPA 3GU3A 2BRUA 4IJKA 4PYIA 3RTCA 4BQIA 2Y0DA 8LDHA 5H83A 3GP3A 1OA0A 4KR3A 3U4QB 1WUHS 5B4UA 1FYXA 1FDUA 3OPVA 2M6LA 1KKLA 2QD2A 2HYDA 1L5LA 3RAGA 3TQTA 4B4OA 4BUCA 2SKEA 4ZV4A 1DWQA 3D31A 4N8SA 4F71A 1EGQA 5ICSA 3KQUA 2VJBA 1V7ZA 4FNGA 1UT5A 2JGDB 1FNDA 2OP1A 2QTFA 1MJNA 3NBYC 4J0FA 4US1R 3C85A 1EEHA 2GUGA 2MSDB 1XTTA 1M1UA 3KOZA 4FDTA 2O5RA 3FYUA 2I8LA 1JHUA 1A77A 5REQB 3I42A 3QKRA 4L76A 1F12A 1JYEA 3P4UA 3K71B 3FI9A 5C53B 3SWWA 1EIWA 1PJ4A 2YV5A 3T3GA 1T4CA 2E6KA 3IX7A 4M53A 1L9KA 3JRNA 4HCJA 1Z5ZA 2G4LA 1A7AA 2QD3A 5ADVA 3JQAB 1U8ZA 5KAMA 2R87A 1NJ6A 4BIIA 2V7TA 2QJRA 2HAEA 4BVAA 1SIOA 1M83A 2IU3A 2RAPA 3F6RA 2C4NA 3ZWPA 1Z39A 4DC1A 5C5IA 2QRKA 1ZX1A 4JVSB 1CUAA 4MSUA 3PT5A 1GCOA 4ZAZA 4EIWA 4EHIA 4EOGA 4O3FA 5ALGA 4UCQA 3OPMA 2Q0HA 3SJZA 4HYEA 4J0CA 1J2JA 2I5PO 3PCXA 5JQGB 4TRRA 4N40A 2BI4A 3GJXC 4IIVA 3PPYA 2HL6A 2O5VA 4L0QA 1XD2B 3UUGA 2HYIC 1QAOA 1X7WB 1YZ3A 2P6OA 4RIGA 2CZGA 4U6SA 3TLJA 4R31A 3H5VA 4Q9AA 3IV7A 7YASA 4UATA 3GLGA 1MT0A 2DPMA 3AVUA 4X3OA 5F51A 3I53A 1BTOA 2Y9PB 2R86A 5EJFA 5K8LA 3U16A 1AGNA 2VPTA 2HPVA 1NHWA 2HPAA 1U5BA 5EKSA 3V7FA 1ESEA 1GPWB 4YJ2F 2D54A 4KLAA 5JD6A 2LDBA 3RVSA 4ZAVA 3WP1B 3NTLA 1Z38A 2JATA 3U4AA 1P1BA 3C6BA 4GEKA 3UT6A 4MVJE 3PDWA 1PE0A 5JU6A 1SA0B 3BGVA 4HLUA 1LJ8A 1Q1AA 1XL0A 1R64A 2I62A 4Q1DA 2VFAA 4ND6A 1P3JA 2FW7A 5G0WA 2INGX 4W5JA 3A6PC 4G41A 3U3MA 1QZZA 4OI4A 5AVUA 1LLQA 3NDIA 2JHFA 4P86A 4PPNA 4TKVB 4RSHA 4TYNA 3HKCB 1JEYA 1IQ0A 3WS7A 4I1OA 4F2PA 2JI6A 3NYWA 4LJ6A 1U81A 3A06A 5F3RA 2G7ZA 3GVHA 1IY8A 3GBVA 1VRCA 1LJUA 2HJ9A 4CMCA 1J2UA 5IM5A 1BRMA 4J2HA 5E4TA 2CXOA 1D3AA 4J94A 4RACA 4B3XA 1ACJA 5EQDA 4ILKA 4MR8A 2PQ6A 4WD3A 3JQDA 2YJNA 3EQ7A 2R25B 3TX2A 5SZJA 2YHIA 3DPIA 3U7RA 2JZOA 1GXSB 1XRRA 1U7UA 2QSYA 3RS9A 1RPAA 4N5MA 4B40A 1IIRA 1TADA 1U2DA 4OQMA 3H13A 4MUKA 4NP6A 2WU3A 3WYNA 2H2AA 4B9EA 2BFDA 2P6RA 4WBNA 3ZE2B 1W4BA 3GJZA 3OZ7A 4K6OA 1VI5A 4LYFA 3KV3O 4B6RA 2POQX 4JOBA 2UVQA 4TZ6A 1EX6A 4P33A 5ALEA 3EVFA 3SC4A 2QP3A 4MB0A 4OP2A 1FSFA 4YRLA 2DM6A 4CLRB 5K4HA 4QJBA 1IU9A 1YF3A 2QNIA 4MGHA 3LDFA 4FBLA 2H1OA 1UPAA 1HLGA 2GVZC 3HACA 5L6MB 2HMVA 4XWWA 3EQZA 2ZSBA 3ELBA 3HE3A 1TTQB 1J24A 3IHTA 5EERA 3AWIA 1ZI9A 3JQ9A 5IDYA 2HIGA 3PK0A 1YRBA 3BHJA 1PGQA 5AXBA 3D5TA 5DHAA 2NT3A 4JS0A 3ZDQA 3TE6A 4EMSA 3C2QA 1R1DA 5AOAA 2HSZA 2QG6A 4OHPA 1CY0A 3OX2A 3AVXA 3QLUA 4OI1A 4Q48A 3EVDA 4M0DA 4EO9A 4C7OB 4HAUA 5T7BA 2X15A 4DTCA 5JO9A 2CLEB 1C4WA 2X23A 2E3JA 3KYJB 1DXYA 5GAJA 4MW6A 1AS0A 4YV0A 4CQNA 3UMGA 1TIPA 2XOKD 1UOPA 3U7EB 3BMCA 5B4VA 3EEBA 2BZ0A 1R88A 5CR9A 3DH0A 5BSGA 3I72A 4CM7A 3GOHA 1YXMA 4Y2YA 5L4SA 3TZHA 1G38A 4HQ6A 3HVHA 2H2WA 3C8HA 4K05A 5L3SA 2IS1A 2Q2WA 1JTFA 4XIYA 5G1NA 2E89A 2HPZA 2Z04A 1ECJA 2WVAA 5AI5A 3T1TA 2C82A 2Z2YA 2ONJA 3DMPA 1OPRA 4P1ZA 5CDGA 2XQVA 3S2SA 5BWCA 4S2EA 4HWPA 1R7RA 4NBUA 4Q05A 5I7OA 4YAWA 1NM5C 4FC6A 1IQRA 3Q2KA 1D4FA 4IJUA 4EG7A 2PLFA 5AIBA 5K45A 4CMJA 1NT2A 1EFPA 1EZ1A 5G3ZA 3USZA 1KTVA 1Z47A 2O2JA 5KCMA 1NC1A 3VR5H 4J0EA 1E60A 2HDWA 3EIWA 4PNEA 5BN4A 1XT6A 3A4NA 3MWEA 1SUSA 3Q3EA 4BO6A 4ZVTA 4YRBA 4YPFA 4DNPA 4FNAA 4IZOA 1AA6A 2VJDA 1CFZA 3F7MA 2Z83A 3VR2D 3PEFA 3JQ9C 1W52X 2OCGA 4G37A 4URHA 4A10A 4DKXA 4FDLA 2C0QA 1GAJA 4BOYA 4I2VA 4XLTA 3ZW8A 1IAQA 5KYUB 3HCCA 5ITZB 2I3GA 4HYQA 4BKRA 3H87A 1T26A 3WSWA 1LDGA 3QNMA 2BCGY 2DY0A 2ATVA 2PZGA 2ZU0C 2VNHA 5E9QA 1WKCA 3IXMA 2GUWA 4MO2A 3WGGA 4IUBS 1NVDA 1W5EA 1YRWA 5FBVB 3H2SA 3MAGA 4YRNA 4RJLA 1RAIA 1J5XA 1HT2E 1L7BA 1O89A 1E0DA 2PXAA 1S8NA 2V6MA 2VYVA 1UIRA 1ZQ1A 3CHYA 3HU3A 1AOXA 2ZJBA 4M8NE 3JZAA 5E3IA 2QMYA 4AO8A 5D01A 2FN7A 4LZLA 1OLUA 421PA 2GJAA 3UH0A 1H3EA 1LNQA 2WWFA 1ODFA 3QA9A 3WOVA 2BGKA 4QODA 4IO0A 5JJLA 4AZ0A 1GVNB 3RE1A 1GLGA 3HJFA 1VHQA 1BCRB 1FQKA 3E03A 4TMVA 4UHKA 4RZUA 1M9NA 3E82A 5L95A 4UREA 3ADCA 1YZNA 1GKLA 1UC5B 4B3BA 3B6ZA 1XKXA 2FPWA 2QN3A 3PC7A 3MTDA 3BMCB 4C4YA 4PLFA 4D9FA 2BR5A 3QVMA 4FGZA 4Q3EA 1EK6A 3RVPA 1R6XA 3DBLB 1U1DA 5DTMA 4ESHA 4GF5A 3P4YA 1GCAA 4YAKA 2GDJA 5HPYB 3KRTA 3EXEB 4RHYA 1QCZA 3ER9A 5HFNA 2YCLA 5DZSA 3PF9A 1T2DA 3IQWA 2IXEA 2FPPB 3V4OA 3KOYA 1L1EA 3DB2A 3GW8A 1ZITA 5DO9A 4B4UA 4RCZA 1M6VB 1W49A 4G24A 4G4GA 4HZIA 4J4BA 5IDXA 1UBKS 2AL7A 1CUEA 2F3PA 2I6XA 3M4XA 3PCRB 2OCYC 1UT6A 3JQFA 3UXHA 3G0BA 4BVGA 1SCQA 3ZD9A 1TFRA 3W3AD 4QAJA 3EC1A 3FIJA 3JY6A 3HBNA 3L6UA 1XK6A 3DO6A 1JQJC 3DAHA 4KKVA 2PLWA 3FVVA 1EM6A 3H19A 5AHKA 1QCCA 4KQ9A 5F35A 4ARZB 3IAXA 1Y7HA 3EIXA 1C0KA 1K1EA 1CUVA 3BXHA 5CXQA 2WDPA 4CKBB 4GLLA 5BN5A 4BN5A 2IDKA 3EVAA 4YACA 1EQUA 2P1RA 3ZE9A 1MAHA 2LCQA 1R6AA 2AXNA 3AY6A 3I9V6 3DE5X 4FT2A 4IVNA 4RY9A 4AICA 1PTJA 2YYAA 3PQFA 3CN7A 4NEHB 4XEUA 4JXXA 2RC6A 4RTQA 3DFMA 4BZQA 2IUFA 3ZDFA 1JG1A 1RYFA 2IKSA 3SEQA 1QBGA 3N2IA 3ORRA 1V11A 5AXDA 3SSAA 5CCBA 1C8KA 2I71A 3OEYA 3T5GA 3ZC3A 3GA0A 1VJ1A 3GGGA 2XMPA 5DM70 3P96A 3H3XA 3D4PA 3OUZA 4KAAA 1W0KA 4MQ4A 1DL5A 3G2KA 2KI5A 3IR7A 4L74A 4XSVA 3PQ6A 4J49A 2ZTSA 3LV8A 3OIYA 1E2QA 4PLYA 4R5MA 2VJQA 3W5AA 1BVRA 1XU7A 4UAGA 3ZK8A 5TS3A 4UMVA 4DRZA 1V1RB 2NYAA 4CDMA 4ZI7F 2BUCA 1CNFA 2DGDA 3WP0A 1J23A 3PRYA 4ETIA 2IZZA 3DDCA 2JLCA 4PGHA 5JFGA 2ETVA 4IDHA 2FMTA 3GMTA 4K40A 1F1BA 2IYOA 2NUAA 2IHJA 4DMGA 4PFQA 5KOYA 4WAUA 4QM6A 2LXNA 2Z1MA 2V6GA 1ISFA 1HE1C 2L17A 2QRZA 3KCNA 2VAMA 4MRSA 4C4PA 3DDWA 4DNQA 4OGFA 2XTJA 3O47A 1RSZA 3TLEA 3FPCA 1WUTA 3HA5A 4OM8A 2Z2XA 3OCCA 4D9NA 1AXGA 4N65A 9LDBA 1OI7A 4OJQA 2OC9A 3NB0A 4U7HA 2YOHA 1PZGA 3LI2A 4MV8A 4TLCA 3ZDBA 2Z9CA 2H2IA 5EGNA 1C9NA 1JPVA 2IWHA 4DUPA 4PZAA 3B1YA 3HCDA 4NTZA 5IDQA 4N0EA 2ZYSA 3EY9A 3UEOA 2JFBA 3RASA 5LIPA 4BATA 4NYIR 1J0DA 2QX8A 2WU8A 4YN3A 2Q46A 4RA6B 2J9ZB 3N0VA 2IYLD 5DGHA 3W2FA 3C41J 2PSFA 3SBOA 1U8UA 3CIFA 1B4DA 2AFVA 1PQWA 1GAXA 1DAOA 5BN3A 5ES3A 4NAUA 1SXQA 2A9JA 4M55A 3V32A 2XWBF 1E3JA 4RSMA 4NBVA 1RI5A 4AP6A 4QNNA 3DE3X 4M89A 1UZUA 1FY2A 1DXQA 4ZT5A 5ISMA 1O9BA 3PUWA 4Z4GA 4M1TA 4XWKA 4FEAA 5C3MA 2UYQA 4CMBA 3RO7A 1F2VA 2VTVA 1U0JA 3HUFA 1KFKB 1RJFA 4L1KA 1AG9A 5KJ6A 4UTRA 1BROA 4F2DA 1U3WA 3O2JA 3O9ZA 2D6FA 3KDPA 5D3ZA 4EHJA 2VZ0A 1GZ7A 2W6ZA 2WIFA 4P58A 1K68A 3LKZA 4K9MA 1OLXA 1NDQA 1S3FA 1TJYA 3CUTA 4GX0A 1GAWA 1I80A 2RBKA 2YZKA 1O8CA 3CXRA 3UWMA 4CU2A 3LHDA 4FFLA 4X24A 3FNQA 1RR6A 3N0WA 2O59A 2Y2VA 3NRBA 4GOOD 3FLBA 3GZJA 3LZDA 2OO7A 1L2TA 2X8BA 1P77A 4P81A 1NLZA 1K8RA 2P7IA 3PFGA 2EIXA 3D1LA 3PL5A 1VPWA 3JARA 3S6JA 1WF6A 5A1JA 2ZSEA 1P9RA 4JLJA 4NEQA 1IZ0A 4EKDA 4DSAA 4WN3A 3CT6A 1X7WA 4P4SA 4LJ7A 2HCRA 2GAAA 4Q1AA 4ZPXA 4INZA 2OO5A 1U11A 1DFGA 1T9GS 2OHJA 4KL8S 2GARA 3BH0A 2E4ZA 3K2IA 1SULA 1Z34A 1NPTO 3K0FA 5AXAA 5TGTA 5L4NA 2W2QA 3CH6A 4UJ5A 4I19A 4DIEA 1GL3A 4XYEA 1JHRA 2NNWB 3RTAA 1O95A 1Q0SA 1JYSA 2RGWA 4G4JA 2FK8A 3BWDD 2E1PA 3COSA 1EWRA 3V3KA 4R1PA 3PJRA 1U9ZA 1O5TA 3EZ6A 1JILA 4FK8A 4OUDB 4RQBA 1JDZA 5AM1A 5ED0A 2F8TA 3E8MA 3D1VA 1Z5WA 3JWJA 2J9YB 1LC3A 3H11B 4EY5A 3WBKA 4Q6BA 4C7XA 1T1IA 1GTRA 1YBVA 1KP3A 1X6VA 1CUDA 1TGVA 2NQ8A 3DD5A 4DNFA 4BVBA 4C20A 3P0RA 1NL3A 4RTJA 1E1NA 1XYGA 5HMMA 3G9UA 1YRYE 1I4LD 4LJRA 2WHXA 1OAOA 4K03A 5E8JA 1OBCA 5FLEX 2E5WA 3THSA 2Q5FA 1CLEA 2IEGA 4DV5B 3RC8A 4BVFA 1DQRA 1XZ8A 4CM8A 3GEDA 2PXXA 5FADA 1Z2PX 1Z88A 5EIFA 2BT4A 3UJBA 2QTMA 3VDNB 2MCFA 4LZAA 5AUPB 1M1YA 1P0MA 4I4TA 3EOAI 3CY6A 1BDBA 1OH7A 4JI7B 2Q62A 3INYA 4NBWA 4WJLA 3WWDA 3ZDYB 1GL6A 3IV9A 1YOVA 1U7XA 4Z4HA 2QY6A 4V24A 1C9EA 2J67A 2QGZA 4FKZA 3DG9A 3CNEA 4GZ6A 2JCYA 5EOVA 3NH6A 3FTFA 1NBAA 1VDZA 3OBIA 4M1QA 4ZOCA 3A27A 3R3ZA 4G0XA 4EYQA 1MOPA 1MMFB 4D74A 2ROQA 3SVTA 2A9RA 5L3QB 2E85A 5KYWA 3DBOB 1E63A 1E6LA