4OZ4A

X-ray structure of the dc8e8 fab apo-form crystallized at ph 8.5 and refined to 3.0 a.
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
220
structure length
220
Chain Sequence
b'EVQLQQSGPELVKPGTSVKMPCKASGYIFTDYVISWVKQRTGQGLEWIGEIFPRSGSTYYNEKFKGKATLTADKSSNTAYMQLSSVTSEDSAVYFCARDYYGTSFAMDYWGQGTSVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab of monoclonal antibody, heavy chain
molecule tags Immune system
publication title Identification of structural determinants on tau protein essential for its pathological function: novel therapeutic target for tau immunotherapy in Alzheimer's disease.
pubmed doi rcsb
total genus 43
structure length 220
sequence length 220
chains with identical sequence H
ec nomenclature
pdb deposition date 2014-02-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4oz4A01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4oz4A02
5ACLA 4LHUD 5D5ME 3I02A 1YNKH 5T1MB 4X7SL 5C0IA 4PR5B 1K4CB 3C5JB 4UZGA 1V7NL 1OAUL 4HPOH 5LWYH 1JZ8A 1X4XA 2C3WA 2EO9A 3STZA 5JORA 3E6HB 3I2CL 4ZYKB 1W0WA 4MHHI 3NIDE 4BSVA 2EKSA 3CLEH 4XCFH 3WJJA 3IVKB 3QDAA 2R0LH 5E2TH 3P4OB 3D39E 4YQXH 1ZSDB 1EZVX 1Y0LA 2JELH 2DN7A 1DCLA 1PG7L 5CIPA 4GRWH 4DQOL 2VTFA 5BZWB 2YBRA 5DJ6A 4AENA 3U30B 1HNGA 2RR3A 4I4WA 4LU5H 1QLFA 3BQUB 4FQXA 4NZUL 2J8HA 4NN5B 4YZFE 2ZUYA 5DO2C 3O11A 3HZYA 1RZKH 5L2KD 2DTSA 1P2CA 5D4QA 3ARGB 4MWFA 4TVPL 3T3ME 1RZJL 1TJHH 3BP7A 1G0DA 3G5VA 3VXRE 4NQDE 4YBQC 1DSFL 1HSBB 1JPSL 1C5DB 5BS0D 2IH1A 3MOAL 3BKYH 2B0SH 1BQLH 2IALB 3DX7B 2O5YH 4OFVA 4JN1L 5IGXL 3P9LA 5E8PA 4I3SH 4I3RH 2LU4A 3T65B 4GKSA 3JTSB 1TCRA 2HG5B 4PRID 4Z8FH 3R8BB 3RX8A 4JZJA 3TN0B 3KPNA 4M5YL 3FN9A 5I17B 2ARJB 1DEEA 4TTDC 4OCMC 2EDJA 5K9OB 5B8CC 1M05A 5FK9A 3SDDD 3O2WH 3RWJA 5F3BB 2UZIH 4TVPH 4LVHB 3VGEA 5IQ7L 2HLAB 4MAYA 4NZTL 4RAUA 2EC9T 5IB5B 2Q6WB 1YN6A 4M6NH 1T2QH 2I24N 3RWIB 5KW9L 2AEPH 3OL2A 5F3HB 5BRZB 5HYQA 3MV9B 4WNQA 2Y4SA 5FB8A 2G5BA 2CJUH 3HE7B 3C8KA 3FTGB 3A0OA 3VXRA 4YHYB 1MCPH 1FZOB 2LAGB 5KG9B 1FPTL 4YQXL 1HXYB 2BVTA 5IOPB 4QTHA 3RL1A 3RWCA 1JK8B 4OCXH 3RWDA 1ZVSB 1ZWIA 5CINL 5SX4H 1MJJB 4XB8A 2R0KH 5D2NC 2X9WA 4FABH 3V6OA 2A73A 4JKLA 1V7NH 4U1LA 4YR6B 5LWYL 3WSQH 5C08B 1R0AH 2X4PA 4OZHE 3KHQA 1I1YA 4AT6A 1RAMA 2PW2B 2YPVL 3TBWB 2JB5L 5T5FH 4X6DA 2A9ML 2MKWA 2PO6D 2P8MA 3T2OA 2JJVA 1F3JB 1KTKE 3GI9H 1FAIL 2FATH 1SJEB 3QAZC 1MF2H 1U58A 5EU4B 4NO2B 4M4RA 1GOFA 5J57B 1AKJA 3BPNC 3BO8A 4JHAH 3W11C 4ODBD 2BVOA 4KPHL 1KC5L 3Q5YA 4JLRB 1FRGH 3ZMRA 1ZA6B 2VH5H 4Z7UE 2PXYB 1SYSA 5I0DA 4U7MA 4F7TB 5AG9A 3FFCA 4KKCD 1VADA 3UBXI 1WSST 4CU8A 4D2NA 5I1HL 5HHMD 3E3QC 1AKJD 1H15A 1W72B 1F3DH 4LPVA 1AH1A 4JVPA 3RWCB 2WUCL 1ACYL 3DUSB 1IBGH 4Y1AB 4YO0B 3IDIB 1R3KB 4OLVL 5D96C 4DGIL 2JIXB 3BP4A 3QAZB 1D5IL 3TVMB 2H2SC 2VDRH 5EOCH 4S11A 4JJ5B 2I5YH 1MCJA 3DO7A 4PJ9A 2FBJL 3WJJC 3BZEB 1U8KA 5IIEB 5SWZB 3BHBA 1T1WA 1OL0A 1QNZH 4ZAKC 3VD4A 4UU9B 1T0NB 4YDJA 2AJVH 2Y06H 5BCAA 5HD8D 5C2BH 3DYMA 4B7LA 4EBQL 4JO3L 1FN4A 5HGDA 1RZFL 4ODHH 3OKLA 4NO3A 2C7UB 2FJGA 1J8HE 2ZUVA 4L4TD 2P5WD 2Q76A 3DRQB 2YPVH 2BSTA 1DUZA 1A64A 5I1IH 1N59B 5ISZA 1XGUA 1OW0C 1A22B 3MA9L 5J89A 1WZ1L 3VXRD 3L95A 4I3GA 3GRWL 4OCXL 1HILB 4V1DD 2ZOLB 4XWOC 5DJ0A 3C6LD 4G8GB 4XNUH 5F7DB 4KDVA 1FIEA 3GSUA 5ID0B 2WQ8A 5F7HA 5HI5D 1PLGL 3G5ZB 1T80A 3HI1B 1WT5A 4LAQH 3GSRB 3RPKA 4LLMA 5HYIA 4HG4J 1Q38A 1JV5B 3RJQB 3MRFB 5HI3D 3SO3C 4OM1H 2HJLA 5JPMB 1ROWA 3O4LA 5CHNB 3AC0A 5GGSA 4JHAL 4K7PL 4Y2DA 4PJAA 1C7TA 2LE9A 1DVFD 1U3HB 3PWPA 4G43A 1MPAL 3VRIB 2WLYA 1CFVL 1I3RA 4OZFH 1BLNA 2EDXA 3SKNA 3GHBH 5JXEA 5F1OB 3HC4L 1OAYL 4O4YH 3ZL4L 4R4BA 4DVRH 5IEKA 2F53D 4KY1L 2YRPA 3M45A 1R0AL 4JM2B 4TSCL 3U0WH 3IXAB 4R4BB 4H0GA 3PL6A 3QB7C 4CDHA 4WDIA 3WXVL 4D0BB 1KPUB 1QBAA 1MIEL 1GRWA 1UYWL 2B5IC 4G6KH 4QHKI 1E4WL 4XGZA 3GKZA 2R2BB 2XZQL 2DTMH 4QF1B 1INEH 4G7VL 2MSPA 5GGSB 4UTAL 1N6QH 5I71C 5EUOE 3ZKSD 1FE8H 5MI0B 3PQYD 2W0LA 4IRSD 1MHCA 4YXHH 3EO1A 3P30H 1J1OH 2ZJSL 3DRQA 4NN5C 2AXHA 2I26N 4YXLH 2H1PL 1W72L 1YPZB 4BUHA 1LEKB 2X4RB 1DLFH 5TF1H 5D2NA 5BOZG 5ITBH 3BZDA 4DTGH 1S9YA 3BT2L 1N8ZB 5H8DA 3F7PC 3ZE0E 4AIZB 4Z78B 5IFJB 4J8RB 1KJVB 4G42B 4XCNA 1OTTC 1V05A 3CFDB 2XRAH 3X14A 3VFOB 3V0WL 3TH2T 1RZJH 3EDEA 4MNGE 3ARPA 4GW1B 1NL0H 1U92B 4KRPC 3JWNC 3U2SB 3OR6B 3O6LH 2EYRB 2Q8AH 43C9A 1U9KA 2X42A 1RUAL 4EUPG 1WAAA 2IQ9L 1MLCA 5I2IB 2PYEE 1L0QA 4JN1H 5IGXH 4XVSL 2I27N 5DFWH 4PJ9B 4PLKD 2CUHA 4UQ3B 3RX7A 5DHVH 6FABH 5BJTA 3UPRA 5M94B 2CRYA 3KPMA 3NAAH 4HKZB 4X4ZA 1PD6A 5HDQL 4BQBA 1YEEL 1X6LA 1RJZA 1UB5B 1GH7A 2EEDA 4TUOA 3NCJL 4XWGL 4UOW1 1CDIA 4KJQC 1NH6A 1QR4A 3HRPA 4XCCH 4U6YB 4K23L 4FQCL 2FJHA 4NZUH 1PY4A 3B5HA 4N9OB 4LCWD 5T3XL 4YHPB 3LEXA 4JZJB 3WEXB 4LLQA 1HHKB 3G5XA 4LQ1A 1T7XA 1ZTXL 3HB3C 5C0JB 3AFLA 4UQ2B 3QNZB 2NY2C 2EC9U 1D5BA 4XB7A 4RFNC 5EU7C 3BD5A 4FQLL 5DC4B 3S5LA 3T2PA 1MRDH 1RJZB 5GRVL 2V6HA 5I15H 3NTCL 1V7ML 3EAKA 5FKPA 1AGCA 2VN4A 4IJ3C 4H88H 5GS0C 4LSQH 1OW0A 5BVJA 1P7HL 4UQ3A 1JMXA 1YNKL 4YR6A 1U6AL 1ONQA 1TFHA 1LP9A 3VD3A 1LD9A 3ZTNH 5IT2L 2NY5C 1FG2B 2BOCB 1MJJA 3KPQB 3DTXA 3LIZH 4KHXH 4P0DA 4QTHB 1E28B 4WFHD 5KSBF 3TLRA 4UILL 4D9QD 4RAUB 1B3JA 3QNZA 5EOTB 5CEZH 1EO8H 5CSBA 1IRAY 1BBDL 4J3XA 1WCBB 4YHKL 5CCKL 2HWZL 2P24A 3F12B 4NQED 3RGVA 2DDQL 2YSSB 2OR9H 2C3GA 4S1RL 1R5WB 1BPVA 5FO9A 4KROD 4JY5H 1NGXB 1NDMB 1JPGB 4OB5H 4NBYB 4L8SC 4FQIL 1HH9A 3RAJL 4Y16C 3QNYA 3RNKA 4YK4B 3LAFA 4QCIA 4TNVF 3DETD 3QO0B 4XPHL 2PYEA 1YEFL 5IESH 3I6KA 4JM2D 2YEZA 3NIFF 1NCNA 3QQ9C 2F58L 1UM4L 4FQQB 1T20A 1CDGA 2XY1A 1C5DA 3QQNA 4QRTB 2C4XA 3QUZB 2Y07H 4OGYH 3TNNB 2AP2A 1M1SA 4HUUA 1FZKB 2CPCA 3L3JB 4FFZH 4L3AA 1KB5H 2NXZC 3QEQB 4D0BA 1G7PB 2OR8A 4PBXA 1T4KA 5TGBA 5MP6H 3LKQA 4JCMA 1F6AB 4X6FB 4YK4C 3U36B 1BIIB 1D3CA 5D9SA 3QIUD 3BN9D 3M17B 2Z31C 3NABL 1OP5K 3I6LD 1HSAA 2UVFA 5IHUL 3M17A 4RQQB 1INDL 5C6WH 3DVIA 1IEBB 4Y5VC 4JFYA 4PP2A 5B3JE 3WIFB 3QNXB 2FD6H 3MBXH 4ZUSB 1ZLVK 3B9DA 5ESVB 5F89B 3TYFB 4AEIH 3GSRA 5CIPH 4DUXA 4FTVA 3DVGB 2J6EH 5AAMA 5JHDA 3D85B 5J12B 1A0QL 5F7KC 5HYJB 1A5FL 3OV6A 1ITBB 1RUKH 1PG7W 4K3JH 5IMLB 2GTWB 4KK5D 3HC3L 4KKLD 1LMKA 5J7CC 4UAOB 3MNWB 4OV5A 1S7VB 5GJTL 4V2BA 4WDIB 1OTUC 1I1AD 5DUBB 1JRHL 2YUXA 4RNRB 3GMMA 4U33A 4KUCF 4KTDH 4OTXL 4PREB 3AREC 4Y1AD 1Z0NA 2ZSVA 3HHRB 3BH8B 2YXFA 2GSIA 5HGBB 4MJ4A 4S0TD 1GVIA 3K0WA 4G43B 4MD5B 1D6EB 3G6JE 1A6AB 1QLRB 4Q7DA 1F4XL 2BOCA 3FT2B 3STLA 1F45A 1TENA 5DMKB 1S7XB 1ZHKB 4GKOA 4JVWA 4UIMB 3FT3A 4C59B 1B0RB 1O7SA 3FQNB 4XHJD 4X6BA 3TT3L 4PJIE 4Y1AA 2EEBA 1NFIA 1R3JB 4UNVA 5IM7B 4NKMB 3WFBL 1E28A 1VB9A 2Q7YB 1N5YL 2R1YA 3RVVC 1LDSA 1OHQA 5MEND 2AV7B 1NCUA 4NPYA 5SV4A 3JTTA 5C08D 2AJZA 1AO7E 2MCPH 4FZ8H 4LAQL 4JEGB 3QULB 5ILTH 1ZMYA 4ZUVB 2BX5A 3I75B 3V0VA 1XF3A 1BFVL 2FEEI 1R5WA 1X4ZA 3C08L 3GIZH 4I8DA 1ES0A 3QUXB 3BX7C 1WQVT 3T04D 3MRHA 4M48H 4XNYH 4X4YB 5ID1A 5I15L 3V6ZB 1T83C 4HW6A 4XPBL 3CVIL 5HHOD 3IB4A 4XP4L 2P42B 3O2DL 4CUCA 3QUMH 3ZKXC 2V7NA 4WTXA 2GIYA 3WIIH 4W81A 4HIJA 3T0EA 3Q3GA 3ZE0F 2DYPD 3AGVA 5D7LB 2AK1L 2VXSL 1IAIM 1AIFA 4M6MH 3GMQB 3LV3B 4NRZA 5DVLA 2YUZA 3P11H 2NY1B 1FNFA 1RVFH 4OLYH 2JIXA 2VDQH 3GSQB 3D85D 3SE3C 3ZDZE 5ITBL 2YD3A 2BSSA 4MMZC 5JHDD 1RUMH 1A4KB 5D2LE 2XYCA 3BESR 1E4JA 2ZPKH 1OTUD 1WBYB 1AQDB 4G9DB 4NO0B 5TE6H 4H20H 3TV3L 4WO4D 4EIZC 4YXHL 2WP3T 2VMFA 3ETBF 4HBQA 2UYLB 3HAEA 3QJHA 2XA8L 3IAGC 1JNNH 4KAQH 2VAAA 4JR9L 5E8DL 4G8IA 2VR5A 3NFPA 1L6ZA 1JHLH 4ODXA 4U6VH 1TCMA 3RWGA 2AJ3B 1AGDB 1YN6B 2DI8A 2EC8A 2ZG3A 1F6LL 4KI5E 4RGNC 4G8EB 1I75A 5K9QG 5I1DA 2XKSA 4IM8A 4LGSB 5C0EA 5TDNA 4WJ5B 2GSGA 2ZNWA 4JKKA 3SKOA 2Z91B 4HS3A 4IMLB 4OQTL 5DFVD 4P2QA 4BZ1L 4DVRL 4RA3A 4HIXH 5F9OH 1K4DB 1WAAE 4DVBA 1UA6H 4IRJD 3VRLF 3DUUA 4ODVH 4XMPH 4N0UE 2KQMA 3SDXA 5ADPL 2CO7B 4P46C 3P4MA 3PGCA 1U42A 2Z31D 1DLFL 5HHMB 2AGJH 4GG6F 3EDKA 4U4BA 4ODSH 3EOYG 2A6JA 1U95B 5KN5A 3C9NA 3B2VL 5TPWH 1NANI 4KI5C 3MACL 3UTTE 5HHME 3OKKA 5LQBL 4PGEA 3DX9A 2X4OA 5FGRA 4XXDB 3WHE0 1QFWM 3ZT5A 2ZSWA 3PWPB 2Q8BL 3OHXA 4PGDB 1LNUA 4MS8D 4K3DH 4JY4B 4OZIF 1CTOA 1RULL 3D3VB 3W2DL 4R2GD 1YEKL 5ALCH 2ENSA 2FLRT 3KPPA 4JRYD 3SN6N 2CQVA 3QFJD 3V4VH 4P57A 1I3VA 1BM3H 1YDPB 4GRLB 5DO2D 3SJVB 3C9NB 4WUUB 1EEQA 2HTKD 3TN0A 5DJXA 2ORBL 3KYNA 2WK2A 1FZKA 3FO9B 2EYSA 2IQAA 4H1LA 4WEUD 5H35B 3FO9A 3KPOB 5IVXA 5DMIH 3W0WB 2R9HC 2HT3C 1HH6B 1WBZB 2VDRL 4TTGA 5D2LA 4PLOB 2VR4A 5K9JH 4QXUL 5E94B 1TJGH 4I18A 1F90L 4UBDC 2PCPB 3WKML 5IJKC 2EIZA 3OAYK 1Z0MA 2FX9H 1UXWB 2YPLB 3C08H 3H9SA 1U8OB 2NY1C 2EE2A 3GFUA 4HIIA 2ZPKL 1DL7H 4R0LA 4FQHB 4JRYB 4L9LB 3SCMC 1T4KB 5INCA 2NYYC 2P4AB 1SBSL 3ZSTA 1A4KA 1CCZA 3VD7A 5KSVB 1X5YA 3P11L 4P23C 4OLZH 1HYSC 1CGUA 3GJEB 5KSUB 2BY3A 3M07A 1PKQB 4YXKH 3MA7A 4CDGC 1E4XI 4HXBL 4YHMH 1TQCC 3EO0A 2DL2A 1U8PB 1I1FA 5F96H 1NFDE 1JCKA 4DN4H 3Q5OA 3E6HA 5EU6E 2MQCA 2GAZB 5A43C 5IVXE 1YEGH 3CLFL 3WS6C 1JWUA 3A67H 2NY5H 1FFNB 4GKNB 2HP4A 3O4LD 3QXWA 4JO4H 4F7CA 4X5LA 3T0WA 3H9SE 5TDNB 4HJJL 4JFFD 5CD5D 1TTUA 2PYFA 2VZOA 5JZ7C 1QEWB 4LASL 4PS4H 2NY1D 5FYJD 1JPGA 4OF5A 3WLWD 4L4VE 3MROB 1IFHL 1IGFL 4Z76A 1XCTA 1DN2A 1CDYA 1X5IA 1ZLSH 4XBPA 4JLRA 4X6CE 4GXUM 3QH3A 3QQ4A 5KW9H 1TPXB 1PGRB 2VXTH 3WIHA 4B41A 2HT3D 1XIWD 3VXNA 3GJFK 1CGSL 1FGVL 3QBTB 4CMMB 1F3JA 5F7EH 1VKXB 1XGTB 3FQUB 2EDRA 1JWMB 1RFDL 2QSCH 3H9YA 4PJHA 5IW6B 4FXGA 5DUMH 1ORSA 2OL3H 3HPLB 1J1PL 1EXUB 1ZHKA 3MNZA 1MREL 5ADOL 1RIHH 1IL1A 2R0KL 1NUFA 1ZA6A 3S96B 3W0WE 4GMSH 1XGQB 1ZWIB 1XIWA 3GMPB 2G60H 1CICB 3VXTA 4F57L 2A6KA 2H3NA 4P2YA 2M26A 4LSPL 4AJ0A 2Z8VC 3CX5J 3H9SD 1HZHL 4GW4B 1OT2A 3FTGA 3D0VA 2WQRA 1IEAB 4MQ7B 5IR1B 2CK0H 3IFPA 1ZHBA 1YY8A 3PGDA 4TNWK 2A6DB 2DBJA 4DUVA 1IGYA 4GBXD 1MIML 1CXFA 4LNVA 1TVHB 3U7YL 3UTZB 4RMTA 4YC2C 2GFBB 4MQXD 1I3UA 3HTLX 5J0BA 2XPGB 1H0DA 4NNPL 4JM2F 2DKUA 2R2HB 1KPVA 3NA9L 5IB2A 4YUEL 4AM0B 3V4UH 3C5ZA 4I0PB 2DQHL 4UT6L 2X4QA 2IFGA 1F58L 4JGUA 1CFTA 1VFMA 5FYJU 3JSSA 4PP2B 4X6EA 2W91A 2ZCKH 5ALBL 5F7YC 3VJ6B 1NJ9A 1A6VH 2YOCA 4F2MB 2BOBB 4HZLB 1TQCB 5HYSA 3R06B 3MCG1 1DE4B 3RZCC 1CDBA 3T3MF 4I3RL 3U1SL 5GGSY 3ZE2E 5FF6A 5KSVA 2OZ4A 2A9NH 5BVPH 1T3FA 4OZHB 4ZTOH 4QXWA 4LSRH 5FA3A 3ZDXE 3SDYH 5INCB 3CGTA 4MA7H 3U4EB 2BY1A 2FBOJ 5AWNH 5IMKB 5D71H 4M8QA 3P40A 3RY4A 3QJFB 3MOQA 4PG9B 2VAJA 5BZWA 3DXAD 1MI5B 3PV6B 1BZ7A 3C87A 4PJFF 3L3JA 3W11D 1U8OA 4L4TB 2AI0L 2D3VA 3HC0B 1RJLB 2EXWC 1RUQL 1MCNA 5DVKA 3ZDXF 1D6VL 1EEUA 3RBSA 5TQ0L 4H25A 4Q6IC 5EU5B 4HUNB 1V3LA 1XF4A 3MRQA 3DXAA 1TZHB 4JE4B 5B39B 4JY5L 2CKBA 3WFCH 4AIOA 4KZDH 5TQ2L 1ZHNB 5GGTL 5GISH 3TIDA 2VN7A 4ZOCA 1ZGLP 2BK8A 3BWAA 3UZEA 1WFUA 3VWJC 1UZ8B 4ELKB 3ARBC 4IOFC 1MJ7H 4R97B 2VE6B 2R2BA 3EKCA 2XFXA 5DJYA 5HHVH 2FZ3A 3MV8A 3LZFH 5GXBB 4E41B 2P24B 3R0NA 1LO3H 5FGCE 4FXGB 1CU4L 5EO1A 2CDEB 4H8WL 4EI5A 5A2KH 4NUGH 5IT2H 4NHUA 4PJGA 1F3RB 4Q58C 1MAMH 1FFQA 2JJTA 2D4FA 3NCFB 3L5XL 4P5KA 1HXMB 6FABL 1Y0LB 1KIPA 4L8BA 5SWSA 2DBLL 1FNAA 3VXPA 2F8XC 5FGCB 2VLRD 3OXRB 3B9VA 3UO1L 1H3PH 1BVLB 5F44A 5BW7A 2VUYA 3QWRA 4LSRL 4MVBC 1AGEA 4YDKH 3P73B 3IVKA 3NTCH 3T0DA 4JJ5A 5F7NC 4NIKB 4FP8H 4QKXB 4BFIB 3SKUD 5JLZB 3I6LE 2KQNA 2PYED 1QBBA 4AYFA 1CBVH 3WJLA 1P9MC 1LP9E 4GAYB 1UKQA 1WAAF 1N7MH 1S9VB 4O00A 2HMIC 5SWQA 3L5WB 4K7FA 1EV2E 1G7HB 1EVUA 3RNKB 1CQYA 4R8WL 4Y2DC 4EDWH 5I1JL 2X70A 1T89C 3S37L 5DHVA 3NA4A 3SDYL 4PJXF 4MHHG 4YAQB 1D5XA 4WV1B 3VDAA 2DF3A 1GJIA 1YMME 4NQEA 5CJQH 4NKDA 1OP9A 4CVWA 2X7LB 4ZUTA 1G9ML 2ESVD 4P59L 2Z91A 2NY4C 2FIKA 1FZMA 3OF6D 1J5OH 2O61B 4GG6B 2Q3ZA 4PRAA 3GDBA 5ALBH 5KSUA 4CAGA 1A6TA 4JANB 1EAPB 4PJFB 3RWEA 2BERA 2XTJE 5AUMB 1SJEA 5L2JA 2DWEA 2P5ED 4XBEL 3EYOB 5JQHC 2R1XB 3VXUE 1DR9A 3O6ML 3MC0A 3BPCA 1R3LB 1AR1C 4ZSOA 2JK5A 2Z35A 3E2HB 5TDPA 2Q8AL 1IGJB 4OZHF 2QR0B 3VG9B 2F5BH 1CI5A 2VJXA 4NQVA 4S1QL 2QQLL 5JW4R 3GMRA 1RY7B 1KLGA 2Y23A 5CLWA 1IILE 3LN9A 3TH3T 2YC1A 5DT1L 2PCPA 4HS8H 3U6RB 5FCUL 3ZHKA 3GGWB 1PYWB 3FOMB 4PJEF 2I9TA 5GGQH 4N0UB 4QY8B 4DZ8A 1IGYB 1HHKA 4P9HH 1OGAA 2QSVA 3CC5B 3MRNA 3FN3A 4LCWE 5IVXF 1CZ8L 2H32H 5IHBA 3TO4C 3UTTD 1GXEA 4UT7H 2BC4B 3TFKC 3VXOA 5JR1L 2XIDA 5F6HI 4OCSL 3FRPG 3L1OL 4WTZA 3HR5B 1QSVA 4K94C 1WWCA 4RMRA 1FE8L 1A9BA 3C6SA 1T22A 1GSMA 4KQ4L 3T0XA 2NX5E 4HWZA 1N6QL 2ARJA 5JIKA 3F6IA 5A40E 1ZT7B 3CZFB 1HQ4A 3F7VA 2VABB 4G9FB 4I48B 4KJWD 4HMCA 5MEOA 1RHHA 1FL5B 1X3DA 3ULVL 1QSED 4HWNA 3WS3B 3NACL 1E27A 3FQUA 5I2IA 2ZUUA 5L8JB 4UTBH 4A6YA 4NC0B 3VFSA 3WHXB 2V2TA 5F96L 1IGFH 1WZMA 3QXVA 3O3EB 1S7QB 4Q6IA 4NCC2 1UH4A 4MX7B 3DBXB 3X14B 4L5FH 3KPRE 3H7LA 5I76B 2XZAL 3LKSB 3TNMA 3OAYH 1TIUA 3EFDH 4F9LC 4Z76B 1SBSH 3KDMA 3WUZA 3TGXA 3VFRA 2NY6C 2DJUA 3A67L 3ARBA 3RHWF 3MRJB 3K1KC 2DICA 3U0PA 3G6AB 2VLJA 4K71B 1RZIA 2EH8L 3BD3A 2JKXA 1I7RA 4WUKH 3HMXA 4F7EA 1OTSD 1BP3B 2R0WL 1LEIB 4CU6A 4Z95L 5T3ZH 5I66B 4KK6D 2FYYB 4WTZG 3HE6A 4HXBH 2W60A 3QHTC 4ZS7H 4OCWL 5LAXB 3K4ZA 1HI6B 4MQXC 3BUTA 1Z3GH 2NXZD 2PTVA 3O4OC 3BQUD 3CVHA 3CMGA 4PLJD 4Y4HC 3TO4B 2OI9C 4YHOH 2UZYB 2ATPB 4D0DB 1J87A 4U6XB 5T1KB 5D1XC 1OSZA 1JWSB 2OTUA 4PJ8B 4HF5L 2BJMH 3GMNB 1J9CT 3ZT7A 3MLVH 4R6UA 5IP4A 3O2VH 1M4KA 4Z9KB 2IALA 4LSUH 1JN6B 4MJ6A 3RA7H 4LNRA 2IPUG 4HKJA 4PUBL 5IBUB 3GI9L 1JRHI 4W4OC 2BNQB 4LLVB 3RJDA 2YD5A 5HGDB 1RJLA 1XR8B 4P23D 3FB5A 2G5RA 3GMRB 4UT9L 1A14H 3LHPH 5EU6B 4D8PB 3ZE2F 4PJ9C 3BFOA 4MCYB 4Y19B 5I8EA 5IEHA 4L29B 1CGYA 4QT5A 2OL3B 3QJFA 4MA8H 5MENB 3TT1L 2X4OB 3IDMA 4JPVH 5CINH 5CGYC 5JO5B 3DROB 3HUJB 4D9QE 1H8NA 3IF1A 1T1YA 3EYUL 5FYLL 2NY0D 4OGAD 4HFUH 2KDGA 1TVBA 5HDLA 3DIFB 1T1ZB 3O3AA 1RZGA 2GK0A 5DMJB 5GGUB 2A38A 4OF0A 5EN2A 3OJ2C 4H8WC 4M7LH 2AEQL 1CGTA 3V4VL 4UTBL 1A7OL 3VXSE 2HAZA 5BZDA 1IAMA 4WI6A 4QHLA 5HHQA 3BISA 1KC5H 4W6YB 4ODSL 3UCRA 3O8XD 3QDJB 3RKPA 5HYEA 1FYTD 5ISZB 4G6FB 4WI2A 5EUOA 1BFTA 1AFVL 5DSCA 3MLZH 3UBXB 4PJBA 3ARWA 5J1AA 2W0PA 2HVJB 5FKAA 4NO2A 5T5FL 3BH9B 3VA2C 1CLZL 4HDIA 1OAQH 4BFEA 4OZFB 3RVTC 4L8SB 4KC3B 5FDWB 1BD2B 1E4KA 4ZFFB 1UXSA 3CC5A 1FYTA 1P84K 4L1HA 5E8NA 1CL7I 1MVFA 3G04A 1FVCB 1CE6B 4KJYB 1QYGH 1JGDA 4J3VA 4V1DB 4P9HL 3BWUC 1A6VL 1NC4A 1PZ5A 5ADPH 4OFDA 2WWMC 5LKNA 4XMPL 4MD5A 5GGQL 2V2TB 3H7BB 3OR7B 1BJ1H 4LLWB 1WTLA 3WV0A 1PQZB 2FJFB 1WFTA 5EZIH 1A21A 3G6DH 3RX5A 3QYCA 5TDPB 1OGTB 1FVEA 4JKPL 1UC6A 1EPFA 2VXVH 1KYOK 4X5WA 1RU9H 1B0GB 1X5FA 1OF2B 4Y7MA 4X99A 4OUOA 3HZMA 3LQMA 4DEPC 1NLDL 4TULL 2R2CA 3VMPA 3D1MC 4PJFA 4IHOA 2E27L 4KI5F 1TTGA 3HA0A 2XA8H 1EO7A 1VFBA 4F7MB 5F3BA 1HNFA 2QSQA 5EUKA 4JZOA 4EXPX 2QQNH 2GT9B 2FEDD 4R2GB 1J05B 5F89A 1RK1B 3UJTH 2OX5A 1ES0B 4WHCA 4ENED 2J4WL 3QXAA 5GSVA 4GQPH 2PO6A 5E2WL 4XP4H 4H26A 5JNYB 3SEPA 3JTSA 2R1WB 4M9PA 1OAUH 3U46B 2R69L 1MI5A 3PV6A 5JHDE 5EA0L 5IOPA 3GSXA 4M8QB 3IRPX 5I16A 3NH7H 4NHCH 2O5ZL 4OZHA 3MLZL 4RGMC 4O9HH 1R3LA 1FG9C 1N5YH 4Y4HA 1T04B 1I9IL 4LP4A 4UUJB 3KLAA 2NXYC 1F11B 3C09C 5C0GB 2FECI 3UC0H 1JZ2A 3AS0A 4LCCA 1N2RA 4J3UA 3TVMC 4WUUD 3CFIC 5IMOB 1L9MA 2AEQH 1AGBB 4QLRA 4EZMA 4PBVC 4AL8H 1AHWA 2W0FB 3MNVA 2X4QB 4XXCA 2ZKHH 4O2EA 5JUEH 4X8XA 2XOTA 5DUBA 4Z5RB 1MWAL 4L4VA 3QFDB 3TBTA 5I6XB 4M4PA 2WP3O 4YC2B 3HFMH 5DJDA 1M7IA 1IGTA 5JA8B 4PRHB 4PJIA 3CFKA 4LRIC 1A6UL 2MQ0A 4XBGA 2DM2A 2SEBA 3X11B 1MRCH 2Z93A 4WU7A 2UV3A 1HHIA 1KENL 3MRPB 4YFEA 3I50L 2ZG1A 5CD3A 1Z9MA 3DVNA 4JZOB 5F9WB 1FORL 4EN3B 3MNVB 4PJDF 4MXVE 3NACH 1NDGA 4UIMA 3PDOA 2OMBA 3H6JA 4MNQD 1IZJA 3JVGA 1A3LH 3HNTL 3G08B 2ADIB 1IL1B 2FX7H 2H9GA 3GSOB 1BQHA 3U4BL 1N64H 2HRPL 2CGRH 4WI9A 3J8F7 3MTRA 3X3GL 3SDAB 3KR3H 3GEWB 3FAWA 4X6CF 4RRPA 3OKNB 4OCYH 1RUKL 4P3CH 5DK0A 3TWCH 3C2AL 1MFDH 5GGVL 1OARL 3MNWA 5JR1H 2OP4L 2EDTA 4AY0A 2DJ4A 4WI4A 5EC2A 3VI4E 2FSEA 1I9RL 3L6FB 4Y5YA 5HVHB 4U49A 1DBJH 2N56A 3T4YA 2VZVA 3DXAE 3CJJA 3SE8L 1MI5D 3V95A 5ITFB 2QQNL 4FNLH 2BFVH 1DQDL 3ZLQC 3PL6D 5KVDL 3M1BA 1MFAL 3V52L 2FO1A 1UCTA 3S34L 4M03A 3MPCA 4HX1B 1J10A 3PIQA 4HWBA 5H94A 3ILPB 4OZGF 4I5BA 2BVUA 3EJYD 5EU6D 3P4NA 3QZWA 2WM0A 3FJTA 3MV9E 3F8UB 2ICEA 3RPIB 3TIEB 3MGOB 3MOBL 4OLUH 4FFWC 5E4EB 4TUKH 5JDJA 5K9KB 3PWLB 1F6AA 4XCEA 2AV1B 4ZDHA 3TP4A 4P48A 3GJEA 1UM5L 1Z6JT 2J8UE 1QYGL 1R5VB 1P4IH 2R4SL 3DIFA 1U93B 3A6CL 3VFWB 4MXWL 4TOYH 2AS5M 5D2LF 3B2VH 1EO8L 5TPWL 2H8PB 2FGZA 4XX1G 5CBAA 5FM8A 1ZXQA 4DK6A 2PO6C 2Y7QA 1MAKA 4LPCA 4Y89A 5HGHB 3F58L 4HK3N 4NJ9H 3C2AH 4PY8I 3UTQB 3OGCB 3EZ8A 4G9DA 3EDFA 4LARL 4F37F 4HJ0D 5DD1L 3WDJA 4X4XA 35C8H 4JQXA 4LAJH 1BOGA 4OF3A 2ADFL 1W72A 3U4BH 3GM0A 1AFVH 5IG7A 5JXAL 5D7JA 5FUOH 1MH5B 3IFOB 2NXZB 1ZEAH 4ELMF 4HBCL 1UWXK 1WBXA 2VNCA 4HCRL 4OJFH 4ONHB 2EZ0C 3KYMA 4JPWH 1IGCH 3KS0H 2OK0L 3Q2CA 3ISWA 4KHXL 4ZODA 1FORH 4PJ7B 1MEXL 1FNSH 4JCLA 5IROA 3WFHA 3O4OB 1T5XA 2EYSB 5EOCJ 2FGWH 4NSKB 3D87B 3VI3E 2PYFB 1GZPB 1U6AH 1WLHA 3HMWL 5DMYA 1J1XH 3H9HB 1RZGB 2GK0B 5GGVY 3WXWL 3ZKXB 1J18A 5IW1A 4EVNA 3KXFA 5KSAB 1QR1B 4ZTPL 4KDTC 1F4AA 5D7SL 3LS4H 1MRDL 3OKMB 5FOJA 4LSTH 2VR9A 2J8OA 2VDKL 3CFEA 2CSPA 3JWDH 3HZVA 4GAFB 3OQ3B 3GO1L 4PUBH 4QHNA 5C0CE 4YHML 8CGTA 3C6LB 4G8GD 3S37H 4LHQB 4KDWA 1GPOL 1NFKA 4YXKL 1QFUL 4MD0B 4WY7H 2W9EL 5FAAA 5CMAB 4ZS6C 3FQXA 2Y5EA 1K9TA 3RDTB 3LN4A 1Y6MR 1U3JA 4LRNH 2ZCLH 3WLBA 1NCDH 1NFDF 1QSEA 2BHZA 5HBBA 1E27B 5AD0A 4QO1A 1QP1A 1BZ9A 4G8GA 1DQJB 2YPLA 3CFEB 3ROLB 1IQDB 2WBJB 1H3PL 1IMHC 3CVHB 3DUUB 4FQXD 5J06A 3JUYA 5DD6B 32C2B 1JL8A 3SDAD 4XVSH 1T83A 4CN6A 3CDYA 4XI5D 1BD2D 2BSTB 3EO1B 3HKFA 1OSPH 2RAMA 2CRMA 4IDJH 1ADQL 3WNMA 4YXLL 3QEHA 2FIRT 3K8LA 4FQJL 1I1AC 3Q48A 4LSDA 4DW2H 3TYGL 2X4TA 2ADGB 1S7WB 2IH3B 1EIBA 1FO0A 4HD9A 3NFPB 4GQ9L 4WEBL 3ARFA 3ARGD 1OVZA 3OX8B 1DQQA 1JPST 3BT2H 4X6DE 4JM2A 4TNVK 5C0FA 3GO1H 1MEXH 1Q9WA 2ESVA 3VGAB 3QIBD 4Z7OF 2YD8A 3WIFA 5I1KL 3VGGA 2XWJB 1IGCL 4CVZA 3ULVH 3B4NA 2DWDA 4KROC 4PRHD 3SOBL 2UUDK 4PJ5E 2EDEA 4TSCH 5J6HB 1S9YB 4L3CA 3JBG7 2CK0L 2W92A 2XN9A 3FB8B 4Z7UA 4CW1B 5L0QC 2M1KA 3CZJA 1FLRH 4LNRB 4WFED 2J5LC 3RWHA 3KYKL 1GIGH 5L8LB 1JBJA 1FNSL 1A0QH 3F58H 5C9JA 1WBZA 4AH2B 3FO0L 2B2XL 4KJPC 1J12A 1SJVA 3QUXC 4V2CB 5D1QD 3JWOC 4QRPB 4PJXA 2YN3A 4OZGE 2N7AA 2NXYD 3TO2A 4KKBC 3UYPA 2VSDA 3MV9D 5GS1B 4HS8L 2P44B 4S1DC 3GJFA 4APQC 5IHUH 7CGTA 5TDOA 4DWHA 4J3WA 3MRDB 1AJ7L 2KKQA 3MCLL 4D3CH 1N6UA 1U8JA 1KT2A 2HLFC 4EQ3A 1HH9B 4S1QH 1T66C 1JK8A 2HT4C 1RZIB 3DETC 2BY0A 5D1QA 4NNPH 4NNXB 1GOGA 4P2OC 3T2NH 1FH5H 5EH1A 4MAUH 1KJ3L 3SBWC 1SHMA 1G7MB 1C5BL 1UWGH 4BFIA 2IADA 4LBEA 1MFEL 4HULB 5IUSA 4LPXA 3A6BH 4NFCA 1WISA 1JNNL 2DB8A 3QUMA 4KAQL 4MB5A 4MJIA 4PFEA 2H2PC 4WI7A 4FNLL 4NM8H 3T08A 2W65A 1QHPA 1DBKL 5IF0A 4BK4A 3CVHL 2UY6A 1W2KT 4NZJA 2DM3A 5IB3A 2FR4B 4RGNE 3VWJA 2D0HA 4GG6A 3PUCA 1P1ZA 4D9LH 4NQCE 2EDHA 5HI3C 1TNMA 2W1NA 1Q1JH 1SM3L 2LVEA 5CZVL 1JHTA 1BQHB 1OARH 4F7TA 5GGVH 5E00B 3MGOA 5A2LH 2GTWA 1IT9H 3T1FB 1KCSH 1G7LA 2VXSH 3BAEL 4MXVF 2YPKA 3T65A 3G6JB 3EYVB 3DX8A 1B88A 4LCUB 5CBEA 1U2CA 5EPMA 1W8NA 3R4DA 3ARZA 3CK0L 3ARVA 3FONA 4GH7B 5FXCH 1NBZA 3DROA 3HUJA 2HYMA 3JWDC 1MFBH 4HLZG 4OLWL 5JPNB 4DN3L 1G0YR 3LIZL 3Q1SL 3X12B 4OCWH 1MAML 3K2UL 2B1AL 4L4TA 4NUGL 4LL9A 2RCSL 5I8CB 1I7ZA 1HQRA 2EEAA 3E8UH 4HXAL 2L4OA 1JZ6A 5GRZA 4NKMA 1V3JA 1KN4L 1QFWI 3DV4B 4R4NC 3EOTL 3WN5B 5ETUA 5CEXA 3DV6B 4M61A 4NFBA 3IJSB 3QDGB 4HC1A 1XF5A 4NYLA 3LKPB 1VADB 4E0RB 4RDQF 3GZKA 5D1XB 3FQTB 3MV9A 1QRNE 1XZ0A 3GMLB 3OPZH 3H0TB 3IXTB 4F9PA 4KZDL 3PE9A 1IM9B 4HLZH 5IFHL 2AEWA 5C07A 5FECB 1K2DA 5GS0L 4XH2B 1DFBL 3DVNB 4ZFZA 1K4CA 1G6RH 2A1WH 4NKDB 1A2YA 3AU1B 2QV2A 1AD0B 4HHAB 2W38A 4ZUVA 3O2WL 5HHXH 1YEEH 3D3VE 4TSAH 1YC8A 1VFUA 4KQ4H 4AZ8A 1UEYA 3RU8L 2AJZB 3QQ3B 4ZD3L 4HQQL 4HJGA 2EDFA 5TFSL 3RVUC 5CJOH 1AXSA 2WANA 3NFNB 4POYA 3MYJB 3TNMB 4P2QD 3GSNH 1A4JB 1YUHB 1CXHA 1NCCH 3EYQC 2VZTA 4JPKH 2NY0C 4OIIH 1CICA 4XNXH 3C6LA 2VQ1A 3RKDD 4QF1A 1JI1A 4K9EH 3MREB 1FDLL 4LQFH 5GSRB 3MUJA 4BZ1H 2D31A 1U8LA 4XCYA 5C8JA 1DDHB 5DK2A 2APFA 1CL7H 2ORBH 2P5WB 4XI5C 4APQA 4QXGH 2ZNXA 3QISA 2F5BL 4OQTA 3KXFB 3RTQA 2DMBA 4ORZC 3VXUA 3O3DA 2R23B 1EH9A 3LVEA 5ANMA 4RBPH 1CK0L 4PD4J 3FQWB 1J7VR 1MQKH 3DVFA 3BMVA 1U8NA 3QDGD 1WC7B 1FFPB 4CKVX 1CQKA 4PGJA 1BQHG 4ONGL 1NSNL 2I9LA 1UVQA 2NW2B 3OWEA 1AXTH 3QXAB 3FCTB 4YDVB 1RPQA 1QSFE 3FFCE 2BRQA 3AB0B 4XH2A 4GOSA 1JUFB 3B8SA 3MXVH 1EK3A 2ITDA 4J1UA 5FA4A 2HVKB 4Z18A 1RHFA 3BP7B 4O02H 5C0AB 2WBWB 3MRMA 3GNML 4LEXH 1PSKH 3MFFA 1OP3H 5E6IB 1JHTB 4MJ5B 1QSEE 2A74B 3I84A 5KVEH 1JYWA 3GIVA 2QSCL 3O6FA 3OKEA 3BGMA 4GXVH 3MUHL 1CGSH 1FGVH 1OAZH 4L9DA 2DDQH 4NKOA 3BZFA 2BSED 3RZCA 5D2NE 4HIXL 2CO6B 1ZHLA 2HWZH 1PBYA 2FJGB 2XN9E 3D18B 4XCFL 4ZXBA 4UV7H 4U6HB 3WO3B 2QADD 5CFHA 2UWEB 4LOUC 2C3VA 2NX5B 4WHYG 3FN0L 3BHBB 3VW3L 4JDZA 3QT2A 4HQQH 3ARDC 4WHTA 4W4NA 4QXTB 2NXYB 1BAFH 3ARUA 4OFYD 1QO3B 4NKQB 4GUPB 3MFFB 2BDNH 1R5IA 2WWKT 2VKXA 5FFLA 1LWRA 4ZXBD 5IVZA 2A83B 3VDBA 3D9AL 5C0IB 3EDJA 3ILPA 5IBUG 5E1AB 3UYRH 4JFQA 3U30C 3CSYA 5JIIA 4QRRB 3IDXL 2BVQB 1BVZA 3WNPA 5T5NG 1KCVL 4Q0XH 1X5GA 2CK2A 3TO2B 4M62L 1KLUB 4EI5D 3WIHH 3LQAC 3KNBB 1ORQA 3DNKA 1JNJA 5E5MB 3TO4D 1ZHBB 1RZFH 2GHWB 2NW2A 1P7KA 1ED3B 1RJYA 5CLTA 3V5DA 5E0QA 3TJEL 4YNYA 2A6KB 2H3NB 3IDJB 2X89A 5DJCA 1WZKA 2AJUH 1C16B 4MNHB 5EU7E 3SKMB 2VITB 3ZDZF 4LLUA 3BXNA 2QHRL 1FNHA 3CVHH 4FFWD 3BEWB 5J13B 3VFTA 1RK0B 5KANG 2ICWI 3PWUA 1WWAX 2VL5A 4QRPE 1HHHA 4LSUL 5H37G 5T3ZD 3OKDB 4E42A 4Z6AT 3GBMH 4OZGA 1OWRM 2AERT 1UWGL 2IWGA 5JDSA 4LKCA 2EH8H 2CD0A 2NY7H 3NPSB 1FH5L 4JZNA 1OT1A 1RIVH 1C12B 3ESVF 3MX0A 4KJYA 2VDMH 1A3RH 2X4SB 4UMGA 4JY6A 2YN5A 3D0LB 4XMKL 5DMIL 1I85C 1GOHA 3QDJD 1NGWA 1PVHA 1ZS8A 1U8IA 5I75B 3ZYIA 2RGSA 4WW2C 5EZLB 4MDIB 3CSPA 3T0ED 4XTRD 4HJ0C 2I07B 1FNEB 2IBGA 3S98A 2DLIA 2VABA 3SE9H 4TUOB 5FCSH 4D9LL 1D9KD 2MOVA 4HGMA 4YHZL 3T3PF 4IBLT 1A2YB 4IMLA 3RP1A 2ARWA 4MAYC 1INQB 5E8EB 3WNLA 5GS1C 2EDDA 3RQ3A 3CAFA 3ZTJH 3WL9B 1CDHA 4Y0GA 1BFOA 3HG1E 5EZJB 3V4PL 3BE1L 4LCCB 5F1IA 5KSAD 1HEZB 3F7YB 5CZKA 1A7RL 2V5MA 4YHIB 1A5FH 1QD0A 3CUPA 4FFYL 1OM3L 5KBNC 1OAXH 1W0YT 4XX1E 1WFNA 4GS7C 5IMMA 2LFGA 5LBSH 2EDLA 3SCMB 1NAMA 2ICES 3MJ9L 4MCYA 4Y19A 5I8EB 5IEHB 1FV1A 3MBED 4YZFF 4KY1H 4MGXA 2UZIL 5IFJA 2ADGA 4NC1E 1M71B 4WGWB 3B9AA 1UXWA 5FO8B 1KELL 4PJAE 4IOFD 2CKBH 3QCUH 4YIQA 1JZ3A 4C56B 3QHFL 1S5IH 3CFBB 1I8IA 2IAMD 3MLUL 1CZ8H 4JREC 5D6DA 1DBBL 1NEZG 3IDUA 2A77L 5I18H 4C4KO 2WINA 2CLRA 2IQAB 2G2RA 3L3DB 3E3QE 5CP7A 4S2SB 3VFUA 3FQRA 5C6TL 3NIGE 1S7SB 3V5KA 5BQ7B 1AHWC 2NW3B 4L8DB 1DUZB 3VXSB 1F13A 1NCDL 3EW3B 1N5AA 2ZCLL 1WBYA 1CGXA 4JFQB 3O81A 4M6OL 4DGYL 4X8JB 2VDQL 1RVFL 1H8SA 4NQDB 4PY7A 4NWTH 2OJEB 4QRRD 4A6YH 3QUYD 3ZZ1A 2G75A 2X4NB 2V2XB 5IIEA 1RK0A 4LEOB 4CN1A 4N8VA 4ZAKA 1AIFB 3VWKD 5B4MC 3NZHL 4GBXC 4XMKH 2OR9L 1A3RL 3OXRA 2VDML 2FEDC 2FBJH 1BD2A 3JWDL 3NCJH 1A1MA 2EECA 1JPFB 2XZZA 1KTLB 3MLSL 4HKXB 5DJCB 1CVRA 5D70H 3QIWD 3V7AE 3OBAA 1H3UA 3NAAL 4JRXB 4UILH 4D0CB 1A9EA 3TZVB 5J1AB 4RFEA 2FH8A 3D9AH 5BO1L 4B0MM 2F53B 1J1XL 4PTUA 3HMWH 3PWLA 5E70A 3TA3C 3VWKA 4R97C 4BZ2H 2F54E 5C0DB 4PJ7F 1ZT7A 3CZFA 3BJ91 2H32A 1U2HA 5IVNA 1MRFH 3PP3H 1G0XA 5FYJE 1YYML 3MGAA 1CIUA 1BBJA 1EERB 3QWOA 1AO7A 1ZOXA 3LB6D 2P5WE 5I73C 5F7WC 5H94B 3BIKA 3DMMD 1X7QB 2DQGH 3I9GH 3CH1B 3CMOL 1YQVL 4PV8A 4K3EL 5DHYA 5DEGA 1X5KA 1SEBB 1K5NA 4OKDA 3OB8A 4KK8C 2NTSP 1SMAA 4MNGB 1I85A 1MF2L 4NWUL 1GHFL 2ADFH 2XG5A 3BZFB 3RZCB 4MNQB 3T0EE 3ABZA 1AY1L 1LO2L 2UWEE 1JE6A 4G6JH 4KH2A 3MO1A 1RMFH 4JO2L 5GIRA 5IB4B 4PRIA 4NT6B 3UDWA 1P69B 5LBSL 4NQCD 3DUSA 5JXEC 1R5VA 4OLXH 1WV7T 4XP5L 5KVGL 2EDNA 3RWDB 1FV1B 4GO6B 1WIPA 3U7WH 2IANA 1QUNA 3KHOA 3L9RA 2ADJB 4XAWL 4XCEB 4Z7QF 5GS1A 5DJ6B 3O8XC 4Y8DC 2ATKB 5D7IA 5F6HJ 4FA8A 3QIBA 5CJ5A 2VL4A 1X5LA 1CFSA 2JCCF 5TQ2H 4BK5A 3WFCL 3BVNB 1M6OA 3PWJA 2J2ZA 4HG4K 3BKCL 4D0DA 1UYWH 1IQWH 3GSNA 3SHSA 4JDVB 2C3XA 4ODTL 4E41E 1ETZB 5CWSB 1EFXD 3ORJA 1KFAH 1D6VH 4F8QA 4FTVB 4KK8D 4UDUA 2FD6L 1RUQH 4BFGA 3GHBL 1OAZL 4P5TD 3AXLA 1JMZA 1YNLH 5DD6A 5E4IA 3DMMC 5CEZE 4M7JL 3GM8A 2VDOH 4PRBA 5J3HD 1IEBA 4J12A 3ALWA 3QA3B 3MREA 3G6AA 2FSEB 4GKSB 2A6DA 5MP6L 3MXVL 3HI6H 2R23A 5BXFA 1DBJL 5AZEH 4TOYL 4ZFZB 5IM7A 1RD6A 2X4SA 5JLZA 1YEIL 1DVFB 4IRJA 2E9WA 4DCQB 1U8LB 1AGBA 5DRZA 4TN9A 1DQQB 4IIQB 2YRLA 2P43B 3BKYL 5D1XD 3IXTA 4WI3A 4YHIA 3MOAH 4F3FA 1NAKH 1Q72L 1I8MB 1DBMH 5T1DH 4OZIA 4GG8A 5CGMA 2MQ3A 3ZHLA 3MNZB 2QHRH 5IBTH 5DEFA 1IM9D 1QBML 2R2EB 4X6EB 4HWEL 1CK0H 3QEHB 1Q9OB 2AJUL 5T1LD 3H3PL 4PREA 4URTB 4GAGH 1A3LL 1INQA 1BREA 3HNTH 4X0KA 4G3YH 5KOVC 1KEGL 5DLMH 4RFNB 3LKNA 1JGVH 3RVXD 5JOEA 2GTZA 1CF8H 2D7TH 1OAYH 4XPAH 4P2RD 4JFZL 1PG7H 4LSVL 2YKLL 1J0JA 4O5LH 1MNUL 1N0XH 1RUPL 4ESKA 4JDTH 5F7EL 4F33A 3G9AB 1NGPH 4S1DD 4APQD 4ZYKA 1S7TA 1WWWX 2P8LA 5HHPB 5GJSH 1E4XL 4P4KD 2YUVA 5EU3A 1Z2KA 3RUGE 1HDMA 3UROR 1QHOA 3DV6A 3ES6B 5L7XL 3GIZL 2P8PB 2XI9A 3UTPD 4L9LC 1BFVH 3FB6B 2C9AA 4JKMA 4ONFL 5FOBA 4FXKA 3O41B 1DLHB 4AL8L 1EVTC 4KJWC 3F65A 3DSFL 4X9IA 3MO1B 5E8OA 4L3EB 4AEEA 4DN3H 4NUJB 5DJ8B 5EC1B 4F58L 3VMOA 5KSAC 3BXNB 3ARSA 3FONB 5GRXG 1VKXA 4RWYL 2GJZA 1QSFB 3BW9A 1OAKL 3BQUC 1KCRL 1N3NB 2DD8L 1X5JA 5KSBB 1ZTXH 3U46A 4Z0XB 4IOIA 4HUUB 4XPTH 3ALPA 2XKNA 4LPUA 3NCBB 1UT9A 4JG0L 1T0MA 1KCSL 1C5CL 3BGMB 4P2RE 2AXGB 4K23H 2GY7B 1LO0H 2GCYB 1UJ3A 4L8SA 3RVVD 4LRIA 3L3IB 3RPIA 1WK0A 3HFML 3U9UA 4PJXE 3QULA 4Q2ZB 4WENB 4NPYB 4IHOB 1CFNB 4QRPD 3VRLE 2F15A 1KIRB 1XGYL 5FO9B 1OLLA 2WBJC 4Q9RL 4ALAL 3O8XA 2E7LC 1FIGH 4OLZL 1D9KC 5E4EC 5IK3A 3F5WA 4WWID 3WKMH 4X98B 3I3DA 1B0RA 3L7FA 1KEGH 1YEIH 4TVPE 2R4RH 1CXEA 2IGFL 3RWFA 1S9KC 1KJ3H 3Q6GL 4M8VA 5T33H 4ODWA 1X5ZA 5D1QB 3OR6A 1MNUH 43C9B 1N3NA 2VLJE 3K2MC 3MLXH 3O3DB 4X8JA 1DBML 1YDPA 4P9ML 5IHZA 1MJ8L 1KG0B 1LP9B 2FL5B 5DLML 2VYRE 1FAIH 2FATL 3F6LA 4LSSL 4R0LB 4OV5B 3HS0A 4R4FL 4S10A 1HHGB 4WCYH 4ZFGH 2RFXB 1MCIA 1L7IL 3FRUB 5EU6A 5J13C 3NBNA 3VXMB 3WE6B 3FB5B 1JNHB 1MJUL 4I5BB 4Y2DB 1XR9B 3QG6A 1TJIL 4Y5XC 4GSDL 3D5OF 1LE9A 1JF1B 2JB6A 4N0CD 1I4FA 4IRJC 3QZWG 2OTWA 4OM0L 5C0DA 2AXGA 4OV6F 3EYFA 2P5EA 4JFYB 2CRZA 1BM3L 2BCKA 5J56B 1E4WH 3KXFE 3QUKB 5C2UB 1AE6H 5JOFA 2DYPB 3AMLA 3D39B 4GRWF 1U8QA 4HIEB 2E7CA 4B53A 4YHNB 1A6ZB 1I9JH 4LCYB 4XXCC 1HN1A 2FEEL 4K3DL 1KGCD 1RMFL 3X3FH 1CFVH 1QA9B 2EZ0D 2Q8BH 2JELL 4LLYA 4AEHL 3TC9A 3UAJC 4L4TE 2J88H 4EOWL 2GQHA 1F4WH 2M8XA 3EO0B 4NOFA 3NIFE 1L9NA 1NGQL 4HZLA 2FHCA 3TBYB 3U82B 3VXQA 3QDJE 1OGAD 2EYRA 3D48R 1I8LA 1JHKL 5F71A 4HPOL 3O4LE 1WCQA 5I1AA 1T20B 3QCTL 3OAZH 4WI8A 4JREB 5ACMA 1HDMB 2VOTA 4Y16D 4I0PA 3UTPE 3FKUS 3DGGB 3WHXA 2DMCA 4S2SA 2IG2L 3VFUB 3QDHA 3QHZL 1FYTE 5DF0A 5HXMA 2WW8A 4P2CG 3FO2A 5JTWA 3GSQA 3L3DA 5EWIL 1HIMH 3IDYB 4WHDA 3IDYC 1D7FA 1PX4A 4MA1B 2CDFB 4QRQB 4PRDA 1A7NL 1MWAA 1LHZA 2C1OA 1RURL 2R0ZL 5LG1A 2ICWA 5E94A 5F7UA 4HV8A 1ZS8B 3BGFB 3LKNB 5C71A 5IR1A 3QIUC 1P5VA 3NZHH 3HG1A 5GZND 4POUB 3SPVB 4P2QE 2AABH 3SDCD 5EBLA 4JR9H 3KWWA 3UJJH 4NO3B 4LU5L 3B9KC 4Z7OE 1HKLH 4Y5YC 1MSPA 5EIVA 3MJ7A 4Z7WA 1HKFA 2DQGL 4ZPVB 1MCSA 3QEQE 2E7BA 4N1CA 1F42A 3PWVB 2DI7A 3Q6FA 2OCFD 5J1SC 5FV2A 3RDTA 3D0LA 3E6FA 1XF5B 3HLAB 4JGMA 5D7SH 5BV7L 4M6AA 3P4LA 4JZNB 4DK3A 3QO1A 4OZGB 1C5CH 3VRIA 1KIQB 1XFPA 3AS1A 4DFIA 4U0RC 1HXYA 3PGFL 3BKJH 4K94L 2FGWL 2QR0A 3QH3B 3S36X 4I48A 1D9KA 3BEVA 3QUML 3OKMA 2K7PA 3BPLC 4P4KC 3CX5K 1F2QA 4XRCB 2VITA 4X83A 3MV11 3RKDC 4JPIB 3ULSA 3QQ9D 4HBCH 2OJZL 1JFQH 4PV8B 4PRPD 3WFZA 1KULA 5B8CB 2LQRA 1YQ2A 3MRRB 1T5WB 3PHQB 2JB5H 1I8KA 5DWUH 4KZEH 2IANE 4JKWA 3LS5L 3FFDA 8FABB 3L1OH 1TVDA 1D5XB 4WV1A 2JCCB 4Y4FD 1PW3A 3P9MA 1S3KH 3NFSL 3QDJA 3B2UC 4U05A 2HN7B 2J6EA 5BZDB 4KRPD 1SJHB 2BRRH 2ZWLT 4QHMB 5BRZD 4LF3B 1VACB 2BXZA 1OPGL 2F54B 4JFFB 2EO1A 1XGPA 2XN9D 3L5WA 3PDGA 4K7FB 2YWZA 2AK4B 1CXIA 1Q9KA 2ZZUT 2D7MA 4O5LL 5J4MA 2Z8SA 4MJIB 1RSFA 3OZ9L 3P0VH 4ONOA 3OGOE 4LHUG 2BHUA 2GY5A 4RGOH 5FO7B 3FOLA 1E6JH 3OF6A 4HCRH 4HH9B 4OJFL 2JCCA 1K6QL 5IROC 5FDWA 1U8HB 4BQ9A 1ZEAL 1KBGL 3DURA 4U6HA 3IDNB 1U8MB 1QSFA 1A6TB 3HCVB 3ARFD 4LMQI 2F54A 3VD9A 4U1MA 1NAKL 2DQDH 1TQBB 4R4ND 1BFSA 1QZ1A 3O3BA 3CXDH 1NGZA 3VG9C 1DQDH 1P6AB 5EORL 2XV6B 2Z92A 3JV6B 5F9AC 3JUZA 3MMEB 1Q94A 2PXYC 4IDJL 2HJFA 3JV5A 5F8QC 1EEYA 2CLRB 4YH6A 4J1UB 1OWWA 4KZEL 1NBQA 3CSYB 1GGBL 4MMXC 2F54D 4POZC 4Q2ZA 3I3BA 1EX0A 3DX7A 4MJID 4UI2A 1MCKA 1QLEH 2VXUL 4KVNL 1G7IA 2O26U 4YIQB 5C8JB 1YEFH 3OKOB 4HK0B 4RZCA 2VQTA 4M00A 4N5EC 1B4RA 5J6HA 2UWEA 2J8UF 5DR5L 3WLBB 4PJAB 4PRPA 2MHAA 4HUWA 3UPCA 3QO1B 5SX5K 5ICZB 4DCQA 4QRSB 4O2EB 4X7TA 2AJVL 3PQYB 2YMXH 4EXKA 3WCYA 2Y07L 3D69A 3H9ZA 1VFAA 5GRWA 4U1GC 5FYJH 3S88L 3NFNA 2GYSA 3HNSH 4P46A 4OZIB 5LGHL 1F00I 1PKQE 3LKRB 3QXDB 5FA4B 2ATPA 4TUJA 4XZUB 4ZTPH 1K3ZA 3MLWL 5E2UH 1NMCB 3WL9A 5E99L 3WNNA 3RDTC 4NP4L 3C60A 3WUWG 3OB0K 4LDEB 3BGAA 5EO0B 4AM0A 1KXTB 2FWOA 4G6JL 3GJFH 1KB9K 1FFRA 5I17A 2YR3A 5EO0A 3HI5H 1AHWB 2UWEF 3F7RA 3W82A 3QUKA 3D2UD 4HMDA 4NZRH 2FNBA 4UQ2A 3HC0A 4P5TB 2V7HA 3TJEH 4CVXB 1QQDB 2HFFB 3GB7A 3MRLA 3QXDA 4M3JA 3UYRL 1LK3L 4NNYA 2YSSA 2BMKA 2HKHH 1T7VA 3WUWB 1QFPA 4K2UH 3HE6D 3LQZA 4FQ2L 3BP6A 4PLJC 3LKPA 2ATKA 5D7IB 2VC2L 4KXZH 1YYMH 2RJMA 4KJPD 3L9RB 1LO5B 3GGWA 4K3GA 4BZ2L 3TCXA 2EDKA 3H3KA 4WW2A 2YD9A 4LVOC 4E42B 1X44A 3CDFA 1I7ZB 4K8RC 4Y5VB 5C0ND 2UUDH 4DKFH 5DJ2B 3QPXH 5HHVL 3WS3A 4G8FA 5IV2A 3ARGA 3T77B 3LOWA 1EMTL 1T04A 5J9PB 1KCUH 2ICCA 1EBPA 3MYZA 3A6CH 1IE5A 3QIWB 5GRUL 5DFVC 2J4WH 2H2PD 5D7LA 5ICZA 5CEYA 4AEHH 4I18C 4FMKA 1NCBH 5EBMA 5BMFH 2NX5D 5L2JB 1YMHA 4RGND 4FFVC 2AK4A 5I8CA 1G9NH 4MXQD 5CWSA 1AD9B 4WFGE 5GIRB 2OZ4H 1CYGA 1NLDH 1H8OA 3QWOB 3L5IA 1IKFH 1JNHA 1UG9A 4DGYH 1FJ1A 2X4UA 4G6AD 2B4CC 2Z92B 3JV6A 4NKIH 2OI9B 2ED7A 5IQ7H 2AJXH 4OSUL 4NHCL 4X5WB 1JTPA 5J6GA 1NFDA 2VXVL 3IETB 2X4PB 4JKPH 1D5MB 4KVNH 2J3SA 2X70B 4OFKA 3I02B 2V5YA 3M8OH 1O0VA 3BPOB 4WI5A 2FDBP 4LLWA 1EFXA 3IU3B 4HUMB 2A83A 1ODAA 3T4AB 1RZJC 2IBZX 3SDAC 2CMRH 4DJMA 1RZ7H 5GHWL 1MHCB 4TPRL 1KTRL 4KUZH 4NYLB 3C60D 1WGOA 3OG6B 3JV4A 2JJSC 4H0IA 3KJ4C 4RFEB 2QL1A 1DQLH 1KG0A 3WO4C 4IIQC 4LLUB 3G9VA 1F58H 2NY0B 3D2UB 43CAA 4NQDA 3OR7A 1QFWH 1JTTA 3KS0J 1CXLA 3D2UA 4K9EL 4KV5E 1PZUB 2HRPH 3L3GA 2J8UA 3KPSA 5HHOE 1KXQE 2AJXL 4G80A 4XP6H 1M05B 4PJDB 3K1DA 3OKEB 4JQVC 5D1ZB 2FZ3B 3MV8B 5JPNA 1DP0A 5D6CA 4KQ3L 1NCCL 4D8PA 3WKNA 3MRMB 1CICD 4XPGH 5AAWA 4U2YA 2EYTA 5EZIL 5J12C 1A7OH 1A7PL 1ZLSL 2WBKA 4LQFL 1CFNA 4ELMA 4IMKA 3RU8H 1YEHL 5B39A 1G7LB 3SGDI 4U1KB 3O3AB 3OPZL 1KXVC 2V9TA 4PRNB 1IAIL 1T1XA 1EJ6A 1GC1C 2H32B 3PJSA 4HAFA 1HH6A 3B6SB 3LCYA 4JPVL 1FP5A 2QQQA 1S9XA 1ZT1B 5JQ6H 4L3EA 4OM1L 4OIBA 5ENWA 5L2KB 5GS0H 1K8DB 1J1PH 2NX5A 4NCC1 2PW1B 1GGCL 1Q0YH 1H5BA 1A1OB 1RZ8A 4XPTL 2P49B 1B4JH 4FQXC 2YHGA 4PG9A 2C4FT 3K2UH 5F9WC 5EO1B 3PL6B 2VIRB 3KPRB 3GRWH 2DQCL 4TRPH 4APQB 3TPUB 4TVSa 1BEYH 3MLTB 4Y1AE 2F19H 3L5HA 4Z77A 3CUPB 4OIAA 2P8LB 4K07A 4OCRH 3VXQB 3BDYH 3UMTA 5D7IE 1ZSDA 2O5ZH 3NZ8A 1KNOB 4K7PY 4BA8A 2G2RB 3AAZB 3ZYJA 1IKNC 1NAMB 3GSWA 5DD0H 1ZKAA 4JG1H 4MLSA 4P5MA 2EDOA 3LKOB 4YPGA 5C2BL 3DBXA 1P9MA 3SPVA 2LVCA 1TTFA 1G9NC 5CD3B 1QNZL 2AW2A 5CZVH 3QO0A 4G8GE 5E99H 3PABA 3TT1H 1AXSB 4MA8L 2EIBA 1YEGL 1H0DB 3MRLB 3KLHD 4KFZC 3LRSA 3MV8D 3VI3F 4NRYB 1WC7A 3L95B 2X4RA 1R3IL 1H3TA 2DIBA 1G1CA 2D2OA 3PNWA 4M1GH 1QSEB 4XPAL 3HRZA 4QOKA 5CGTA 5FYKL 3O9WD 3HNVH 4M43H 2IPKB 5HYJD 2W60B 3EYSL 4HKBB 1CD9B 2R8SL 3RWHB 5JW5B 3UZQA 4F7MA 3X13B 4R7NA 3UTTB 4LVNB 3S3SA 3CFCH 4GAGL 1QBLL 3VGBA 3GSNB 3QG6B 3PQYE 2KPNA 2MHAB 4N90E 2MJWA 4U6TA 4ZPTB 2BOBA 4YDJB 1JGLH 4NM4H 3VXMA 1ND0B 4U1HB 4NRXA 3ROOA 4AT6B 1QLEL 1YNTA 5C0BA 2E5EA 3QP3A 3MGTB 3BEWA 4IRJB 2AQ3A 1Q9LA 2OQJA 2X5PA 3LKOA 1JP5A 1WUNT 4QRSA 1CXKA 5TF0A 5IEKB 1SM3H 2FX8L 1Q1JL 3KPRA 1KYOJ 3U6RA 2VQUA 1HCVA 5B39G 5FGBC 4LHJB 4GRWB 3QCTH 3C5SB 3F7YA 5JOFB 4CVXA 1JHKH 5F1NB 3C5ZD 3OKOA 1D5ZB 4NM8L 5DQDH 2ERJC 4H26B 3QR2A 2Y9RT 5ISZE 1CLZH 4PP1D 2FH6A 2JJSA 2OTWB 1IAIH 5HYQB 1CFSB 4M7JH 4PJ7E 5DHXB 4BKLB 4MQ7A 4OCLC 3CX2A 3O6KL 3FT4A 5L8KB 4HDIB 32C2A 3IAPA 3EIFA 1UA6L 2A6IB 4MSWA 2OMNA 1K2DB 5FYLE 4G7YH 2CJUL 3W39B 3GNMH 3LEYL 1WJ3A 3BSZL 1KBGH 5LCVL 4W68A 4WGVB 4LLAA 1AGFA 1CR9L 4ODTH 4R7DA 1GGTA 5IFAL 5ALCL 5BW7C 1IQWL 3EJYC 5DSCB 1XZ0B 3GMLA 4IRZH 1XF2A 5FUZL 4NN6C 5DRXA 1OP3K 4N90D 5I8KL 4NZTH 3DWTA 1QO3A 3TVMD 1ORSB 2VWEE 3O6MH 4KROB 3WJLC 4OF7A 2Y6SD 4P23B 3MA7B 4YEFA 5D7JD 1PYWA 2FECL 4RSVA 4PPTA 1NSNH 2EIEA 2WWMD 5F7MC 1BOGB 1HQRB 1SJXA 4OCSH 4OKVB 5CJXA 4XAKD 1XMWA 2C26A 2X1OA 3BIKB 3OMZA 3EYQD 1RUML 1NMBL 5ICYA 3O6FD 4I3SL 3GBNL 2HKFH 4UV4L 4LDOB 1KJVA 1UKTA 2YA1A 4ZSOE 5SWSB 3S35X 1KLUA 3SDCA 1H9VA 5F9OL 1R3HA 4M5ZL 1BJ8A 1ZK9A 5JHLH 1IC4L 1MCRA 5SX5H 3EYVA 5E9DB 3WS6A 3LPFA 2OM5A 2CUIA 3MLVL 1JUFA 3KPLA 1CE1L 4AMKH 4X80L 3B5TA 4NKIL 1C7SA 4YAQA 4NJAL 3CIQA 3RNQB 2VXQH 2V2WB 5E6IC 1ZGLB 4QHKJ 1G1YA 4KMTL 1OSZB 3GSNL 1AQKH 2OS7A 5TE4H 4LPWA 3MRRA 4N5ED 1MY7A 1CS6A 1WT5C 4JRXA 3OB0H 4DW2L 1DANU 3VXUB 1EHXA 4J6RL 3DPBA 4WUKL 1I9EA 3IXAA 4YDVA 4W70A 1F4HA 3REWA 1KCUL 3FOLB 5MENA 2XWBB 5FM5M 5ICYB 2IJ0C 5C08A 3BKMH 1S8DA 1G7MA 5HHOB 4EUPA 4R90L 1KUMA 3MJ6A 3KG5A 4XNMA 1HKLL 1C08A 4YBHA 1FSKB 5HJ3A 2BVPB 1BGXL 3AY4C 4ODUA 2ID5A 1G7QB 2AQ2A 1RIUL 3LKSA 5GISL 5GGTH 3MRDA 3RDTD 4WU5A 2ZG2A 3DI2B 3VFPA 2NY2B 2HN7A 2R0ZH 4ZQKB 2Y5TA 4FP8L 1HHJB 5SV3A 4Q97A 5JW4Q 3VFVB 3WUWA 4MQTB 5EUOF 2ICWB 3TIEA 2SEBB 1DQTA 5K9QI 3VWKC 4QWWC 4NC1C 1MHPH 4JFEE 1P4BL 3QUYB 4BM7A 1UQSA 3GBNH 5C9JB 1SVCP 2GEEA 1F8TH 2CIKB 1NMBH 3MV01 12E8L 4HWZB 4Z5RA 4OZFG 1YECH 4OLWH 2EDYA 2WNGA 4UIKH 1FSKC 4F7EB 1LEIA 1T3FB 4AEIL 4NRYA 4AIXA 2XNAA 4OGAC 1NGPL 2W59A 4M9OA 5DK3A 1MCEA 1MOEA 4Z7WF 1HINH 2CR6A 4C83B 4HH8A 1VSCA 3BIBX 2FO4A 4Y5XA 3ZHDA 2HT2C 4NDMB 2FWOB 2NNAB 3UDWC 5I74B 1MELA 1CTNA 4R7NB 3UTTA 3MR9B 2ESVB 3NABH 3IYLW 4ZOAA 4EN3D 3NIGF 2V9RA 1AE6L 1U36A 4TSBL 2R2HA 1CGWA 1JRHH 1X5HA 1FZJB 2HFGL 4U1HA 4AK1A 3D39A 5JXAH 4W6XB 3EOAB 2DKSA 3PWNA 3PXJA 5IVOA 4KTEH 1K8DA 5EB9A 2C1PA 4XVUC 2QKIB 3LRSB 3LPWA 1DBKH 3O0RH 3X12A 4AG4H 2MCG1 3D69B 2Y6SC 1S7UA 1DVFA 5JW5A 3S97C 5IW6A 2VDNH 5IJVA 3UEZA 4XT1C 2CIKA 4KMQA 1C16A 3WN5C 5J11C 3CSGA 4I2XA 5JW3L 1GGBH 2VWEC 5D5MA 1KPRA 3BO8B 1MJUH 1QSFD 4F57H 4PRAB 3UTZA 5A3IC 3HI6L 1TZIA 3VXOB 1ZV5A 1XIWB 2XWTB 4ZUTB 1AD0A 4HHAA 3NZ8B 4X99B 3T1FA 3V8OA 5GS2H 1JI2A 3MCLH 4D3CL 1I8LC 3RGVB 2R56L 5BV7B 3VXME 3OTTA 4LGRB 3D0VB 3HPLA 2VKWA 1RZKC 5D96B 5DUML 4LCUA 4YJZL 3PQYA 3EDDA 5ETUB 1HINL 3SE8H 1TZGH 1NPUA 4HK3J 4OT1L 1KFAL 4OZ4A 5T3ZE 2BZDA 3AUVA 3WE6A 3K3QA 1WICA 1B0GA 4YFDB 3UTQA 2R8SH 3ZKND 2VDNL 1B2WL 3PP4L 3HNVL 1V3KA 2AXJA 2Y7QB 5E5MA 3KPSB 3V5HB 4OCNC 4MYWB 4L8BB 1CLCA 1PQZA 2LTQB 1NGYA 4KTEL 4PS4L 4UOW0 1VESA 1NLBH 1MAJA 2O93L 3ZKMC 2DYPA 4QRRA 3G6JA 3WDIA 2FRGP 4GMSL 5KVGH 4OLXL 1MCLA 5T5NF 1EEYB 1JNLL 4M7KH 4RNRA 2NQCA 3UBXA 2Z4QA 4ZNEA 1RQ5A 4MZ2A 1MWAH 1T1XB 2RIKA 3H9SB 3SQOL 4I77H 4M62H 5T3XH 3AY4A 1EA9C 4XC3L 4WEBH 5E1AA 3K74B 5GZOC 1E0OB 4N0YH 4YGVA 5D5MB 4Y4FB 3VFMB 4O51A 5ACZB 1NKOA 1QPPA 5IVZB 5DTFA 3BW9B 4PG2C 3LMJH 3TYFA 5FIEA 5HGAB 4S1SL 5J6GB 1OQOA 2MWCA 2O5XH 4GXUN 3SGJC 3MQIA 1HSBA 2X41A 1J11A 1MVUB 2ZKHL 5HDOA 4HC1L 3PGFH 4MJ5A 3FT2A 3STLB 1M7DA 5IV2B 4OKVA 3QDMD 3O41A 2DQIL 4OFYA 2F74A 3GK8H 3HUJE 3WNKA 1CFQA 4BSJA 4NQSB 1B6UA 1IC5H 1YNTB 5C0BB 5CIPB 5JUEL 2AXFA 3LQZB 4BFBD 5GSRA 2G75B 3LEVL 3ARFB 3FB7A 1KSRA 3KGRA 3KPOA 5IVXB 4WY7L 3NGBC 5FDYA 1IAKA 5DYOB 1T5WA 3PHQA 3UJJL 5KJRH 3TO4A 1JGVL 4R96A 1UCBH 1CGVA 4JFFE 1A3QA 3EBAA 4PGZA 4AH2A 1I9IH 3MRFA 1ACZA 5C1MB 3ULSB 2X1QA 1Q8MA 4Y2DD 2D0GA 5EBWA 5L88L 2RB8A 3H42H 3MV7A 3Q6FB 4Y16B 1QBMH 4J2XA 4NNYB 5IBTL 4YBQD 1UKSA 1J1OL 2H41A 4JFOA 4RQQA 3QPQC 2CH8A 2XKNB 1JZ7A 5EN2B 3QRGH 1QTYT 4HWBL 3RY6C 1F90H 1NMAH 3LQAL 4R26H 1MQKL 2VXQL 1KJ2L 1T0PB 3TFKD 2XZCH 1INEL 5BOPA 2GSGB 4XP9L 2HFEA 5C0FB 1LILA 2RBLA 2C1OB 4X6CB 1LEGA 3T0VA 3S6CA 3U0WL 2BVPA 4H5SA 1IZKA 1KJMB 3ROOB 1YJDL 1O5DT 4PJ8D 5HDBF 1HEZA 1FG2A 5JHLL 2AJSH 1KJMA 3IDGB 1FNLA 5KTEH 1UEMA 4IJ3B 1BFOB 5EZJA 1V3MA 1NDGB 5JPMA 4ZUWB 1A4JA 4BZYA 4NJ9L 5CSZA 3E1F1 5GQBA 1CIDA 1KEML 1S7TB 2ZP0T 1CT8B 1J8KA 3S5LB 3GMNA 4NGHL 5E03A 5MERB 4WJ5A 3P30L 1B6DA 3BKCH 4NN7B 1QQDA 2HFFA 3GB7B 2UVEA 4NSKA 1IM9A 1P4IL 2R4SH 5ENWB 5L2KA 1ED3A 4YPJA 2NY6B 1UM5H 3VI4F 4DUWA 4YHPA 5GZOD 2QLVB 3B6SA 3T3PE 2EXWD 5KSAA 4ONHA 1LE5A 1EHLH 2XZQH 4DZ8B 3KJ6L 1WZ1H 3VXUD 3H9HA 2CR3A 2DQJL 4CJ1A 1TJIH 4N0FB 4P2RA 1DQJA 4I9WE 4OLEA 4PRPB 4O4YL 1XGQA 3HC4H 1SVZA 2EYTB 5IFHH 1T0NA 3DURB 3SDCB 3BVNA 1MPAH 3OGCA 4TVPD 3KPTA 1S9WB 3VRJB 5BJTB 3QIBB 3KYAA 4M1CC 1VFAB 1MJ8H 5FYKE 3MJ9A 1BX2B 1VGKA 4KRMB 4P9MH 4K3EH 4MNHA 1FL3A 4ERSL 2W65B 2P48B 4QYOB 4HXAH 2R1WA 2IGFH 1KJ2H 1MCWM 4LF3A 4XPBH 1MRFL 4Y4KA 2NZIA 4O2CA 4LMQE 3LV3A 3MODH 3EYUH 4X98A 4MNQA 5DMKA 3RZCD 5B38B 1CFBA 2VLLB 3BDXA 3GSVA 2Z0BA 3VFWA 4YWGL 5D7IF 4PRNA 3O3BB 5DHVB 3P4NB 5C08E 5EUKB 1P1ZB 5HYFA 4O51B 3ZTJG 1NUDA 2VLMD 2BSRA 1BD2E 3V8CA 5LGHH 2XY2A 2V5TA 4X9FA 4F7CB 4M93B 3L7EA 1SJHA 4LKXB 3PHOB 3OJDB 1Q94B 5C7XL 1UCBL 3K80A 2YMXL 3EJZC 4JFDD 5I71B 3BRFA 5KJRL 3U7AA 3V0VB 5I0ZA 3IRZA 3BJLA 3R1GH 4G80B 2IPTL 1A7BA 3KPRD 3TCLB 4G9FE 2I5YL 3WIIL 1XH3A 4JM4L 4RMSA 4UNTA 5KAQG 1YN7B 3RVUD 1KGCE 5J3HC 1YEKH 2X9XA 4U1IA 2GJZB 4NQVB 4QOKE 5MEQA 1I1CA 3L3OA 2XQBH 5I1GL 3DYOA 2XN9B 5ERWB 3O6FB 2E8YA 4YBLB 4L1DA 4TNWF 4NQXB 4A2LA 2IFFL 2V2XA 1B4JL 1K85A 2W0KA 4XAKE 3FFDB 4KRNA 5D1ZC 4PLKC 4FOMA 2DWEB 3MJ8B 2A77H 1Q9KB 2VH5L 4PD4K 4R7DB 3UJIL 4Y4FA 5ACZA 4LLVA 3ME0A 3MRCA 3RY6A 1FRGL 2HLAA 3BH8A 4MAYB 4U0QB 3CDCA 1LDPH 5F7FA 5CILH 2HJLB 2FIKB 3S37X 2QBWA 5GJSL 4PJBB 4NUJA 1S5IL 2AGJL 2GJ6A 5CS7A 4K9EC 5KN5B 2CKBL 3B83A 3BPLB 5CP7B 1FO0B 4DKEH 1CVSC 3X11A 4PTUB 3THML 5H35A 3QDMB 1O7VA 5D72H 4HX1A 1AXIB 5E08L 3K46A 4U1GB 4BSVB 1S7RA 1KPRB 3MLYL 2W07A 4CL7A 4N8CL 1P53A 5AYUH 4Y19D 2XTJD 1KPUA 3MBEA 1KACB 5SWSE 4XRCA 1I8IB 3TA3D 1A1NA 1GGYA 2APBA 3KPSE 5FYKU 5DD5H 1GIGL 3C60B 2HTLD 4R26L 5IKCA 5C9KA 2B1HL 1AXTL 3PWNB 4XVUD 1M71A 4EUPH 2IMNA 3VDCA 1XR8A 3JWOL 1KCKA 5TE6L 1A6WL 4IMKC 1UM4H 2E6PA 1QVOB 2ED8A 4KQ3H 5ABDE 3TVMA 1FQ9C 3SGKC 1HYSD 5EU3B 2BVEA 4HV8B 1CL7L 4A6YB 4HGWB 2R15A 2Z93B 3KJ4B 4W6WB 1JFQL 4LIQE 5F1IB 3RGVC 1LK2A 3C09B 3QUZA 3ROLA 3D3VD 1NDMA 1WTGT 2A0LD 1ZANL 3MLRL 1ZT4B 3DARA 4Y16A 1N59A 2F8VA 3ULUH 1OTTD 4YHKH 4HS3B 4TPRH 5JXED 5GS3A 1NMAL 2OZ4L 1LE9B 5SWSD 4XBGB 3QWQB 3QFJA 2B0SL 3W5MA 4YX2H 3M8OL 1T5XB 5TFSH 3O2DA 1NGXA 3T0AA 3IFNH 1JPSH 4QWWD 3RWGB 2D7QA 5EZLA 3JVGC 4XWOD 3W0WD 3HUJF 2IAMC 2VL5B 2VAAB 1OGAB 3H42L 3SE4C 4FG6D 3V6BR 1LEGB 3HG1D 4N0UA 3SDXE 1OB1A 4S1SH 4WU5B 3IDIA 2DLFH 3VXTB 4YDKL 1EFQA 2UZXB 4ODUB 3WDHA 4RFOL 1DANT 1N6VA 2IEPA 2C3HA 2NY4B 2PKDA 3IAQA 1BIHA 1XCQB 1YPZF 4DQOH 1FZOA 3C8DA 2PR4L 1F5WA 3QDGE 4E0RA 4DGVH 5M95B 1J0IA 2BCKB 1RJYB 1YYLL 1OCWL 4NRZB 2E9IA 1CBVL 3EJZD 3EFFA 4YDLC 5HY9B 4M61B 1L7TH 3F5WB 4Q0XL 5L2KE 2APXA 3KYMB 3IDXH 2VUOA 5HGAA 3RHWK 1U93A 4QTIL 1I3GH 5EPMB 5FM5O 3V79C 1UENA 3WFEH 3AREB 4WVRA 1WEJL 4YGVB 3TZVD 3VFMA 4ODWB 3K8MA 5D1QC 2ZSVB 4ZOBA 4ZS6D 5FHAL 3E8UL 3EGSA 4QHMA 3W5NA 4HUXB 2P1YA 1CE6A 2OTPA 4PJ7A 4Z7WE 4S0SD 3LEXB 1CU4H 2MPAL 5L9DL 1SBBA 4GUPA 3PHSA 1BJ1J 1BF2A 5E6ID 1EEZB 5BO1H 1HHGA 5IWLA 3ZKQD 5E6YA 3T0BA 1MFBL 3DMMB 3LMJL 4PJDA 4ZO6A 4GFTB 1BF8A 3VXSD 5FV1L 1IAII 1NGQH 1CD1A 3UXFA 3W9DB 4WO4A 4KU1A 4GKNA 2R1YB 4PIRF 3AREA 1UM6H 1P7QB 35C8L 3BZ4B 4V1DA 2AV1A 5B38A 2XRAL 1JPTH 1MVUA 2OYPA 3FB8A 3CFDA 3HS0B 4Z7UB 1U8PA 3EFFB 3L7FB 3BPCB 3OAUL 5LJYH 4YUEH 3LN5A 3L6FA 4Y5YB 2JLLA 3O8XB 5A2JH 3B3IA 1ZVHA 4PLNC 5MHSE 3ARED 2V17L 3H2WA 1U92A 3HNSL 1I7UB 1CD1B 3CSBA 5HDQH 2WMPA 1IGMH 5K9OA 5D7JC 1Z9SA 4N8VB 4MZ3A 2KZ1B 3KLHC 4G42A 4HIIB 4XCNB 5J1TC 2X9YA 1S9WA 3VRJA 2D7PA 3WNOA 4C56D 1SQ2N 3NA9H 3QZWB 2DIJA 1EFXB 3IU3A 2W9DL 1AGFB 3V2AR 2HG5A 1KT2B 4XPHH 5A2IH 3P0GB 3O9WC 2D7OA 5DVMA 1YY9D 2BSRB 1S78D 1E6JL 1RIHL 4R3SB 4UB0H 4LSSH 2DM4A 1BQUA 5I9QB 5E08H 5CEYB 5DXWA 4GRWE 3V5HA 3N1MC 2ZUQB 3OKNA 5ID0A 4X5XA 3IDMB 1KELH 2NPLX 5I1EH 4B7IA 4PJ8C 1T0MB 4XVTH 2CXKA 5E8OB 3D6GA 2PN5A 3VG0H 4RISH 2CLZB 3QUZC 3Q6GH 3HZKA 1MCHA 1I1AB 1SYVB 4G8FB 1EO5A 4UNUA 4N9GA 4OD2A 1FBIH 1CT8A 3C60C 4CBPA 4L4VB 4UIKL 4GKZA 2EDWA 2LV4A 1T1YB 3NOIA 4UT7L 2P8PA 5DURD 5ADOH 4EI5C 4Q9RH 5DS8B 5CJOL 4QEGA 4YEEA 3UTSD 1XGRA 3BYYA 4LCWB 1BLNB 2NNAA 2WSKA 3O0RL 4AG4L 1ULVA 4YHYC 1A7RH 5FO8A 5EULV 5E6IA 3KPQA 3QXTA 4QHUB 1OPGH 1FYHB 5FCUH 2V7HB 2VSCA 4FQPA 2VISA 1BJMA 1QKZH 3P4MB 3BWAB 4TSBH 2J7LA 4IRZL 3N06B 1T21A 5KOMC 3SGEI 5INDB 1VEMA 3F7VB 3OKKB 2HFEB 5IFAH 2YEZB 1XGUB 3HG1B 4LVHC 1FL6A 3DGCR 5E2JA 3HE6B 3ZL4H 4JHBA 3HRZB 4QOKB 1CICC 2EXYC 3I50H 5C0AE 4FFVD 2YK1L 5F7DA 1TITA 5JIHA 2DD8H 4JO3H 2HMID 4JZJC 1TVHA 2OJZH 4KKNA 4WWKB 3QDMA 4GG8B 1RI8A 5T1LA 2P5EB 5GRVK 3MUZ1 3C5SA 2APWA 3FO2B 5K59E 2VDPH 1FZJA 1LDPL 4FQJH 1BWWA 1S3KL 3NFSH 1MHHA 4BH8A 3B8YA 5IMMB 3SO5A 1H5BC 3MCKB 4HLJA 4HCRA 4YWGH 4Z7UF 2IFFH 4WFEE 2CLVB 3O9WB 2B1AH 5DYOA 3V9FA 3QG7H 5ECJE 1IJ9A 4QHNB 4C83A 4QHUA 4P46B 4PRIB 1SY6A 2E9JA 1TJGL 2M2DA 3IS1X 5T3XD 2QHLA 4NQSA 1RUAH 2XWBA 5CBAB 1FHGA 1TQBC 2ZCHH 2IANB 5JDSB 3SKMA 2YC1B 5E95B 3NCYS 3R1GL 5HJ3B 2Y1VA 3HB3D 3IFLL 4G6AC 4GRLD 3SJVD 2YPKB 4IRSB 5FYKH 2P7TA 5A16B 3KVQA 1MCOL 4ZO7A 2GK2A 5BV7H 4H8WH 3QUXA 1NC4D 3PABB 3UTSB 3QWRD 3WSQL 3MRIB 5GGRB 1LGVA 3HR5A 5JOPE 3L7EB 5MEPB 4U1JA 1A7QL 3U83A 4QRUA 1G9MC 1WF5A 3B9EA 4O58L 3HCVA 1DQML 4Y4KD 5TE7H 1MFCL 3U4AA 1R3HB 4XNZB 1WIOA 3MJ8A 1E6OH 4HSQA 1MCPL 2BNQD 3RVXC