4OZ1A

Crystal structure of human caperalpha uhm bound to sf3b155 ulm5
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
111
structure length
111
Chain Sequence
VQPLATQCFQLSNMFNPQTEEEVGWDTEIKDDVIEECNKHGGVIHIYVDKNSAQGNVYVKCPSIAAAIAAVNALHGRWFAGKMITAAYVPLPTYHNLFPDSMTATQLLVPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Cancer-relevant splicing factor CAPER alpha engages the essential splicing factor SF3b155 in a specific ternary complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords RNA-binding protein 39
total genus 28
structure length 111
sequence length 111
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-02-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4oz1A00
2KG1A 2KXFA 1D8ZA 1FJCA 3OW2R 1VQ6S 1D9AA 2DGXA 3P5TL 1HA1A 3K0JA 2DGWA 3IRWP 1VQ8S 2MXYA 2QFJA 3I56S 3SDEA 2AYGA 1U1QA 4ERDA 2DGTA 2JVOA 3CTRA 4QQBA 5DDPC 2OSRA 1YTYA 4TLQA 2M9KA 2DHAA 2HYIB 1U1PA 2CPXA 3DXBA 3TYTA 3CCQS 2N7CA 1DZ5A 3LQVA 2PEHA 1PO6A 1VQ5S 2KVIA 2KRBA 2A3JA 3MUVP 2CPFA 1WEYA 2XS2A 5H1SV 4F25A 1N54B 1Q81T 2F9DA 2RU3A 3PIPQ 4UQTA 2CJKA 1ZH5A 5DETA 1A7GE 2MKIA 4ED5A 5LJ5Y 2CQHA 3EX7B 1U1LA 4W92B 1OO0B 3BS9A 5CYJA 2RUGA 2KT5A 1YJNS 2LEBA 4Y0FA 3UWTA 2MJNA 2DNNA 2J0QD 2E44A 2KM8B 2SXLA 2RS2A 2MGZA 2VODA 2N82B 3CC4S 3TO8A 1K9MT 2M4MA 3IWNC 3P49B 3PIOQ 2FHOB 2CPEA 1VBYA 1WHXA 4YB1P 1QM9A 3S7RA 1WF2A 1KQSR 3CCJS 1X4EA 4F26A 4FXVA 2FPHX 5MLCV 4IUFA 1M5VC 5FJ4A 2ADBA 1WHWA 1WG5A 5DDQC 3TP2A 3VF0B 2CQ1A 2KH9A 1VQNS 2RQ4A 1WWHA 3CCES 2Q79A 2MQPA 2MSTA 3SMZA 5BJRA 2DNPA 4M5DB 3EGNA 4PKDB 5LXYA 3G6ES 3S8SA 1QVFR 2MQNA 1KC8T 3G8TA 2AYMA 2MKHA 4EGLA 4OZ0A 1X4CA 3LPYA 2E5HA 2YWKA 4WFBQ 5JVHQ 1UW4A 3MXHP 3U1MA 3J7ZT 1VQ9S 3VAKA 2EK6A 3CCRS 1DRZA 1QVGR 2DHGA 2E5GA 2DGOA 2DH8A 1K8AT 5D78A 1WF1A 3NS5A 2HGMA 3NNCA 5CXTA 1Q86T 2JRSA 4LMZA 1X4HA 1XN9A 3VAHA 1VQ4S 2FC9A 2RVJA 3BEGB 4QPTA 1A9NB 2X1FA 1M1KT 2RNEA 4C7QA 3NMRA 1UFWA 4TU8A 4WCEQ 2YKAA 2CQ2A 1SJQA 2GHPA 2ERRA 2LA4A 4UY8T 4CQ1A 1WI6A 3HI9A 1R8PA 3CD6S 2DB1A 3VAJA 2LMIA 2X1AA 1KOOA 1U1OA 4IOCQ 2DGVA 2I38A 1U1NA 1U6BA 2YH0A 3CPWR 3EGZA 4V19X 1DHMA 3VAFA 1FNXH 1WHVA 3VAMA 2B0GA 5GAEU 5IM0B 1X0FA 2CQIA 3BO4A 2KM8C 1VQKS 1URNA 2CQDA 3VALA 1U1KA 1SJ4P 2DGSA 1WELA 2WBRA 1N52B 4Z2XA 3I55S 1X4GA 5GMKa 3CMES 3CCMS 5DDRC 3UCUP 2J0SD 1YWXA 2M0GB 3BO2A 1JMTA 2MZTA 5DDOC 2MQOA 3CCLS 2RT3A 3CF5Q 2MKKA 2DNKA 3UCZP 3FEXB 1SJ3P 2EVZA 2ADCA 1N88A 3S01A 3G8SA 1NO8A 2VOPA 1YI2S 2M8HA 1SXLA 5JVGQ 2DIUA 3NNHA 1X5PA 2CPHA 2LCWA 1S72S 2DGUA 3MUTP 1WI8A 2HVZA 2MHNA 2LEAA 4W90B 4LIRA 2DGQA 2M7SA 1YITS 1Q82T 1N8RT 2M88A 2NZ4A 1FHTA 2F9JA 2XNRA 1VBXA 4C0OC 3R1LA 2DNRA 2ZJQQ 1ZZNA 1DBDA 2M2BA 1H6KX 3CCUS 1VC5A 2DH7A 2CQPA 1G2EA 3R27A 2CQ0A 3BO3A 2MY8A 1P1TA 2VONA 1KOHA 4PR6A 2FY1A 1O0PA 1R8HA 3G96A 3G9CA 2LXIA 1W2BR 1M90T 2M8DB 5CA5A 1UP1A 3HHNB 2DITA 3RW7A 3CUNA 2KI2A 2OTLS 1P27B 3V4MA 2CQ4A 4WIIA 2MPUA 2MZQA 2LYVA 3UE2A 1OWXA 2HGNA 4WFNQ 3D2WA 1ZZFA 2RS8A 1FXLA 1WF0A 1VBZA 3RW6A 4OZ1A 3CC2S 3Q2TC 1WG1A 1JJ4A 2E5IA 1X5SA 2KG0A 1U1RA 1U6FA 2BZ2A 2DNQA 2HZCA 2CPIA 2XNQA 1HL6A 1Q7YT 2MY7A 1M5PC 2LKZA 2LQ5A 2VOOA 1WG4A 2DISA 1WTBA 1UAWA 2G1DA 3VAIA 3G4SS 4P6QA 2DO0A 2DNZA 2DNYA 1F9FA 2MZRA 2F3JA 2KU7A 3UD4P 1VQLS 2KN4A 2MKCA 1H2TZ 1VC0A 2DNMA 2OJ3A 1VC6A 5LJ3Y 3ZZZA 2U2FA 4WF9Q 2N3OA 2MQLA 2OSQA 2D3OR 4TU7A 3P3DA 3B4DA 3NS6A 2MQMA 4PRFA 5IQQA 2K3KA 1BY9A 2CQBA 5IM0A 3MOJB 3FEYB 1NJIT 4CIOA 2CPDA 4LJMA 2KFYA 3CXCR 1FJEB 3CULA 2YTCA 2KXNB 2L08A 2J76E 5GADU 5EN1A 3S6EA 2MKSA 3JB9k 1RK8A 2DH9A 4ZKAA 1CVJA 3CC7S 2DNLA 2HGLA 3CCSS 4Y00A 2QEXS 1X4DA 2LECA 2U1AA 2MSSA 2OTJS 5DM6Q 4IO9Q 2KYXA 1SJFA 2CQ3A 2DNOA 1U1MA 1PGZA 4FXWA 5HL7Q 2G0CA 1YHQS 2RQCA 2ZJRQ 2K8GA 2J8AA 5LXRA 2FC8A 1H2UX 3US5A 5IFMA 2OIHA 1B7FA 4WKRA 1JJ2R 2M70A 3ZZYA 5GVQA 1KD1T 1WHYA 2CPYA 3CCVS 3P6YC 2I2YA 1VQMS 2MB0B 1NU4A 4YUDA 2L9WA 2DK2A 3MUMP 3G71S 1YJ9S 2LA6A 4QU6A 2O3DA 1OIAA 2UP1A 1IQTA 2DIVA 1X4FA 2CPZA 2MMYA 1AUDA 2G4BA 1YIJS 3SXLA 1WEXA 4U67Q 4IOAQ 2DNGA 1YJWS 2DHSA 3MD3A 2DHXA 5D77A 1FJ7A 2BOPA 1JJHA 4CH1A 1WEZA 2X1GA 1VQOS 2KXHA 1M5KC 2CPJA 2N3LA 1H2VZ 2ZJPQ 3THPA 4F02A 3J7YU 4TU9A 2X1BA 4BS2A 2GO9A 3B4MA 4C4WA 2AYBA 2EK1A 2PE8A 5ITHA 1X5OA 2NLWA 2M52A 2MZSA 2V94A 2L41A 5LSOA 3L3CA 3ULHA 3Q2SC 4J5OA 4A8XA 5LSLA 1S79A 3THTA 2RRBA 3SDEB 1FO1A 1FT8A 1HD0A 2XB2D 4RU2A 3NNAA 2KHCA 5GAHU 2AD9A 3UCGA 5GAGU 3MD1A 2MJUA 2KRRA 2XS5A 1VQ7S 4YOEA 2JX2A 2RRAA 4WFAQ 2CQGA 1VQPS 2MYFA 1K73T 4CH0S 2DNHA 2CQCA 2XSFA 2AYEA 1U2FA 3MDFA 5HO4A 2JVRA 3MI7X 5DM7Q 3H2UB 3VAGA 2XS7A 1X5TA 3MURP 2QA4S 1RKJA 3UD3P 2MKJA 2MQQA 3N9UC 2E5JA 2DO4A 1X4BA 2JWNA 1OPIA 3R1HA 2D9OA 3H2VE 2MZJA 3DLLQ 2MGZB 3CMAS 1X4AA 4QU7A 1HD1A 2D9PA 1SJRA 1M5OC 2MZ1A 2YH1A 2LXUA 1L3KA 3U1LA
chains in the Genus database with same CATH superfamily
3V6DB 3CD7A 1GTHA 5B0GA 3JXOA 3KLEB 2GO8A 3OQ2A 2RRNA 2KXFA 2EKYA 2QLWA 1DJ0A 2HFUA 4IRKA 4NXNJ 3QT6A 3BBBA 3BDPA 2W2PP 3AJ1A 2GW8A 2W7PA 1XC9A 3NXZA 3DOLB 4WPAA 1HA1A 5B08A 5I4MA 2NPIA 3SV4A 2UXDF 4WP8A 2IVMA 3SCKE 2EI5A 2QFJA 3UN5A 2BE7D 2YNGA 4P2SA 4ZPVR 3HZGA 3I56S 4C11B 3C16A 4C8YA 2RAQA 1T9YA 2FHJD 2CZ4A 1ZAVA 4F0HA 1NKCA 4ERDA 3BBFA 4CYUB 2HW3A 2V4JA 1KWMA 5IV3A 3OJUA 2CFXA 5AXKA 3DRYA 3H25A 2MKYA 3W9HA 2LP4A 2DEJA 2V67A 1JLEA 2ASYA 2DCLA 3CJ5A 2HK3A 1HMVA 2GJ2A 2XG8A 1RB0A 1A0OB 3PNIA 1RT7A 4FYXB 4BWJA 3PX0A 1DZ5A 3LQVA 1T02A 2VFSA 4JI1J 1HBNA 2KRBA 3JQKA 2HKEA 2FJXA 2CPFA 1WEYA 3W5YA 3R2CJ 1ICEB 4PABA 2E9TA 5D15A 4EYHB 1Q81T 4NLPA 1S1TA 1IBKF 3PYDA 1NSPA 2PA8D 2YKPA 3QFHA 4UQTA 2POKA 2G2OA 2CJYB 3MTKA 3DMJB 4LBIA 4USMA 1T05A 4WU2A 1ZPVA 4PQUA 2FJEB 4TLRA 1FNOA 4X62F 1N5YB 3ILJA 1TKDA 1NLKL 3I5BA 3IBCB 4A8WA 4ILMA 2RUGA 3FZBA 1R8BA 2LEBA 3IGNA 2J0QD 1VRUA 2MLZA 4X62J 1U0HA 2G2ZA 3GJTB 1MROA 1FJGF 1NDLA 2R4FA 3ZZUA 2MGZA 2RU9A 3FFIA 2VODA 3JTPA 1N5VA 1PYOB 3EWGA 3GP9A 4NZ6A 2XI3A 3HPOA 3RB4A 2B9EA 3NLCA 1K9MT 1IKWA 2QA2A 2H1YA 3I5CA 3Q89A 2JEGA 4EMDA 3LPEA 2QMUB 4L6V3 3VWSA 1VK8A 1KQSR 2HHHJ 3NOGA 3JYTA 1N56A 4CI0B 4F26A 5KOXA 4USTA 5MLCV 5L1KA 1QSLA 4NLOA 2VG5B 1MW7A 5B0FA 5HROB 4Q2LA 3GQCA 1U25A 2QE5A 3MM9A 3V4IB 2ADBA 2KKHA 3TVZA 1WHWA 1LK5A 1XMBA 2HS3A 1IQZA 1HLWA 2LLZA 3UI3A 2XCPA 4RKUC 1B0PA 2KH9A 3BQ1A 3GIIA 3BSNA 4DR1F 3CCES 3V2UC 1U02A 3H59A 3OJSA 3DU5A 2V4QA 1S5ZA 3TAPA 3PCOB 3C16B 2WHOA 1B99A 3MPWA 3N6MA 3IC1A 2OHDA 4M8LA 4QIWD 5A76A 3J80Y 4ES3A 4YY3F 2OELA 3KYLA 2DNPA 4DLEA 1QSYA 4N47A 4DR4J 3MR7A 4PKDB 2P9CA 3S8SA 1ZM2A 3P96A 2B8PA 3C6UB 3Q86A 4I2PB 1NK4A 1KC8T 5KG2A 2V2ZA 3MM7B 3I9ZA 4OZ0A 2N4CA 1X4CA 5HANA 3LPYA 3M2VA 2C2NA 2Z0GA 3HHLD 5EX3A 2D7SA 3HULA 4DQPA 1LFWA 2UUAJ 3P8BB 1S7IA 4P71A 3U1MA 3NOCA 4H4KA 1NK8A 5I3QA 4A8SA 1SL2A 4MFBB 4BWMA 4LRDA 2KDOA 5FD1A 3J7A1 1QVGR 2UUBF 3MHYA 2E5GA 3PX4A 1JK9B 2MDAA 1QDUB 2RILA 3RB6A 1K1QA 1MU2B 2O1PA 2VPXB 4NLYA 5D78A 5GMDA 1E6YA 1K8AT 4WZQA 1RUSA 2HGMA 1D3WA 3PEJA 4DR7J 1EQMA 2AGQA 1Q86T 3M7VA 3BGLA 4AXIA 4KAIA 1X4HA 1T9UA 4HT5A 3RAMA 2DXDA 1LWCB 4C48A 3K17A 3T3FA 4IDKA 2RVJA 4QPTA 1SVDA 5CYQB 3GIKA 2PMHA 3QRRA 1A9NB 2UXBJ 3HXMA 4CLPA 3FRZA 5HI7A 5I3UB 1SIZA 1UFWA 3DNCA 3HLUA 4XAKA 4LR7A 4TU8A 1UFKA 1YSJA 2JEIA 1IR2A 2CQ2A 4OV1A 2GHPA 2IM0A 3QWPA 2W2NP 3DDKA 2RF2A 3G2XA 5CYMA 3OTBA 1R8PA 1HNIB 2IMOA 4K4SA 3CD6S 4FNHA 3E8OA 1DQ8A 3ZC4A 1HQUA 5E5NA 1OQ3A 1QD1A 2A6OA 1F5BA 1Q8LA 2BKNA 2LMIA 3LANA 4EFAC 1UPPA 1GT8A 5IQ6A 4DV5F 3IN5A 2BANB 2BQUA 1HQEB 5KFVA 1VGYA 2E1RA 5KFTA 3VAFA 4WIQA 2FUG9 1SH0A 1EJ7L 4M94A 2AX0A 4LBPA 2LQBA 1HBUA 1R0AA 4PXEA 1X0FA 3RYLA 3MAHA 2ZKUA 4JYAF 1NDKA 1UEUA 4O44A 2XI2A 4DL5A 1N4LA 4L76A 2C3PA 1XWLA 2ZZTA 2OFGX 3TWZA 4ITSA 3RAXA 5I3PA 1NKEA 1HNZJ 2DGSA 4GKJF 4HACA 5J2QB 1NZ8A 5KG0A 1MWYA 3GWCA 3WBZA 5D6GA 4QW9A 2QMWA 1IR0A 4NLDA 2HVDA 4NLUA 5B0CA 5D0HA 5K8PA 5DQHA 3KLGB 1CJKA 4PWDA 2J0SD 1JLBA 2B4UA 4J9KA 1ZTTA 3W7BA 3BO2A 1MWQA 3NCQA 2R7WA 2ASLA 2FVCA 3CJQA 2B5JB 3J81U 4FBUA 1LEOA 1S0VA 3CCLS 3M1VB 5ETNA 1UVMA 1RCOB 2MKKA 4TQRA 2DNKA 3UCZP 2OUGA 2UUTA 2AW0A 2BJ8A 2FLOA 3MM5B 3M8QA 2ADCA 1N88A 4UOHA 1NK6A 3E51A 3MAAB 5D3GB 1KQKA 3QO9A 3S01A 1KVIA 4BHQA 5F8IA 1XBWA 4WKYA 3G8SA 2RDDA 3D3CJ 4JI3J 1JNRB 1NO8A 4V1Ak 4CWBA 1YI2S 1Y5LB 2VOPA 2V0NA 1SXLA 3DRXA 4NLSA 1SC3B 4YDXA 4LSNB 3BSOA 2HQCA 5IWAF 3DGPB 1IM6A 1EB0A 2K7KA 3HHEA 3KLIA 1RAAB 4ZOSA 4A8YA 3H7HB 4DSFA 2J6SA 3G6XA 1NBEB 3NBPB 4OJHA 4DR1J 1S72S 2BA9A 4UUWA 2D74B 1WI8A 1LFPA 2NREA 2XSJA 1TQLA 1X0PA 1BGXT 2GIQA 2GGPB 2VU5A 3GR1A 1YLXA 3R5AA 4CO2A 1J5OA 4ILLA 4LSLB 1I94F 4BC9A 1RAEB 2RB7A 1Q95G 4LIRA 1K44A 1S1TB 1UEVA 2KHDA 1SH3A 4OMFG 4USWA 4P75A 1YITS 3POTB 4IFVA 2M88A 5KG1A 1RT5B 3BBCA 3ETMA 5L1LA 1Q82T 1RWKB 1FHTA 2ZWPA 1J5EJ 1SJ1A 4IH7A 4WYWA 3QBCA 3LF0A 3TAMA 1YKWA 4USVA 3FBBA 1VHIA 5KFWA 1FKPB 2CQPA 1B3TA 9RUBA 4CZCA 2XMUA 5KT6A 4M1KA 2HBRB 1S9EA 1WC5A 1UVLA 1U8SA 1GMWD 1QAYA 3RBZA 1O0PA 1NK5A 1HNXJ 2R2SA 1RT4B 2FTRA 1M90T 1EZZB 3AFGA 3DU6A 2W7OA 2KI2A 3CD0A 4DZ6A 1KLMB 3LWMA 2RH3A 3V4MA 3CO0P 2MPUA 1WKLA 3QGGA 3E2EA 2GVZA 1S6QA 2CNNB 1DQ9A 3NP5A 4WFNQ 1RISA 4ZP6A 2WVBA 1V5IB 3KUGA 5AE3A 3HHLA 4OZLA 3C15A 1ZZFA 2F7VA 4IH5A 4DG1B 3EJMA 1KTQA 1VBZA 2B4VA 3BJYA 3T5JA 4F36A 3OVSA 1K0VA 3OHAA 4ED6A 1UVJA 1X60A 4RNHA 4ECUA 2FZKB 2GIFA 3HFKA 2XZTB 2HZCA 3W65A 3VGTA 1UFLA 5KFPA 1F9EB 5FIIA 2ZH6A 2EFQA 4HTJA 1S1XA 4IG0B 3MECB 1CS4B 5C25A 3J80U 1DTQA 1TKXB 4ZVHA 3UDLA 2LKZA 3ISND 2XM3A 1HNXF 1N6QA 1RT3B 1VQSA 4ZITA 2HWTA 4DFMA 2ZM6F 2I9SA 4PG4A 3M30B 2HHWA 3VGVA 2GA7A 1JLFB 4I2PA 1WTBA 1CLFA 2C2MB 2DRDA 4RUAA 3G4SS 3AB2B 2X3DA 3PJWA 2DNZA 2DNYA 2F3JA 2PI4A 2RSQA 3K2YA 2Y1LB 1VQLS 2BRLA 2KN4A 4DV3J 4D3GA 1H2TZ 2RE1A 4M95A 2DNMA 3KK2B 1JKHA 1T95A 2YKMA 4LSZB 1PBAA 4MT1A 3H4DA 4LR8A 5CCMA 5LJ3Y 1GX5A 3TEGA 4ECTA 3HSGA 4PEOA 1TU0B 3F0NA 2MQLA 3I0RB 4M63A 5LOQA 2N3OA 5F3ZA 4DV1J 3FSIA 4ZVGA 1PAEX 1D1UA 3P3DA 2AU0A 3K58A 2VG6B 4FYWB 2BE9B 2X3GA 4K4XA 2ZE2A 4ZLLA 4FF2A 5IQQA 4F0MA 1BY9A 5B09A 2CQBA 2Y8WA 3G82A 4Y28C 1OYDA 3FEYB 1RYRA 2CPDA 2PO4A 5B7WA 2KFYA 3GR0A 4DL6A 1N32F 5D4LA 4C0BA 2D69A 1RCXB 5GADU 4RLEA 5EN1A 4GO7X 1CJUA 2WVEA 4CTAB 2VHGA 2R8HA 5HJYA 3OL9A 1IBCB 2XMAA 1FK9A 4DV2J 5F8JA 2XMVA 2O67A 2DNLA 3H90A 3PG9A 4FVCA 4I7FB 3A3OB 1CVJA 3QZ8A 4K59A 2UVWA 3EDRB 2QX0A 2QEXS 3R7SB 4E98A 1JXVA 2BJ9A 1U24A 1O8BA 2MQ8A 3DYAB 1KFSA 2I6WA 1HI1A 1I6JA 3ZTSA 1SJFA 4CLYA 1U1MA 5IS2A 1PGZA 4MIAA 1H3DA 4FXWA 5HROA 2VIHA 2QMXA 3UDCA 2R7XA 3QRQA 1N5TA 2B7BB 4X65J 5LL6d 1U2CA 1KQGB 4CO1A 4M5HA 4ZCMA 2K8GA 3CE8A 3D7SB 1ZM3A 1H2UX 3PRVA 2OFHX 3R8YA 3US5A 2UVUA 2JFDA 4K2JA 3W8GA 1EKSA 1B7FA 3B78A 4IOBA 1SQFA 4EO6A 4F4XA 3JAMU 1IBMJ 2EPIA 5KFZA 5M2UA 2M70A 3SYZA 3DFEA 3ZZYA 4U7CA 1DTQB 3TW0A 3W9JA 4N5SA 4KGKA 3T5KA 2OGUA 3ENQA 4J9RA 3V81A 1KD1T 2DJWA 5H9FJ 2KL8A 4LFAF 3TZXA 3IBWA 1EETA 1HI8A 5HLFA 4PUOA 3HD1A 4YR0A 3JSRA 4ZPAA 1DY3A 4YUDA 3OV7A 1KP6A 2DK2A 2O66A 2X51A 2NZCA 2ZBPA 1ZM9A 4KE5A 2GC8A 2PI5A 1RT7B 3H98A 4HT7A 3NMAA 3RAQA 2JC1A 1OIAA 3KNGA 5F3TA 4QW8A 1T9VA 2QIFA 2UP1A 2HIQA 4ANCA 4DFJA 1T03B 1KR4A 1NHVA 2EW9A 2KO1A 4UT4A 1X4FA 2CPZA 2HQFA 2RQKA 3OLBA 4PWWA 1ACMB 1J2VA 3MR6A 3AOCA 1YIJS 3BKTA 2OPRA 3CW2C 4LVOP 3CD5A 3D0IE 4PYDA 1S59A 3SXLA 4CLTA 3IMQJ 1EKRA 4Q7AA 3PY8A 1FE4A 4B3TJ 4PQUB 1QUPA 4ECYA 1SV5B 4I1TA 3D28A 4DV7J 3QJJA 4USHA 2HHVA 3SQOP 2GMLA 5KFOA 2GAHC 3MCOA 5SUHA 4B17A 3F44A 2ASJA 5DLGA 2VF3A 3JAMY 4AD6A 5KFMA 1NH8A 4DX8H 5I3UA 2FVPA 4YHHF 1EP4B 1M5KC 2AEMA 5DQIA 5THWA 1R6VA 1VQYA 5H9EJ 1S12A 1SB6A 2BM1A 2CPJA 1HNVB 2OPSA 2JH3A 2RUSA 1PG5B 2N3LA 3D5MA 4IQMA 4ZS6A 1RSCA 2ZJPQ 3WHIA 2RD5C 1FDNA 2WZ1A 4I7FA 4DLGA 2GHVC 4UOCA 2GO9A 2R8IA 4C4WA 5E3AA 2AYBA 2HFZA 2EK1A 4USUA 1GNKA 5ITHA 2OPQA 4HL9A 4UTGA 3DI6B 4N8OA 3PR4A 4KHPF 4NYPA 1LW0B 1Q5VA 1EAYC 1XR7A 1JLAA 4IKAA 3THVA 2DR8A 4FF4A 1QY7A 2L41A 1F6TA 5LSOA 3L3CA 3SQGA 5T7LA 2HS0A 4B3SJ 1RHJB 1XERA 3IR7B 2R8JA 2WONA 1YBTA 2IYGA 4DSLA 1H73A 1YRTA 3THTA 2RRBA 2HHPA 1XJWB 3SDEB 2IFXA 2F40A 2VA3A 5HVHA 3QGPA 3Q24A 4KJIA 5GAHU 1JLQA 4ZVOB 4IDKB 2LQ8A 2L48A 3EVOA 1PJ7A 2HEKA 5E3RA 3V5RA 2ZZNA 2GVDB 1YQHA 4NLVA 1HFEL 2QSFA 3DGPA 2ZC4A 3SBMA 3UCGA 4ED7A 3CIZA 4LR9A 1BWEA 3UFCX 1EIYB 2XS5A 1VQ7S 4YOEA 3PDNA 4Y65A 3PW7A 3EVMA 3CVKA 4ETXA 3QWUA 5KFHA 3AD9C 2VFTA 3JQJA 3NCPA 5CYMB 2FLLA 1VQPS 3RR7A 3PW4A 1CJVB 4RW4A 1K73T 5LMNF 2ASDA 1XNQF 2CQCA 2CXEA 2XSFA 4DV6J 1CC8A 1KVJA 2AYEA 1U2FA 3HVRA 2JVRA 2QLJB 4UW2A 2W9AA 5HMZA 3W2VB 3PYFA 4ID5A 5A0YB 1J5OB 2UUBJ 2HVHA 3T1YF 4CH7A 2OPPA 3R6GB 3DLJA 4CLZA 1PYTA 3W2WB 5E7OB 3N5BA 1SH2A 2JZ5A 3FUYA 3M9NB 1VIXA 3NY0A 3FZ2A 1EHWA 2B51A 2HNDB 2DO4A 2IM1A 1LWEB 1BUXA 1RDRA 1X4BA 2Z58B 1S0NA 4LRFA 1LQ9A 1OPIA 1RADB 3IR6B 2JEJA 4QCLA 4Y2IA 2DR6A 3QPIA 3GIMA 5D4OA 2QTWA 5HK4A 2P9EA 4C8MA 4RR5A 5DS7A 3GCXP 4J9VA 2AMCB 4Y34A 3MFIA 3DLLQ 4QU7A 1HD1A 3AXKA 3NKYA 1R8AA 3PRDA 1IBLF 1FNMA 3CJTA 1RWPB 2CIMA 4DX7A 1M5SA 3TQEA 4IFYA 1RHRB 5AXLA 3U1LA 1WTFA 4CO0A 1REVB 2HFNA 2ALZA 3LP2A 3OFFA 4KHPJ 3CGIA 1ELOA 1D8ZA 1GXUA 2G0IA 4BBYA 2Q1LA 4NEYA 1W7WA 3OW2R 2BJEA 2GJIA 2YNHB 3C6TB 4NXMF 2C2EA 2YPYA 4DFKA 1VQ6S 3FC9A 1Q53A 2XHWA 1D9AA 2J8SA 3RTVA 1NB7A 5HAOA 3IA0A 4DX5A 3QSYB 2QLXA 4KKOB 2IRUA 1Y00A 3OTEA 2MXYA 4YEAA 1DTTB 1UPMB 2HVEA 3BN7A 2V2QA 2VQEJ 3SZ2A 3R3TA 1RTIB 2I5JA 4K4ZA 4UF4A 1U1QA 2H5IB 1JLQB 4QQBA 5KT2A 2LXFA 5DDPC 5SZTA 2OSRA 1PKUA 3KJQB 3QNWB 2DHAA 1H74A 2IC3B 2RKIA 2CPXA 3DXBA 4X4OA 3TYTA 2VBWA 2V4RA 3CCQS 5T41A 1YJUA 2YWWA 2K3IA 4IQXA 3L09A 3EUNA 2AEFA 2UXDJ 2IM3A 3N79A 3X1LB 1CEZA 2GGPA 1VQ5S 2XY6A 2QYCA 2A3JA 1UJ6A 4DWIA 1RABB 5H1SV 3WZ0A 4LREA 2HQIA 4ES1A 1N54B 4F25A 3LW5C 3TZZA 3H20A 3W8PA 2DCUB 1Y0HA 2RDJA 4F0KA 2CWXA 3T5HA 4QIFA 4DFPA 4ED5A 5BYSA 5LJ5Y 1YZ7A 2HAFA 2ZFHA 4YHHJ 3CCWA 2E5LF 1FA0A 2UXBF 3U27A 1Q16B 3BS9A 1AUSL 2OD6A 3FCVA 4DUYF 4N76A 2W24A 2OMOA 2KZMA 1S9GA 2KT5A 3AB4B 4IG0A 5C25B 4Y0FA 2VZ9A 4DS5A 2DNNA 4FYYB 5D0GA 1G4CA 1JB0C 5T14A 3GYNA 4ECRA 4LSNA 2QT7A 3OTCA 4J9QA 2N7YA 2RS2A 3H4BA 3TA0A 3GZ7A 1NJYA 4HI2A 2P6TA 2E1CA 2N82B 1OPZA 1NCLA 3A4TA 4M5IA 3IWNC 2WB4A 3GCWP 2IJNA 1VBYA 2HFSA 5D4NA 4N7TA 1Z1ZA 4ZVEA 4DV6F 4JI5F 1HBOA 1WF2A 4RUBA 3CCJS 1LW0A 1X4EA 5F41A 4FXVA 2J7KA 4XPCA 3GE9A 4IR9A 1HW9A 3GJSB 3D1OA 2M3DA 5HBMB 2FGCA 4IYQA 1KRPA 1ZA2B 3FBCA 2WONB 4H54A 4JB8B 2W25A 3EZ5A 3VF0B 3W5XA 3LP0A 1VQNS 5FLXU 2RQ4A 3PO4A 3QRPA 2K1RA 1WWHA 3GSDA 5KG3A 3KK3B 3M2RA 1ZETA 2MSTA 1K47A 1H7WA 2B9WA 2O01C 2DPJA 1PJ5A 2HRTA 3KJFB 2NPFA 3SMZA 3SSSA 4DV0F 1CS4A 5BJRA 2Y1IA 2HBQB 1MNEA 1N34F 1FD8A 2W9BA 4I64A 5LT5A 1S76D 2WVCA 1Y9OA 5J2PA 4R5PB 4X4SA 3M30A 3PW0A 1QVFR 3G8TA 4RPFA 2GJFA 3JQMA 1JXLA 1N33F 2PFDA 3AA9A 4E8UA 4JBCA 2YWKA 4LFBF 3AH6A 2CVEA 3DLEB 2P2CB 5JVHQ 5A8WA 3KLFB 3T1HJ 4Y2CA 3J7ZT 5KFLA 3IGVA 2FVRA 2EK6A 2R7QA 2DY9A 2AIRB 2JJ4D 2XWXA 3N0VA 4L3NA 5LMUJ 1DRZA 3NS7B 4ZVSB 1F5AA 2V9KA 2CYYA 4O3OA 1F60B 2DRBA 2XZDB 2YKOA 4P2MA 1TKTB 2B6AB 2PMWA 2VBYA 4ZK7M 4DV2F 1WF1A 3NS5A 4MH8A 5EHHA 1CULB 3NNCA 3TRGA 4C8NA 2OO4A 5GADI 4DL3A 2PA3A 1YZ6A 3Q22A 2QLBB 1F3FA 3M9MB 3UQSA 4S0MA 1N32J 4LMZA 2Y1RI 4LF5J 2HHSA 3BF4A 4B9UA 2BVZA 1P9YA 3BEGB 1PC4A 1HWUA 1FRXA 2ZEJA 2X1FA 5L9NA 1M1KT 3QJPA 2RNEA 4C7QA 1X9SA 1VRTB 5DRKA 3HM9A 2ZH3A 2CDRB 4AUKA 1EQ0A 5ETRA 2PD1A 3FK4A 3DHXA 1RTZA 2RQMA 3DOMA 4IH6A 3MTJA 4MMOA 4UY8T 4H4MA 1WI6A 4F8RA 1M1HA 1F2GA 4NL5A 3KJVA 2UVVA 2DB1A 2IM2A 2AJFE 3VTIA 4IRCA 4WTOB 3VAJA 2OPQB 1IR1A 4I68A 4ZJLA 2AJ4A 2XULA 2XMMA 4NYZA 1U1OA 4X4PA 2YVSA 5A0YA 3N6LA 3W2VA 4BC7A 2WCXA 2I38A 3FQKA 1OJ4A 2IHR1 4V19J 2DKOB 4OZ5A 1WACA 4AFFA 1VOMA 2DEIA 4TY8A 1NK7A 3MMJA 2WW8A 1FNXH 2QYGA 1WHVA 1YJTA 3VAMA 4X4NA 4ZPBA 4DX6A 5H9FK 1H7XA 1FRKA 5IM0B 3J81j 3Q8RB 4XTTA 3AOAA 4NLXA 3TX0A 1RACB 1TUGB 2KM8C 9ATCB 1HI0P 4CYUA 2CA9A 5J2NA 2EBEA 1TL1B 3VALA 3PEHA 3UO0A 1EETB 4PUOB 2B4PA 2D3UA 1ZAXA 1JLEB 4XDCA 2OH2A 2RHSB 1RU2A 2NQPA 2J9EA 3SCLE 1IKXA 1X4GA 3TAQA 1IN0A 5GMKa 3CMES 1REVA 1JLCB 1VJWA 4FN5A 4QIEA 4OX9J 1ZOTA 3RRHA 5E2QA 2FLNA 2M0GB 4KGZB 4DPOA 4DPXA 1JMTA 2CZ9A 2B43A 3H2LA 5D0RA 4ICLA 2MQOA 4QWEA 1OYEA 2RT3A 3HFZB 3VQSA 2ZVSA 1E6YB 2A6MA 3H8YA 2EC0A 2BRKA 3KKFA 4IO1A 4O23A 4C9DA 3SCIE 3AA8A 4LF7J 3L95X 2R8KA 1LWEA 1RTIA 2I5JB 4JI3F 1TKXA 2DBBA 5CZVA 3RRGA 2EFGA 3VGUA 4I6AA 5AJ3J 5JVGQ 4ETZA 3UDEA 3HDSA 1RZMA 4ES2A 2JNJA 3V6HA 4DSKA 3GFZA 4A47A 5L1IA 4P72A 4FYDA 2CPHA 2OPSB 4NA3A 1ZTWA 4DHVA 2YKQA 3OXGA 4I2QA 6AT1B 5HP1A 4K0KF 1IM4A 2VFVA 1Q78A 3NL0A 4OL8A 3FGVA 2BJ1A 3NAIA 2HVZA 3M05A 2MHNA 3DI6A 5ETQA 2JL9A 2H4WB 4H4KC 2ZHAA 4W90B 1UWBA 1OQ6A 4LVNP 3SQGB 4DSEA 2ROGA 2YNHA 4FYVB 2HWHA 2IRYA 4X2BA 2XYHB 2VA2A 2NZ4A 3DMJA 1T05B 3J7AN 3ZNUA 1VBXA 2HNDA 1V9OA 5K5MA 1ZZNA 2V9WA 1DBDA 2CJXB 3M2RB 4YB5A 2ATCB 3QFWA 5KFNA 3K5LA 2DR9A 2HZVA 5FDLB 3TOQA 4ZCLA 2MY8A 3ZFVA 1CJTB 1Q8KA 3T1AA 2W9BB 1OSDA 2HURA 2VONA 3ET6B 3P4UB 1TFWA 2Z30B 5BR8F 4PR6A 1RTDB 1AB8A 2FY1A 3OPKA 4CLWA 3G9CA 1IJFB 1IXKA 3OD2A 1ITPA 4RW6B 2M8DB 2Q43A 3MM7A 1T0TV 3MPDA 2DITA 1BC6A 4NI2A 2R2RA 1RAGB 2ROPA 2V8GA 3CUNA 2OTLS 4DV5J 1GXTA 3UNGC 3SV3A 1ZS6A 2HHXA 2LYVA 7AT1B 2Y8YA 3UE2A 3J7YI 4Q0BA 1H72C 1CJKB 1NH7A 5J1EB 5K8NA 2XY7A 2ZOGA 4TVAB 4TN2A 4Q45A 1UW9A 2MEWA 2OPPB 3IG1B 1IUJA 2LQJA 3L9ZA 4UUXA 2ZZMA 1B7YB 2K06A 1T8EA 5CZXA 3VZIA 3EDQB 1WG1A 3D66A 3D3BJ 1C1BB 2KG0A 2XGPA 1FWPA 3Q0AA 8AT1B 4ECWA 3MM5A 4PXCA 5AJ3F 3K7RA 1HL6A 1YBUA 2YBVA 2YWEA 2J9DE 2MY7A 5HQLA 5JUMA 1FI4A 1R0CB 3KUHA 3I4PA 3D6MB 1U2RA 8ATCB 3OTOF 2LQ9A 4Q5VA 4ZP9A 1RT2A 2PMZD 1V6HA 2HZAA 4KTQA 2HRUA 4DR7F 3GV7B 1B64A 3C66A 4JI2F 1UAWA 3M8PB 2XO6A 3VAIA 1JQGA 1TVRB 2BV3A 2KT2A 1XNRJ 2C1EB 2MZRA 5HP1B 1IKYA 2B7CB 2XSJB 4F50A 4K50A 2LU2A 2MKCA 2FVQA 3LP2B 3Q8SB 4OX9F 2OJ3A 4O0IA 3A8IA 1VC6A 4J91A 2G0JA 3L7PA 3K5MA 4WF9Q 1MN7A 2Y0SD 4X4TA 4JI4F 1HYSB 1UWBB 4JV1A 3C6TA 1LV5A 4IR1A 2Y1JA 1HQ2A 1S99A 2B9YA 4JI8F 3JSMA 3PYEA 1SQEA 1BMQB 2FHMA 3NS6A 2J9DA 4RX6A 3R2DJ 3MEDB 1HPZB 1DTTA 2F8HA 3QAUA 4NLTA 3MOJB 3HMJG 1NJIT 4ALZA 3UDVA 2C3OA 4LJMA 3MF5A 1LXNA 2VQFJ 1FJEB 2YTCA 4BDPA 3CULA 4URQU 4LRBA 3IP0A 2J76E 3ITHB 3M6UA 3ZXWA 4NA1A 1UVIA 2MKSA 2AJ2A 4J9LA 3WIUA 3JB9k 2DH9A 2OLWA 4HKQA 1WSRA 3HD2A 4H4OA 3CC7S 3ZZPA 4OYBA 3LWLA 4X66F 4Y00A 3CCSS 2HHQA 5CCLA 1RBOB 4NI2B 1X4DA 3M2UA 1R89A 2OTJS 2GMHA 3KLEA 3FRYA 2H54B 3HSZA 2PFFB 1HBNB 4NE9C 2DYAA 2GNKA 1JLBB 2YQ3A 4F3OA 4ZHRA 2CVIA 5HL7Q 2AF6A 3ONQA 2G0CA 2VFUA 1RAIB 2ZJRQ 2HNYB 1AFIA 1Q1KA 4YQWA 3OXFA 3PR5B 4KGXB 3C19A 3TZYA 1BD6A 2OIHA 4KFBA 4F4WA 2C28A 1LOUA 1M1GA 3TNVA 4YDDB 3OTDA 1VBKA 2W9CA 5DG7A 1KN6A 3VVTA 3I82A 1KLNA 1VI7A 1GX6A 4QR1A 1XIQA 1VDHA 4PZVA 2XMWA 4KH1B 2A18A 2EFNA 4JV0A 3HZEA 4M5JA 5KFUA 1JJCB 4CLKA 4DR3J 2CPYA 1FEHA 3CCVS 4HACB 5J2QA 4OYXA 5FLXY 1TK5A 2I2YA 4BCAA 4YMEA 1RHMB 4OYOA 4I67A 2JHEA 4K5RA 4F2SA 4NWBA 3BSAA 3MAQA 4F4YA 5D8HB 4DL7A 3GB0A 3KLGA 3KLVA 2KJVA 4OZ2A 2Z2ZA 2YWHA 4LT6A 2AJ1A 4UOFA 5L8RC 3T1HF 1JNZB 4OI6A 1IQTA 1AUDA 4ED4A 1RLCL 1I94J 1D9DA 2LU1A 2AP6A 3F56A 5HVFA 1WEXA 4WBFA 3UN3A 1CSJA 2DNGA 1AT1B 1VJQA 3PACA 3SSQA 4CNZA 3T5LA 4WU3A 3DRRA 4WXWA 5E41A 3I6PA 2VG7B 2HG4A 3LP0B 2EWHA 3MD3A 5B0AA 3MOZA 4OI0A 2ZE2B 3I31A 4X66J 4DPYA 2F4VF 5D77A 2HHUA 3A3NB 4DV0J 4P52A 2DR5A 4CH1A 2FJVA 3NGTA 4QIGA 5B0EA 3PW5A 2HRYA 1WUUA 4JI7J 4NMLA 2KXHA 3AT1B 2F4FA 5BXIA 5L38A 4ECSA 4DR2J 1NKBA 1RT1B 4CTAA 4OI3A 2HFOA 2HLTA 1Y3JA 4ZJQA 1H2VZ 2VBXA 3V6KA 3G96A 3THPA 1IBKJ 3B8HA 4URSA 1BQMB 5K14A 4DUTA 4DR5F 4U7UD 1Z2ZA 4LF6J 2VDHA 2PE8A 2IMWP 3TARA 4TXSA 1F1BB 2IJFA 1LW2B 1S1UA 3IS9B 4WTYA 2OMLA 1G3OA 2AGOA 4I69A 4O3RA 1GMWA 3LTOA 2FVSA 1RAFB 3E01A 4C0HA 3PO5A 4PYAA 3ULHA 4ICLB 3Q2SC 2EKNA 4I6YA 4M5NA 1S1WA 3SEOA 4CT8A 5LSLA 3M1VA 2DY1A 1NPKA 3H5SA 4F7VA 4KO0A 2XCAA 3LA0A 1FDDA 1CULA 2K1RB 4LRCA 2NXEA 2V2KA 3N4WA 4OI2A 3WX8A 2HNZA 4PQAA 5EWEA 1FO1A 3FSYA 1HD0A 2WB1D 4KQZA 4DN0A 2WK4A 3TA2A 4ECZA 2XB2D 3NNAA 1HR0F 2JLEA 5A6WA 5BR8J 1HNZF 5AXMA 4RW8A 2RKIB 1SPBP 2DPIA 3BM7A 2LEPA 4B9TA 1QUVA 4QWBA 4RU9A 1NAQA 1AW0A 5GAGU 3MD1A 4M5GA 4QBUA 2D3ZA 3M8PA 2BW7A 2JX2A 3DRPA 4M5LA 3G8QA 1TL7A 3OL7A 2HLUA 1IKVB 1C1CB 4WFAQ 2CQGA 2RRAA 2MYFA 3NGUA 2BR0A 5J2MA 2HS4A 2ZH8A 1BLUA 3A8JA 3ZTOA 3I87A 5HO4A 3MI7X 4AE5A 1KFDA 5DM7Q 3H2UB 2UV8G 4KB7A 5ADZA 3C14A 4QR0A 4DF4A 4J7CA 2NS1B 4DUZF 3VAGA 2YPZA 1X5TA 2R7OA 2QA4S 2OPRB 1P1LA 1BHNA 2MKJA 4ZVUB 1S4FA 4MKVA 4EO8A 2MQQA 3QZ7A 2PSZA 3D4JA 3KHLA 5C5JA 2E5JA 2EG2A 5CQGA 3VVUA 4YB6A 5RUBA 5HMYA 6FDRA 3MEGA 3MM8A 1QE1A 3KHGA 2NYHA 2JWNA 3BV8A 3T19A 3UD5A 1FKPA 2HQ3A 2ZDOA 2D9OA 4RO0A 4LUBA 1FD2A 2Z57B 2HBZB 3ITHA 4N77A 3CMAS 3GIJA 4OFZA 3EPGA 2ZBCA 2GCFA 2MZ1A 2ILYA 1M5OC 3I96A 4MIWA 1FJCA 1FERA 5C42A 1W2IA 2G2YA 4GO5X 3KHRA 2XLIA 3P5BP 3H0PA 5AE2A 4AL6A 2DXFA 2VFRA 5KFRA 5KFAA 3QT5A 2CRLA 5DG9A 1L5UA 1TV6B 3IM8A 4ID8A 1U09A 2ZHBA 1LW2A 1S1UB 1WC1A 2GV1A 4OI1A 3W62A 5CAAA 4K4YA 3TI0A 2H5EA 4EYIB 2IVYA 1MMNA 4ZJOA 1HQEA 4CO4A 5DG8A 5JXSA 3CCTA 5L46A 2VBZA 3U1NA 2XWYA 1SUQA 3RU0A 5HN0A 4LF9F 2DGXA 3M8WA 4OX8A 3JSMB 3K0JA 2DGWA 3TZWA 1VQ8S 1RTHA 4K0KJ 3KK3A 4FF3A 3M8QB 4U7UK 2Z56B 1KBRA 3SDEA 3I5AA 2E29A 3N5FA 1U6ZA 3M4XA 3QLHB 1S9FA 2J7WA 4Q8EA 1S1XB 1UL3A 2UXCF 3D6HB 2DGTA 3PYGA 3CTRA 1CJTA 3JTNA 3Q83A 2R7UA 5ETTA 1TUVA 2HSEB 5IOLA 4TLQA 1SC1B 3EYZA 2XO7A 2HYIB 4HLBA 4P74A 1U1PA 5K8MA 2JDJA 3OBIA 2CJ9A 2QJ3A 1ZPWX 3IBFB 4WFXA 1DFDA 3AQPA 3M9OB 1IWGA 1NK0A 1KLMA 1KQFB 2N7CA 4NLWA 4B3RF 5G0RB 2HMIB 2QZ8A 2JOQA 3BZQA 3OFHA 2V68A 2PEHA 4MIBA 1S6QB 2GVZB 2ZNZA 4OYPA 2F65A 5C24A 1TR0A 3Q8VA 4JI6F 4AXJA 3MUVP 2CNLB 4J9PA 1AXQA 1DAXA 5L39A 1ZAWA 4QWAA 4B3RJ 3HHDA 4ELVA 1T94A 2F9DA 5A8KB 2RU3A 3PIPQ 3LO3A 3QMQA 2CJKA 1BWVA 5EDWA 1KTVA 1WKJA 1A7GE 3QYYA 2MKIA 1OY9A 2ZH4A 2VICA 2UUAF 3RR8A 5KG4A 2CQHA 4OJ3A 4UZBA 3EX7B 4A8MP 2DRAA 2MJNA 4LRAA 3HF5A 4USKA 1QAIA 4UOGA 4C97A 1FJGJ 3OT9A 2SXLA 3HVWA 2J7UA 2COLA 4CLFA 2C22A 1U4BA 1SL1A 4MKYA 3BH7B 5CH7B 3J7Z5 2F63A 4RW6A 4ELTA 4OYWA 4XDDA 2R8GA 3TJ9A 2M4MA 1HNIA 1UJ5A 4HH1A 2ZH2A 4ECQA 1N36F 1GFWB 3P49B 4RZRA 3DYAA 4B9LA 3KNAA 4YB1P 4ANEA 2GS8A 1BQXA 3DLKB 3H5YA 1C0UB 3DC2A 2FPHX 2VJUA 4IUFA 3FMWA 4ZP8A 1MWZA 5FJ4A 3QT8A 3GIRA 4OYAA 2HHHF 1SUQB 1WG5A 5F0WA 5DDQC 4WFYA 1R7IA 3A1YG 1C1BA 2QC3A 1RHUB 1RWNB 5CD4A 4QWDA 5KFYA 2BMBA 4N8NA 5LSRA 2Q79A 3MEEB 1FCAA 2BJ3A 2XTJP 4CT9A 4K4WA 4C8KA 4LFCJ 1KSPA 2HQDA 1MMLA 1Z2LA 4RJVA 1KVKA 4OLPA 4HDHA 3OSPA 1XMQF 4UY85 3EGNA 4DV7F 5LXYA 4M5KA 2I1RA 2IIHA 3V81B 3PV8A 1YGYA 2J0XA 3MZIA 4IRDA 1NUEA 1NDPA 2MQNA 1PO6A 1XEZA 2HWIA 2MKHA 3CJ3A 2V50A 4EGLA 3Q23A 2XBPA 2HQGA 3LAMA 1N0UA 4CDIA 4LF2A 3SSRA 3O2IA 1CQNA 2V6AA 4A8KA 4WFBQ 3TX8A 3MXHP 4L3KA 5J2MB 1VQ9S 3VAKA 4PWDB 4Q0BB 5ETVA 3RZAA 1H98A 2GFFA 3TUJC 2ABYA 1V3SA 3CCRS 5LMUF 1SC6A 4MKBA 5T7LB 2DGOA 3TVKA 3VHQA 1AYEA 2R7TA 1HWIA 4M5MA 2DH8A 3KLHA 4JI1F 3FMBA 3K59A 4GC7A 5LM7E 3H5UA 4LIWA 3VCDA 2XZWA 4WE1B 2C42A 2G9OA 5CXTA 1N33J 4ZN3A 1LWXA 4XIUA 1DQAA 1VQ4S 1QE1B 3FKBA 2FC9A 2R42A 2IY5B 3A8KA 3U7JA 2QN6B 2V5HG 3F41A 4DSJA 2G13A 2GHWA 2GVDA 3PHEA 4CO3A 1EP4A 2NXNA 2XY5A 3PVXA 2VUGA 3G6YA 2BOAA 4WCEQ 2YKAA 2ZD1A 2ZITA 4RNNA 4ED3A 4H4OB 2WSFC 4O4RA 3OL6A 2C2ZB 3CDBA 2LA4A 3LOUA 3MM6B 2JC0A 4J9MA 4I4BA 4B3OB 4A46A 4RNOA 4D3HA 5F8NA 4LF1A 2UUCF 1CPZA 1P6TA 4PXDA 3M2UB 3LP1B 3MMCB 4NLGA 5F0UA 3TUIC 1I5OB 2X1AA 2B8QA 3KG0A 5IC4B 4IOCQ 2CNOB 2DGVA 1KNZA 1RXOB 3I0RA 4NX9A 1U1NA 1FX4A 2YH0A 1SKSA 2VG5A 1FFWB 1FXDA 1FEEA 3DN9A 4V19X 3KMSA 1S1WB 2CJQA 4HI1A 1SV5A 2BKPA 5GAHI 3LUYA 3KOAA 2KFZA 4RW9B 2MHEA 1O6XA 1NHUA 2W1BA 2FJDB 5KTQA 4AL7A 1HR0J 4CCHA 3GV5B 1LK7A 1U48A 1RA7A 4C11A 3NGKA 4ED0A 3BO4A 3TANA 4LF6F 1VQKS 1I1GA 4NEZA 3CEDA 1S9EB 1AA1B 1CJUB 1WDDA 1XTZA 2ZOFA 4GMKA 3SCJE 4LQ3A 5EUHA 2FD2A 4HHHA 1SJ4P 4B3MF 1M0SA 1RT4A 1S1VA 1Y5NB 2WRMA 3KDNA 3HP6A 4DV1F 3M32A 1YDLA 2WBRA 3UW1A 1N52B 3J81Y 4Z7YA 1HMVB 4Z2XA 3I55S 1FWKA 1LKZA 2A2CA 2E7WA 3MMAB 2BE2A 3IAM9 4DDFA 4K8RA 3EZOA 3M6WA 4X4RA 2IYIA 3CCMS 3V6DA 2IA6A 3UCUP 1FFGB 2PT0A 3GFXA 4CO5A 4GVBA 3NRBA 2ZH9A 4G6VB 2FLPA 4FVMA 2EG1A 2ZWOA 4ZCKA 4ZPDA 2UVRA 2VD3A 4OZJA 3EM1A 2LDYA 3CF5Q 3UR3C 2HFVA 1RHKB 3TUZC 4KHRA 3FEXB 3GG0A 3KK1B 3EXYA 4XK8C 5F8HA 4X4QA 3EPIA 4DBQA 1SJ3P 2UV8A 3WQPA 2ZH1A 2W9CB 4O3NA 1VFJA 5EWFA 3QLHA 5ETKA 1HWJA 3AXMA 1WORA 3K89A 4ENOA 1XMOJ 2KTQA 4OX6A 2ZUGA 4RWWA 1Y3KA 1XMQJ 3T9ZA 1QJHA 3MCMA 2PEBA 5B0BA 3NNHA 2J0WA 2FY8A 2VQEF 3HVTA 1TMJA 3BGRA 4B02A 2LCWA 1PBUA 4WYLA 4MJKA 1K1SA 2DGUA 4E2FB 1WD6A 3NAHA 2V8PA 4EZ6A 2APOA 1P8GA 1U26A 1IJEB 2X7IA 3VGSA 4Z7CA 2QL5B 1T7PA 2KZZA 2LEAA 3O1LA 4BLGA 3D1QA 1YJRA 3ADAC 5KAKA 4YFUA 3ZO7A 4DQSA 2DGQA 2H4YB 2LDIA 4ER8A 1N8RT 3FBEA 4MYUA 2EFVA 2F9JA 4WK3A 4TKTA 1TKZB 1CBKA 3BB5A 4C0OC 3R1LA 4NCBA 1G1XA 5IZHA 2Y9HA 4LF8F 1VHFA 3CCUS 1Q8BA 2XHCA 1VC5A 1IBLJ 4G1PA 2CUYA 5JJBA 3R27A 2Z2YB 4FBTA 2XLKA 1S57A 2V2VA 3BO3A 3VQTA 1KOHA 5L1JA 4X64F 5IT4A 5DZ7A 3IXQA 2QLFB 5E33A 1E6VA 4A4JA 4B9SA 1TAQA 3PKYA 3AY0A 5CA5A 3M8YA 4F4AA 3PX6A 3CWJA 3HHNB 2CZVC 1C0TA 1TAUA 4LF7F 3EVWA 1RWXB 2AHOB 3UR0A 4GC6A 3FJ2A 3MMAA 2MZQA 4WIIA 1NJXA 1TV6A 3LGMA 1RE1B 1PC5A 1WOPA 1OWXA 3WDOA 3W60A 1U47A 4RUCA 4NCAA 4O4GA 4RUHA 3IFEA 1N36J 2KFNA 2VPYB 4Q2MA 2RS8A 1WF0A 3MM9B 3V4IA 4FKXA 1R27B 4OZ1A 2FDNA 4DL0C 5J1PA 3CC2S 5LMNJ 1JJ4A 1O5JA 2E5IA 2FZGB 2PGCA 2R7VA 4EBEA 2DNQA 1TTHB 3D6TB 4EU0A 1SQGA 1ZBTA 2XNQA 3PZPA 3R9LA 5D3GA 1T11A 4P9SA 1FDBA 2W7AA 2WOMA 2OEMA 2QGFB 3PFOA 2AGPA 2BQ3A 2K7JA 3MWBA 4X64J 1I3OB 2MLYA 3DRSA 4JI8J 4P10A 3IR5B 4QZVB 5HMWA 2VOOA 2IVFB 3FFIB 3TVYA 4TY9A 4CLLA 1LWFA 1RAJA 2V8VA 4JI4J 4KRWA 2DO0A 4B3OA 1GQEA 2W4CA 1F9FA 1LXJA 2KB2A 2BBEA 4H4MB 4U95A 3BGUA 4NA2A 2KU7A 3UD4P 3HK2A 3HT0A 3RG6A 1FDAA 1SIWB 3GFYA 1FE0A 4R0JA 3W5ZA 1HBOB 3ZTQA 4ID5B 5I42B 2P6SA 1TZ0A 1C0UA 2GAGC 3EXCX 3OLAA 4J9SA 2OSQA 4Q43A 4TU7A 1WDTA 3W63A 3ZZRA 4HTIA 1RBAA 3DRRB 4CLUA 4DQIA 1L3VA 5DLFA 5ETOA 3PXGa 2H48B 1TKZA 5C7PA 2IBOA 2K3KA 5AE1A 2C3YA 4KY3A 4PRFA 5IM0A 1PCAA 4DL2A 4TYAA 2UXCJ 1WC0A 2KJWA 3PFEA 3EE3A 3R5DA 2V4JB 2EFOA 4ZP7A 1NPRA 3ILIA 4RBUA 4WFZA 1FFSB 1YVFA 1NNDA 2QRRA 1HWLA 3B6BA 3VR1A 4DU7A 5C42B 4HVZA 4DCPB 1RK8A 7FDRA 4R5PA 3GSIA 3C6UA 2VDIA 1R31A 5IXUA 3G6VA 3M32B 1APSA 4O3QA 1Y4ZB 2CNKB 5G0RA 2MSSA 2GQCA 4DPUA 1ROFA 5E3QA 4IO9Q 2KYXA 4MK9A 3OL8A 2CQ3A 2DNOA 2BX6A 2BYCA 4DUZJ 1Q5YA 1BQNB 2E7XA 3O6QA 4QYRA 2BANA 4K4TA 3ENVA 2B5JA 2JLFA 1YHQS 2C3MA 3DOLA 2RQCA 4N41A 4ATNA 1FVSA 2VB6A 1UKUA 1ZA1B 3AHPA 3UN2A 1FX2A 1HBMA 5LXRA 3RBEA 2FC8A 3CIMA 2PN6A 4P2XA 2YNGB 4OHZA 4LFBJ 1RWUA 1YRUA 2DVIA 5ETLA 3CNQP 2FJBB 2VPWB 2E7VA 1CQMA 2V69A 2YNIB 4OYZA 2ZBIA 1N0VC 1UJ4A 2WOMB 4NASA 4QYZJ 4J9OA 1U0HB 4KPCA 1XR6A 1WHYA 3ZZOA 3NGDA 3CO9A 3RBXA 1NJZA 3BSCA 3H42A 4HHJA 1QTMA 3P6YC 3IWLA 2QFIA 1AFJA 4DMZA 4L74A 1XR5A 1VQMS 2MB0B 1NU4A 3JSBA 2L9WA 4EK2A 3MUMP 4NZ0A 1J27A 1ZM4A 2C2DA 2ZBQA 2LA6A 4HEA9 2E1PA 2HMIA 3KLFA 5HQ8A 2XGQA 4RBTA 2O3DA 3MR5A 1RWVB 1SKUB 5CHCB 4KV8B 3HSDA 3N01A 4LF4F 2AV5A 2RDIA 4RWXA 1T3OA 2A2DA 2DIVA 4X84A 2XMJA 2AJQA 2MMYA 5I42A 2B3TB 4K4VA 1WKKA 2KVQE 2G4BA 5KFEA 4WZMA 2FQQB 3RUBL 3O5TB 4NRUA 1TKTA 2B6AA 5KFIA 4U67Q 3MCSA 2C2KB 2DR7A 3I0SB 2ROEA 2DHSA 3EZUA 4ELUA 2UUCJ 3GU0A 3MEGB 3MM8B 4LF5F 5KFDA 2QSWA 2BOPA 2GZOA 3PKMA 3LGNA 4J90A 3GPAA 3L7OA 3K57A 1VIOA 3R5BA 3CT9A 2X1GA 1VQOS 2E66A 4JI7F 5CABA 2YWGA 5D0EA 5KFBA 4FS1A 3M8RA 2KYZA 3HCXA 3W66A 4DZDA 3FVYA 3DOMB 3W64A 4Y6IA 4F02A 1IKWB 4TU9A 3J7YU 2X1BA 4BS2A 3SIPB 4NRTA 3M2VB 4DXLA 1C0TB 4USJC 5KG5A 1QAXA 2AZ1A 5HJXA 2E9RX 2NLWA 1JLCA 1AZSB 1UZHA 2XLJA 1W26A 2B4OA 3HFVA 3WIVA 3CDWA 4MFBA 2A10A 2V63A 1LNQA 4LSLA 5KFKA 4MYTA 3K8VA 1RT5A 4OYMA 3R97A 2VC1A 1S6PA 5M2RA 4AQYJ 1RTHB 4YR3A 3QSIA 2DTJA 4WWSA 5E3PA 2J5AA 4WE1A 3TAMB 4ZLPA 1JLGA 5HATA 1FT8A 1WC4A 5GMEA 4B9NA 1RWOB 2F1FA 5FDLA 2AD9A 5BYQA 1RP5A 4C8ZA 1KKHA 4KC5A 1SL0A 2EBGA 2PC6A 4XO0A 1TL1A 1NEEA 3FEZA 4CP5A 5IV4A 2KRRA 1B4SA 2W4PA 1UA1A 1EX8A 4NLRA 1MSWD 4ZPWR 4A8FA 3PW2A 4CH0S 2DNHA 3OFGA 2IRXA 4YB7A 2QL7B 3MPYA 2CJBA 1UWAA 3MDFA 3KXDA 3BYPA 3BN4A 3O8WA 3KMQA 4ZVPB 3KG1A 1V3RA 1PAUB 4UZCA 1FRIA 5A8KA 1HWKA 4DR6F 3BKFA 4KIAA 4HHUA 1G7CB 3MURP 1HYSA 1S49A 1RKJA 3DM2B 4FZVA 4TY8B 3UD3P 2IPOB 2BQRA 3ZTRA 3I0SA 2J9CA 2E1AA 4KHMA 3NGSA 4RW9A 5KT3A 4CRJA 1XMOF 3QIPA 1FTRA 4NZ7A 1N34J 3H5XA 3BH6B 1NSQA 2IAJA 3OR1B 1VRUB 3R1HA 1NRKA 1VCTA 3H2VE 4YP3A 1N6QB 4KPYA 4EEYA 1VRTA 2MGZB 2JEFA 2D9PA 1D09B 4LFCF 4YR2A 4OJGA 2Y3YA 4DU8A 4TQSA 2RIJA 3ISZA 4GVLA 4PG5A 1GH8A 2AQ4A 5KT4A 5U47A 1RWWB 4F2RA 3R5GA 3RBDA 4NXNF 2RMLA 3CJ4A 5E3CA 1H38A 1NHKL 2L9DA 4ZVTB 3UVJA 4Y3CA 4OI4A 3GJRB 1OMSA 1Q4RA 3DLBA 1AZSA 2KG1A 2H9ZA 4Y2KA 4O4GB 2Q66A 5AXNA 3M6VA 3B54A 3E01B 1Y5IB 4MK7A 3T9NA 1F3VA 3IG1A 1RTJB 3SFGA 3G86A 4ED2A 4PXBA 4QPXA 1GTEA 5KT5A 3P5TL 2EC2A 2VG6A 1HBMB 3IRWP 3EMTA 4KO0B 2GIRA 1HBUB 1R0AB 1AROP 1NM2A 2GX8A 2AYGA 1DARA 3PTWA 1KONA 1XK8A 1FVQA 1F2HA 5DGBA 4JP8A 2JVOA 3DKDA 4G1IA 4O44B 4M5DA 5HMXA 2J6UA 1NJWA 2HVIA 1RT3A 3FQLA 1T9TA 2M9KA 4RW8B 1YTYA 3CJSA 3DHWC 1NXIA 1VYAA 3T41A 4AQYF 2VV5A 4HR2A 2JFKA 2QO3A 2ZKTA 2GQ2A 4ZVFA 3W3SA 1GXLA 4KBIA 1IKYB 5J1NA 3AD7C 5A2QU 2W8LA 1CJVA 4RW4B 4AL5A 2FYXA 2YQ0A 2YX1A 3F73A 1FWLA 2VPZB 3TA1A 2W8KA 2KVIA 4R0EA 5IT0A 1L3UA 4LF9J 4GVBB 4K7QA 2OAUA 2XS2A 4ZHRB 3HHLB 4P2FA 3DGVA 5KFFA 2QA1A 2VL1A 1XQIA 1F9HA 3D54A 3CJKB 5KFXA 1S6UA 2I0XA 3CB4A 1ZH5A 6FD1A 2EFPA 5DETA 5C2GA 3FNNA 3KJNB 4Q8FA 3HT3A 1X9WA 2LVWA 1U1LA 4W92B 4ZIVA 1OO0B 1FRJA 5CYJA 3MEDA 4FF1A 3BREA 3IAS9 3MPUB 1YJNS 1NB2A 3UWTA 2F5GA 4DQRA 1F5CA 2OP5A 2E44A 4NMXA 1IVZA 1FRHA 2WW4A 3AOBA 3JS9A 2KM8B 4E0DA 4RNMA 3G87A 3KHHA 2OD4A 3CJRA 3A12A 4PAAA 5F8GA 2WTFA 1YJVA 2CDQA 1TK0A 3CC4S 3TO8A 1T9WA 5KOWA 4ECVA 2XEXA 1EARA 3ILOA 3MEKA 2FHOB 2CPEA 3S1TA 3PIOQ 3I4HX 1WHXA 2YXLA 1QM9A 3CMQA 3S7RA 1VLYA 2QV6A 3GLJA 4W4MA 4R8UB 1UETA 3OHBA 3KK2A 1JLAB 3MPVA 2F8EX 4I56A 3LGHA 3DLHA 2W2QP 4OHWA 1M5VC 1NZAA 1NSKL 1YG0A 2Y0BB 1X8DA 4F3MA 4A8QA 5JMNA 4EI2A 3CSKA 2ZHOA 2I8EA 3DDNA 4W98A 2CQ1A 2OI2A 3TP2A 2WAQD 4JV5J 3I9V9 3V6JA 5IT9U 1HPZA 3KFWX 2P9GA 3BGOP 4G1QA 2MQPA 1JWWA 4OYIA 5KG6A 1S10A 1RJJA 1ULRA 3RGIA 3TUPA 4DQQA 2AZ3A 2BACA 4LFAJ 3CJ0A 4M5DB 1ZYQA 5K20B 3LALA 1TL3A 3G6ES 4L73A 1FK9B 1RT6A 3GFHA 1HNVA 3MMBB 2ACMA 1PSDA 4PG7A 3ISNC 4ZA1A 5HLFB 2AYMA 1D0EA 2N4DA 5IT9Y 1W25A 4GKKJ 3ENAA 2Z2MA 1QSSA 2BKOA 2E5HA 1TL7B 2R3VA 3B82A 4WP9A 1UW4A 2DT9A 1C4CA 2MLXA 4OHYA 1V3ZA 4NYOA 4J9NA 2ACYA 4HDGA 5L9XA 4KV8A 1JKHB 1TP7A 2YKMB 1N5QA 4ILRA 2C3UA 2V34A 1WJ9A 3L4BC 4LBHA 3TJ8A 4Q44A 3ENWA 2DHGA 2YNFA 4RL1A 1HIYA 1SKRA 2C2RA 1R6YA 3CJ2A 1VK3A 3BKUA 4J37A 1X7VA 4P7VA 3O3LA 3W2WA 1S97A 5HQMA 3OR2B 1HKAA 2YQ1A 2IDEA 2RHQB 3KG4A 3C2PA 2EXUA 1PIEA 5HSPA 1PJ6A 2JRSA 4L75A 4RW7B 3OVBA 3QIPB 1XN9A 2FGOA 3VAHA 1FRMA 1S9GB 4OV6A 3HO1A 1RWMB 4DI6A 3GJQB 1GK8A 2EEYA 5KFGA 4DL4A 2V8DA 3NMRA 4QOTA 2A1BA 1JLFA 1KS2A 3OFEA 1OSCA 8RUCA 3ZNJ1 5KFQA 3K5NA 5EWGA 4G3IA 4RNFA 1SJQA 2ERRA 1L3SA 2HK2A 3T1YJ 4CQ1A 1TL5A 2VKZG 2IBKA 2CJAA 3HI9A 1REGX 1BQMA 3HKZD 2BEFA 3MR3A 2ZDPA 3CDAA 3FBFA 4FDFA 1RBLA 1S4EA 1VRQC 5K8OA 3IO1A 2W2MP 1XNQJ 4R8UA 4HYKA 1KOOA 2H5JB 2JSXA 3A8EA 1TUWA 3IS9A 1TMMA 2NUUG 3QQCD 1WOOA 1U6BA 2D1CA 3CPWR 3EGZA 4ZVRB 3KWMA 1UZDA 1DHMA 1QTNB 1NPPA 5DO2A 2PDAA 2J6TA 2QG9B 3AAWB 4DV3F 1DURA 3OVAA 1D9FA 3DLGB 4DR5J 2B56A 1QAJA 2B0GA 5GAEU 3GV8B 5KFJA 1R0BG 4U96A 4ZPCA 4DJBA 2IAJB 1S6OA 1VMBA 2CQIA 2WBMA 2YX7A 2FB0A 1I51B 1WC3A 2Z4PA 4DR2F 4LF8J 2ZM6J 4DR3F 1URNA 2CQDA 2OEKA 3TJAA 3WC2A 1UCNA 4QIVA 4DCJB 1U1KA 4K2XA 2YY3A 4C8LA 3IRXB 5A8RB 1WELA 1WNEA 3Q8PB 2NYIA 3ZZTA 2WVDA 2Q6CA 4EBCA 4DS4A 5K14B 1X9MA 3BDEA 2F4VJ 4FPRA 2C2OB 1IKVA 1FTCA 4OIXA 3UVJB 3PJ9A 3IWXA 3M6XA 4AT1B 5ETPA 5DDRC 1R3NA 3AODA 4N56A 4X4VA 3DXSX 2ZBRA 1YWXA 4DR6J 1T03A 5AT1B 5ETSA 3ZZ0A 4DV4J 4TYBA 2FIUA 2MZTA 1NMEB 1TL4A 3E3XA 2AWZA 1RHQB 1RTJA 5DDOC 4USIA 4EUVA 2ZOMA 2H51B 1YK9A 3DM2A 2RJZA 3RJMB 2EVZA 4FP9A 3NWGA 2IA0A 2VG7A 4IG3B 2HBYB 2D41A 3QATA 1WOSA 2LFVA 1O51A 1UEKA 3NEKA 4ZMMA 4ED1A 5DGAA 3CCZA 2ZC3A 3TQ1A 1GAOA 1LWCA 1Z4UA 2M8HA 3LH2S 2DIUA 2GMJA 4A8OA 2Z8QA 4YS2A 4PPZA 3RB3A 4OQJA 3HJVA 1LWFB 3R7NB 3W61A 1X5PA 3BPSP 2VQFF 1SBRA 3D9BA 3MM6A 4B9MA 2R7RA 1C1CA 3A13A 3MUTP 4B9VA 3IM9A 3ELHA 2WVFA 1J5EF 2FHKA 3D67A 1WSVA 3AQOA 2AKWB 1Q8IA 3HHLC 4MAKA 1IWAA 1MG7A 3MFHA 1UA0A 3C14B 3HX9A 3DLKA 4PG6A 4JV2A 2HIYA 4URGA 4C8OA 3VZHA 2UU9F 3T6JA 2M7SA 5C2CA 3BQ0A 4ZDNA 2QA4G 1A6LA 2VH7A 4MK8A 1S6PB 1KHWA 4B3MJ 2XNRA 2Q3PA 1B70B 2VASA 4QYZK 2ZVIA 2DNRA 1HARA 1HHQA 3NG8A 5E0OA 2ZJQQ 1H6KX 2M2BA 4FNIA 1IBMF 1RI7A 2FJWA 1S7HA 4P7TA 2DH7A 3OR1A 1G2EA 4Y2MA 4JI2J 3QGIA 2W4DA 1FF2A 2CQ0A 3DDIA 1P1TA 4JUZA 5DJBA 1BXNA 1T3NA 4O3SA 1C2PA 1CG2A 2IC3A 4DEZA 1R8HA 5B0DA 4P73A 5J2PB 1HW8A 1RT6B 3MMBA 3OTOJ 2LXIA 2UUWA 3IRXA 5A8RA 1W2BR 3WX4A 1UP1A 4MTPA 1Q79A 5IC6B 4WJBA 3RW7A 2YKNB 4DPTA 3C46A 1P27B 4K4UA 1RU1A 2CQ4A 3DLEA 4Z37A 5EGYA 4PG8A 1YRXA 3JYTB 3GTYX 4JI5J 2HGNA 1BQNA 1BE4A 3K5OA 3QGHA 5HVGA 1YJ7A 5ETMA 3W9IA 4KYZA 3D2WA 2OKQA 4L72B 1N48A 5HBMA 3N28A 3O44A 3CJKA 3TEHB 4OX7A 4LF4J 3RW6A 4ZCIA 4ZN1A 2L9NA 2BDPA 4FKYA 3Q2TC 4JI0J 3I32A 4C3LA 1X5SA 2NXCA 1U1RA 4NCGB 1U6FA 2BZ2A 4KFBB 3HKWA 2HNZB 5MAOA 3KK1A 3FSXA 1UVNA 4FXDA 1XNRF 4C3MA 2CPIA 2V8HA 2NR0A 2YNIA 4WP3A 4ZVQB 1Q7YT 4DCOB 4F67A 4EZ9A 1KDNA 1GEHA 1PYSB 4DPWA 1M5PC 4GKJJ 2AJ0A 2BJ7A 2LQ5A 3DOKB 2VJVA 3EICA 1WG4A 1U0SA 4I6WA 3HSJA 1RGVA 4KH0B 2XYGB 2E5LJ 3D68A 4XPEA 1TFYA 3PJXA 5KFSA 2R9LA 2DISA 4DOZA 2G1DA 3DRPB 4KGVB 1FESA 4P6QA 4QJVA 3OUYA 2XMTA 4O3PA 4QWCA 3KTQA 2RF2B 2W2OP 4PCQA 4DV4F 4NLQA 2AX1A 3TR5A 3GILA 3D0GE 3ILLA 1U45A 1JIHA 1VC0A 2NCKL 4HH0A 2YX4A 3BPDA 5M2PA 2AT1B 3PHTA 1R8CA 1PILA 2U2FA 3NGRA 3Q8YA 2VC0A 1FXRA 3ZZZA 5GAGI 2D3O1 2D3OR 1VLOA 2WSCC 2CG8A 3PM9A 3POTA 4IFVB 1RA6A 1FXLA 3SFUA 3T6BA 3B4DA 1Y11A 4AYBD 3HHKA 5KT7A 1N5SA 2MQMA 3MCNA 4F4ZA 4RW7A 4JOUA 2ZH7A 3GG1A 3JTOA 4G1QB 2JLGA 2O5DA 3AD8C 3ETOA 3A3PB 4CIOA 4CLSA 2DD8S 4R25A 3M8SA 3CXCR 1S77D 2KXNB 1U49A 2L08A 2M5YA 2A0FB 1MROB 4G65A 3S6EA 5J2NB 3BGFA 2H3EB 3ET6A 4F4KA 1S48A 4ECXA 2ZD1B 2R2UA 1UMJA 4DN9A 4ZKAA 1S1VB 2K2PA 2HGLA 2P5VA 2PIIA 1FRLA 1KEKA 2HHTA 4OHVA 1UTAA 1F0XA 2VKRA 4IFYB 2YKNA 1GMUA 4ZLNA 4NXMJ 2LECA 2U1AA 1WC6A 3GMGA 5A8WB 5DM6Q 3K8WA 5G4DA 1HNWF 1HHTP 2GQQA 4KSEB 1HHSA 1Y7PA 4OHXA 1X31C 5K9FA 4ZLJA 5A2QY 3KUEA 3C3LA 2IDLA 4I0WA 4O0NA 3W1YC 3KLHB 1HNWJ 2J8AA 3OSNA 4EBDA 1JX4A 1JXEA 1T9XA 2DHHA 1JLGB 1UVKA 4NCGA 5IFMA 2KT3A 4WKRA 2BW2A 2F8MA 1FKOB 3K5PA 3MAAA 2FHJA 4UQGA 3BQ2A 2ATLA 2FZCB 5F9LA 1JJ2R 1VR6A 2WSEC 5KFCA 2Z2LA 1V5VA 4FS2A 2B9XA 3HJFA 1RAOA 5GVQA 1TL3B 3DRSB 4PWUA 4YY3J 4DR4F 2CG4A 5F8MA 3LAKA 1P9QC 3HVTB 1GMVA 1NK9A 3RRKA 1QLNA 3ICLA 3G71S 4YN3B 1YJ9S 4I2QB 2E1MC 4QU6A 1Y10A 3GYXB 4CM2A 2CADA 2Q6BA 4OZ3A 5C24B 3Q8QB 5KG7A 4JI6J 2ALYB 4KR0B 3AJ2A 1URRA 3BR9A 4WK1A 5EX0A 1SI9A 3MGJA 1M5HA 2XYPB 2IJRA 2MTLA 5F9NA 4IOAQ 5DQGA 1H0HB 5IWAJ 1DLOB 1CC7A 3U02A 1YJWS 1N5YA 4KT0C 2DHXA 3GYGA 4C6AA 1VISA 2BXJA 1FJ7A 1YX2A 4RBVA 1D8YA 4ZIWA 3H40A 3G82B 2E9ZA 1JJHA 2P8IA 1WEZA 3FDSA 4U9RA 3OXLA 4K5SA 1FKAF 2DXEA 2W01A 5H9EK 1K0TA 1RTDA 3SI8A 1Q7LB 1MLAA 2ZUAA 3VV2B 3CDEA 3KDOA 4MKAA 5F8LA 3C8YA 1U7LA 1OY8A 4LQ9A 3KJVB 3B4MA 3HVAA 3N6NA 3BYRA 4U8YA 4B3TF 2AEJA 3UPFA 5A6PA 3NCRA 4DF8A 4JYAJ 2BE2B 4JI0F 1X5OA 1SC4B 4PPDA 4ZPTR 5BYRA 2M52A 2MZSA 2ZH5A 1G6BA 2V94A 3GONA 5J1EA 2H65B 4F04B 3Q8UA 3MR2A 3PRBA 2XQCA 2YNFB 3EGVA 3C15B 4DG1A 4ED8A 4GKKF 4J5OA 1NSAA 4A8XA 3X3UA 1MU2A 2NXJA 1SKWA 1S79A 2HNYA 4KKOA 3CJ8A 3OR2A 4CM0A 1NDCA 4IG3A 3MEEA 3QIDA 4KGMA 2R7SA 3FCWA 3QO9B 4RU2A 1FKOA 2BJDA 2KHCA 1RQ0A 4C2MA 3QAEA 2NXUA 5CYQA 2R2TA 5DZ6A 3DOKA 4B08A 3RB0A 3AJDA 4JV5F 4F3QA 1U8WA 1E6VB 2BABA 3CDUA 1VS3A 2MJUA 3D6FB 4OJ1A 4FPIA 3BGRB 4WXOA 3WC0A 1TVRA 1MN9A 1SCJB 2NUHA 3R5CA 1Q0NA 4EWTA 3QJLA 1IKXB 4X4UA 4DSIA 2HPUA 1OS5A 2XMKA 3LP1A 2YWFA 3MMCA 4QR2A 5GAEI 4X65F 3BR8A 2CAJA 1B0VA 2FJAB 2ZNYA 2BM0A 3UNYA 4ANDA 5CD4H 1TK8A 4NPOA 4GRSA 2UU9J 2CWKA 2NSBA 2XS7A 2QL9B 2UZAA 5D4PA 1S0OA 7FD1A 1MMDA 3D1HA 1OY6A 4B3SF 1RKIA 3ZTPA 3N9UC 1DLOA 2OEJA 3DLGA 3M8ZA 4NOHA 1RLDA 4OZNA 2NSCA 4CNYA 3D0HE 3R5JB 3JSYA 3DCAA 4TNOA 3MECA 4U6PA 1S0MA 3R6LB 3QT7A 2HAIA 1RT2B 2ILZA 2MZJA 3EGWB 4OLOA 3NWRA 1B0TA 4U8VA 4A48A 1X4AA 3KLIB 4C3KA 1SJRA 1YBAA 4J9UE 4Y2AA 3R7BB 1RT1A 3P45B 1KHVA 4C98A 3FCHA 2LXUA 2YH1A 2L3MA 1L3TA 3NBPA 2G1HA 1L3KA 3OUYB 1RYSA 4DUYJ 2BUNA 1R43A 2XC9A 1C4AA 3L7UA 1RAHB 2CKWA 1TELA 1HQUB
chains in the Genus database with same CATH topology
3V6DB 3CD7A 1GTHA 5B0GA 3KLEB 2GO8A 3OQ2A 2RRNA 2KXFA 2EKYA 2QLWA 1DJ0A 4IRKA 3BDPA 3AJ1A 2GW8A 2W7PA 1XC9A 3DOLB 3SV4A 1HA1A 5B08A 5I4MA 2NPIA 2UXDF 2IVMA 3SCKE 2EI5A 2QFJA 2YNGA 4P2SA 4ZPVR 3HZGA 3I56S 4C11B 4C8YA 2FHJD 2CZ4A 1ZAVA 1NKCA 4ERDA 2HW3A 2V4JA 3OJUA 2CFXA 5AXKA 3DRYA 3H25A 1JLEA 2ASYA 2DCLA 3CJ5A 1HMVA 2GJ2A 2XG8A 3PNIA 1RT7A 4BWJA 3PX0A 1DZ5A 3LQVA 1T02A 2VFSA 1HBNA 2KRBA 2FJXA 2CPFA 1WEYA 2E9TA 4EYHB 1Q81T 4NLPA 1S1TA 1IBKF 2YKPA 2PA8D 4UQTA 2OH2A 2POKA 3MTKA 3DMJB 1T05A 4WU2A 1ZPVA 4PQUA 2FJEB 4TLRA 1FNOA 4X62F 1N5YB 1TKDA 3I5BA 4A8WA 4ILMA 2RUGA 3FZBA 1R8BA 2LEBA 3IGNA 2J0QD 1VRUA 1MROA 1FJGF 2R4FA 3ZZUA 2MGZA 2RU9A 3FFIA 2VODA 3JTPA 1N5VA 4NZ6A 2XI3A 3HPOA 3RB4A 3NLCA 1K9MT 1IKWA 2QA2A 3I5CA 2JEGA 4L6V3 3VWSA 1VK8A 1KQSR 3JYTA 1N56A 4CI0B 4F26A 5KOXA 5MLCV 5L1KA 1QSLA 4NLOA 2VG5B 1MW7A 5B0FA 5HROB 4Q2LA 3GQCA 1U25A 2QE5A 3MM9A 3V4IB 2ADBA 2KKHA 3TVZA 1WHWA 1LK5A 1XMBA 2HS3A 1IQZA 2LLZA 2KH9A 3UI3A 2XCPA 4RKUC 1B0PA 3BQ1A 3GIIA 3BSNA 4DR1F 3CCES 3V2UC 3H59A 2V4QA 3OJSA 3DU5A 3TAPA 3MPWA 2WHOA 3J80Y 3N6MA 3IC1A 4M8LA 4QIWD 1NJZA 1QSYA 4FBTA 4ES3A 4YY3F 3KYLA 2DNPA 4DLEA 4N47A 4PKDB 2P9CA 3S8SA 1ZM2A 3P96A 3C6UB 1KC8T 4I2PB 1NK4A 5KG2A 3MM7B 3I9ZA 4OZ0A 2N4CA 1X4CA 3LPYA 3M2VA 2Z0GA 3HHLD 5EX3A 2D7SA 4DQPA 1LFWA 3U1MA 4H4KA 1SL2A 1NK8A 5I3QA 4A8SA 4MFBB 4BWMA 2KDOA 5FD1A 3J7A1 1QVGR 2UUBF 3MHYA 2E5GA 3PX4A 1JK9B 2MDAA 2RILA 3RB6A 1K1QA 1MU2B 2O1PA 2VPXB 4NLYA 5D78A 1K8AT 1E6YA 4WZQA 3PEJA 2HGMA 1D3WA 2AGQA 1Q86T 3BGLA 4AXIA 4KAIA 1X4HA 4HT5A 3RAMA 1LWCB 3T3FA 4IDKA 2RVJA 4QPTA 3GIKA 5CYQB 2PMHA 1A9NB 3HXMA 5I3UB 3FRZA 5HI7A 1SIZA 1UFWA 3DNCA 3HLUA 4XAKA 4TU8A 2JEIA 1YSJA 2CQ2A 4OV1A 2GHPA 2IM0A 3QWPA 3DDKA 2RF2A 5CYMA 3OTBA 1R8PA 1HNIB 2IMOA 4K4SA 3CD6S 4FNHA 3E8OA 1DQ8A 3ZC4A 1HQUA 5E5NA 1OQ3A 1F5BA 1Q8LA 2LMIA 3LANA 4EFAC 5IQ6A 1GT8A 4DV5F 3IN5A 2BANB 2BQUA 1HQEB 5KFVA 1VGYA 2E1RA 5KFTA 3VAFA 2FUG9 1SH0A 4M94A 2AX0A 2LQBA 1HBUA 1R0AA 4PXEA 1X0FA 3RYLA 3MAHA 2ZKUA 1UEUA 4O44A 2XI2A 4DL5A 1N4LA 2C3PA 1XWLA 3RAXA 2OFGX 4ITSA 1NKEA 5I3PA 2DGSA 4GKJF 5J2QB 5KG0A 1MWYA 3GWCA 3WBZA 5D6GA 4QW9A 2QMWA 1IR0A 4NLDA 4NLUA 5B0CA 5DQHA 5K8PA 3KLGB 4PWDA 2J0SD 1JLBA 2B4UA 4J9KA 1ZTTA 3W7BA 3BO2A 2R7WA 3NCQA 2ASLA 2FVCA 2B5JB 4FBUA 1S0VA 3CCLS 3M1VB 1UVMA 2MKKA 4TQRA 2DNKA 3UCZP 2UUTA 2AW0A 2FLOA 3MM5B 3M8QA 2ADCA 1N88A 1NK6A 3E51A 5D3GB 1KQKA 3QO9A 3S01A 1KVIA 4BHQA 5F8IA 1XBWA 4WKYA 3G8SA 1JNRB 1NO8A 2VOPA 1YI2S 1Y5LB 2V0NA 1SXLA 3DRXA 4NLSA 4YDXA 4LSNB 3BSOA 5IWAF 3HHEA 2K7KA 3KLIA 4ZOSA 4DSFA 4A8YA 4ELVA 2J6SA 3G6XA 3NBPB 4OJHA 1S72S 2BA9A 4UUWA 2D74B 1WI8A 1LFPA 2NREA 2XSJA 1TQLA 1X0PA 1BGXT 2GIQA 2GGPB 3GR1A 3R5AA 4CO2A 1J5OA 4ILLA 4LSLB 1I94F 4BC9A 2RB7A 4LIRA 1S1TB 1UEVA 2KHDA 1SH3A 4OMFG 1YITS 3POTB 4IFVA 2M88A 5KG1A 1RT5B 1Q82T 5L1LA 1FHTA 1SJ1A 4IH7A 4WYWA 3TAMA 3LF0A 5KFWA 1FKPB 2CQPA 4CZCA 2XMUA 5KT6A 4M1KA 1S9EA 1UVLA 1U8SA 1QAYA 1O0PA 1NK5A 2R2SA 1RT4B 2FTRA 1M90T 3DU6A 2W7OA 2KI2A 3CD0A 1KLMB 3LWMA 2RH3A 3V4MA 2MPUA 3QGGA 3E2EA 1S6QA 1DQ9A 3NP5A 4WFNQ 1RISA 4ZP6A 5AE3A 3HHLA 4OZLA 4DG1B 1ZZFA 2F7VA 4IH5A 1KTQA 1VBZA 2B4VA 3BJYA 3T5JA 1K0VA 3OVSA 3OHAA 4ED6A 1UVJA 4RNHA 4ECUA 3HFKA 2HZCA 1UFLA 5KFPA 5FIIA 2ZH6A 2EFQA 4HTJA 1S1XA 4IG0B 3MECB 5C25A 1KRPA 4LF5F 1DTQA 1TKXB 4ZVHA 3UDLA 2LKZA 3ISND 1HNXF 1N6QA 1RT3B 1VQSA 2HWTA 4DFMA 2ZM6F 2I9SA 4PG4A 3M30B 2HHWA 2GA7A 1JLFB 4I2PA 1WTBA 1CLFA 4RUAA 3G4SS 3AB2B 3PJWA 2DNZA 2DNYA 2F3JA 2PI4A 2RSQA 3K2YA 1VQLS 2BRLA 2KN4A 4D3GA 1H2TZ 2RE1A 4M95A 2DNMA 3KK2B 1JKHA 1T95A 2YKMA 3H4DA 5CCMA 5LJ3Y 1GX5A 4ECTA 3I0RB 2N3OA 2MQLA 4M63A 5F3ZA 3FSIA 4ZVGA 1D1UA 3P3DA 2AU0A 3K58A 2VG6B 2X3GA 4K4XA 2ZE2A 4FF2A 5IQQA 1BY9A 5B09A 2CQBA 4Y28C 3FEYB 1RYRA 2CPDA 2PO4A 5B7WA 2KFYA 3GR0A 4DL6A 1N32F 5D4LA 4C0BA 5GADU 4RLEA 5EN1A 4GO7X 4CTAB 3OL9A 1FK9A 5F8JA 2XMVA 2O67A 2DNLA 1CVJA 4FVCA 4I7FB 3QZ8A 4K59A 2UVWA 2QEXS 4E98A 1U24A 1O8BA 3DYAB 1KFSA 1HI1A 1I6JA 1SJFA 1U1MA 5IS2A 1PGZA 4MIAA 1H3DA 4FXWA 5HROA 2QMXA 3UDCA 2R7XA 1N5TA 2B7BB 5LL6d 1KQGB 4CO1A 4ZCMA 2K8GA 3CE8A 1ZM3A 1H2UX 2OFHX 2UVUA 3US5A 2JFDA 1B7FA 3B78A 4IOBA 4EO6A 4F4XA 2EPIA 5KFZA 5M2UA 2M70A 3SYZA 3DFEA 3ZZYA 4U7CA 1DTQB 3TW0A 4N5SA 4KGKA 3T5KA 3ENQA 4J9RA 3V81A 1KD1T 2DJWA 5H9FJ 4LFAF 3IBWA 1EETA 1HI8A 5HLFA 4PUOA 4YR0A 3JSRA 4ZPAA 4YUDA 3OV7A 2DK2A 2X51A 2O66A 4KE5A 1ZM9A 2PI5A 2GC8A 1RT7B 3H98A 4HT7A 3NMAA 3RAQA 2JC1A 1OIAA 3KNGA 5F3TA 4QW8A 2UP1A 2QIFA 2HIQA 4DFJA 1T03B 1KR4A 1NHVA 2EW9A 2KO1A 3OLBA 1X4FA 2CPZA 2RQKA 1J2VA 3MR6A 1YIJS 2OPRA 4LVOP 3SXLA 3CD5A 3D0IE 3PY8A 4Q7AA 1FE4A 4PQUB 1QUPA 4ECYA 1SV5B 4I1TA 3D28A 3QJJA 4USHA 2HHVA 2GMLA 5KFOA 4B17A 5SUHA 3F44A 2ASJA 5DLGA 3JAMY 5KFMA 1NH8A 4DX8H 5I3UA 2FVPA 4YHHF 1EP4B 1M5KC 5DQIA 4B9UA 5THWA 1VQYA