4OZCA

Backbone modifications in the protein gb1 helix and loops: beta-acpc21, beta-acpc24, beta-3-lys28, beta-3-lys31, beta-acpc35, beta-acpc40
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
56
structure length
50
Chain Sequence
b'DTYKLILNGKTLKGETTTEADATAEVFQYADNGVGEWTYDDATKTFTVTE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Streptococcal Protein GB1 Backbone Modified Variant: beta-AC
publication title Folding Thermodynamics of Protein-Like Oligomers with Heterogeneous Backbones.
pubmed doi rcsb
molecule tags De novo protein
total genus 11
structure length 50
sequence length 56
ec nomenclature
pdb deposition date 2014-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01378 IgG_binding_B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4ozcA00
1YMHE 2N7JA 2ONQA 2JZPA 1F2RI 1HEZE 3FILA 1P7EA 4HKZE 3MP9A 1IGCA 3V3XA 2JSVX 3GB1A 3FILB 1MHHE 4KGSA 1PGAA 4WH4A 4OZAA 5HHDG 1K53A 2K0PA 1MHXA 2N9LA 4KGTA 1UWXA 1JMLA 3UI3A 1QKZA 2ZW0A 5HI1A 2LGIA 2I2YA 2J52A 5HG2A 2RPVA 4KGRA 2LHEA 5BMHA 2I38A 1XF5L 2JWUA 2J53A 1MI0A 1KH0A 1FCLA 1FCCC 1MPEA 1K51A 1P7FA 1PGXA 2QSDA 1C9FA 1XCTL 2IGHA 1F2RC 4GLSC 2ON8A 4D2KA 5BMIA 2KQ4X 2RMMA 4OZCA 4IKGA 4HJGE 1IGDA 4OZBA 4IOIE 1GB1A 2N9KA 2LHDA 5HFYA 1D4BA 1GB4A 2JU6X 1HZ5A 2ZW1A 1MVKA 2IGGA 1ZXHA 2LUMA 4MACA 2PTLA 1IBXB 1EM7A 2KN4A 2KACA 1PGBA 1XCQL 1K50A 2GB1A 2NMQA 2GI9A 1HZ6A 2PLPA 2IGDA 2OEDA 1Q10A 2QMTA 1FD6A 2KWDA 2JXTA 2PW9A 2EELA 1YNTE 2KDMA 5JXVA 1IBXA 5BMGA 1K52A
chains in the Genus database with same CATH superfamily
3H7PB 2KFJA 1I42A 1SEBD 2GOWA 4MGYE 2JZPA 3ZRCA 1F2RI 2QDFA 3ONSA 2KDFB 3BINA 3K9PB 2SEBD 3NVWA 1QF6A 4MH8A 5EE3A 4E74A 4MEMA 1PGAA 5FR6A 4WQMA 4CHKA 4DHJB 4DDGD 4C4VB 2INCC 3AE9B 1WXAA 4MELA 1N63A 2PVOD 3NS1A 4XWTA 1KLGD 4K81A 1YJIA 1BT0A 2HE7A 2I38A 4HPMB 4WIPA 3DPDA 1E7UA 2FE8A 2DZJA 4W9JA 1E8YA 4JIOU 1WGGA 2Q5WD 4O1NA 2K5PA 2XK5A 1WFYA 2E3TA 4ANWA 3RNEC 4FHJA 2EMSA 1JALA 3AE8B 3UIPB 4RGTA 2N9PC 1OQYA 4W9GA 2KLGA 2D2QA 4IDIA 1ZUD2 4GDKA 4RGMA 2V3PA 3AU5A 4W9DA 3L16A 1RFAA 2JT4B 2MCNB 1E6EB 3U7DA 3U2SC 2M0AA 1V9JA 2M8SA 2CJOA 2ASQA 2D11A 3H1UA 2RDGA 3CMMB 3HUIA 3HK0A 1FNVA 1XXGA 3V05A 2Y5CA 3A9JA 1VJKA 3B1LX 3VUWA 2JXTA 1KJTA 3AI5A 3PVLA 2PW9A 2EELA 4P1CC 1SGHA 3C19A 5CHVC 2IZVB 2WXFA 1CZPA 2FCMA 4EUTA 2JRIB 3Q3FA 3B2FA 3Q8FA 4DXFA 2LWPA 1YN5A 4KGSA 1TKEA 2D5GA 3UIOB 1FRRA 2WXJA 4MGIE 1WWTA 2CJNA 3VR9B 4W9HA 1L0XB 1Z2MA 1QKZA 5HKHA 5G55A 2I2YA 2J52A 3HRDD 1PYWD 2ZNVB 3JVZX 2FBWB 2JWUA 2J53A 3TMPB 4NQLB 3N20C 4BVUC 3VH3B 2RPQA 1PGXA 3T3OA 1PQSA 3AU4A 2JVCA 2HD5B 1C78A 2D3BA 5D3IB 2UU7A 4A55A 3QHTA 2LXCA 3AE6B 3BK1A 3BYTB 2BS4B 4RGNA 4JQWC 4AP4C 1RLFA 4HKQA 4A90A 1PUTA 1EM7A 1UBIA 4LNFA 4KX6B 3KUDB 4HCPB 4ZYNA 4XDCA 2LRUA 3OJ3A 3MJ5A 2BVCA 2RR9A 3ZXRA 2FIFA 3A4SC 2KJRA 3NJTA 4W9FA 3RUIB 3M95A 1E0ZA 4YTPB 2KDMA 2K8CA 2AQ2B 3K9OB 4DBGA 5AUKA 3BIID 1IGCA 1TIFA 1EUVB 3PZ8A 2WXHA 1DGJA 1TS5A 2X38A 4FJYA 2WNMA 3X0WA 4IM2A 1T6BX 2JY6A 1C4CA 1SIJA 2QHOA 4WH4A 4M8MA 2LVQA 3WALA 2WLBA 5BYSA 3AE3B 2ACZB 2N7DA 1T3QA 4S17A 5C2TB 1C77A 4L2YA 4HJKA 2G1EA 4EZJA 1E8ZA 5IKCM 2QILA 4I6NB 2KTRA 5IP4D 2PPHA 4WJPA 4IG7B 4BOZB 3NUHB 4NAWB 2BS2B 2KDEB 2NCNA 4OZCA 2I1JA 2ZEQA 1KTKA 2IPKD 1Q0WB 4IKGA 1IGDA 1UELA 2H89B 3FKYA 5D94A 4XX5A 3PHXB 4BKSD 1KFYB 4YTNB 2LUEA 4NAMA 2V3SA 3P4QB 3DWGC 1WXQA 3DBRI 2XNAC 4LLGM 2NVUI 5T8IA 3QC8B 2IYDB 4PS7A 3X23A 1ZP0B 2J7QB 2KACA 5J18A 3BVZA 4A6QA 4TSSA 2V3NA 1WH3A 3FC4A 5EE1A 3N1YC 3OLMD 2D10A 3A9JB 4JL9A 1C76A 1QLBB 3SEBA 3JSVB 1MG8A 2EKIA 1HEZE 4HKZE 3UQAA 1FM0D 2WXPA 2K6QA 1VCBA 4PS3A 3LJ3A 2QEJC 2PMVA 3LDZE 2CHZA 3RNFC 4OVVA 2NPTB 5HHDG 3E56A 1MJDA 2BF8B 2ZCBA 1TBEA 2V4LA 2BBCA 1V97A 3PTFC 1QOAA 3WIMA 4AWJA 4NPNA 2BYFA 2AWTA 2RGFA 1WR1A 4TQ1A 1XF5L 1L6VA 4B6WA 1SF0A 1ET9A 1FNUA 4FJZA 1L0YB 1JROA 2KC1A 2KMAA 4C4VA 4A3PA 3ZIMA 1P3QU 4B0EA 4EZLA 1P1AA 2HTME 3ABVB 4KVGB 1GB4A 2JU6X 1A70A 2L52A 1E8WA 5E6NA 4NY0A 4LDTB 1WXMA 5CHWA 3ZNGC 4I6LB 1Z5SB 1MVKA 3ZO5B 1GC6A 4HPLB 2VRRB 4X57B 4YWGG 3PO0A 4KDLB 4DWFA 4HLEA 4GN1A 2K8BA 4RH6A 1UZXB 4TKNA 4ZYSA 2QC8A 3PLUA 3W5UB 4DHZE 4NJ7A 4P16A 1OTRB 1C79A 1JWSD 4XGAB 1NVID 1R4MI 1TJEA 2WU5B 3L10B 3OG5A 4EOYA 2KT7A 2K1FA 4FLHA 5JXVA 2KX0A 2KX3A 1T0RC 5J17A 3QCAA 1EF5A 3GZNI 1ENFA 4NJ6A 3TEYA 3A9KA 4YXDB 5EE9A 1WX8A 3EGRA 2LXAA 5BO4B 3MFGA 2MJEA 3APDA 4JE3B 1EO6A 2FNJB 5GMVA 3W1YA 1ESFA 1FMAD 2GBJA 1MHHE 2KAJA 1NBFC 3H9DA 4EZKA 4LTUA 2IO1B 4K7WA 4WWPA 3DVNU 1ZDXA 2BB5A 3L54A 1RFKA 2KWCA 2KWUB 3W1SC 2K6DB 1F77A 3W2DA 2ZW0A 5HI1A 2A4ZA 2UWQA 3OWEB 3GOEA 2KOXA 4WQOB 2OJRA 5IA7A 4MH0E 2KHWB 1C4AA 2A5UA 1BXTA 2V0GA 1P7FA 2WXOA 1LXDA 3WANA 4ANUA 1F2RC 2DZKA 2VZKB 5BMIA 5I4DA 1QZEA 5D6JB 4WWMA 3RNCC 2L83A 2KXJA 3ZJVA 1AW7A 4TQ0A 1N60A 2LGYA 4WAFA 1YIWA 1CMXB 2LHDA 2MHJA 3AEEB 3KH0A 2K9XA 3TEXA 1R4MB 2MBOA 2V9HA 4ANVA 3NRZA 3I3TB 4WURA 1ZXHA 3C8YA 3AB5A 3VVWB 3GZNB 3RNAC 1ZPSA 2MH7A 1R7SA 1VZ8A 4ITKA 2FUG1 3WAOA 1V5OA 1I35A 1L7YA 1OQRA 2ZCCA 1SJHD 1I4HA 2WQYB 2D3GA 2WXIA 2BW2A 2IGDA 1J7AA 2DAFA 3VAWA 4FBJB 3TUOA 4ZRIA 3NVYA 3AN1A 2CR5A 1Y8RC 3GP7A 2JUOA 4KKJA 2WX0A 5MPOA 3P2BA 5D7GA 1R4NB 2SAKA 2C7NB 3OAWA 2N0SB 3VQIA 4YT0B 1FFUA 3HM6X 4A3OA 3V6EB 1B1ZA 2VH1A 3KVFB 1ISNA 3IAM1 4GIVA 2D07B 3DOWA 3UI3A 1TS4A 1WM2A 1EWYC 1TY2A 2NS5A 5DPTA 3MC9A 2DYMA 2WDRB 2RPVA 4BZAA 4BBNF 1XLPA 4GMVA 2L05A 4RM9A 1NI3A 5IN7A 3NS8A 2MLBA 5EDSA 1K51A 4UDUC 3NZUA 2Z59B 2KQ4X 3QJZA 2CU1A 2C9WB 3AE4B 2KN5A 3AE2B 5E6JA 3WA0A 4US8A 4C7ZA 4MSQB 3BWUD 2DLBA 1HZ5A 2DWQA 5IOIA 3KWLA 3RN9C 4NAWA 1YJJA 5L83A 3QQ8B 5G5HA 4N9F4 4M00A 2PE9A 4G0NB 3VTVA 1IP9A 4EKUA 3PHWB 5CTRC 1UUPA 5IO9A 1UGJA 2ZPYA 3PRMB 3ZVVA 2Z8LA 1WGDA 4RF0A 4WAAA 3TIXA 1J7CA 1PDXA 4P1BC 4IC7B 3WCQA 3R3MA 1YMHE 4II2B 3VXWA 1T0YA 3QK0A 3U52E 4YSYB 3MP9A 1F0ZA 3V3XA 2JSVX 3A9KB 1VRAB 2MEKA 5BYRA 2BS3B 1QOGA 1FXTB 3CSFA 2IY1B 3ETRA 3TCAA 4S0RA 1BMLC 3BVGA 3RZFA 3JSVA 3LYYA 3SFDB 3ML8A 3TEWA 3L08A 4WJOA 3ZTDA 5H8YE 1L2NA 2N4FA 2JYEA 4FN2A 2KQ7A 4XYCA 1J7BA 4RMAA 4F8CB 2NPTA 4KDIC 4ARCA 3B2GA 4OW0A 1C9FA 1SE9A 2L7RA 3JW0X 5JZEB 1XT9B 2CHXA 3WAMA 3RNBC 2KWVB 1J8CA 2W55A 3V6CB 3C0RB 3RMKC 2BB6A 1XO3A 1VDVA 4LNIA 2JX5A 1I4GA 2VH2A 4KSKC 3DQVA 1IBXB 1FXAA 2CKHB 3IBEA 1XCQL 1WMHA 2ICIA 2DAJA 3M63B 5H92C 2C5LC 2QIEB 3VTUA 2O6VA 1N5XA 1V8CA 4MT5A 5CX3A 2WDVB 2FUHB 3URYA 1YNTE 2W82A 2Y3AA 1I4QA 3O13A 1KM7A 3NY5A 1QQRA 3FILA 2IO2B 3BK2A 1WGKA 2KC2A 2KFKB 1V1OA 1P98A 3TSSA 2DZIA 1D5XC 2ZJDA 3PRZA 1TT5B 2N9XA 2G4SA 2MJDA 2WDQB 1GPXA 3EECA 1JW9D 4K3CA 2N9LA 2L0TA 5D2MB 2H88B 2IO0B 1T0SC 2WP9B 1XLOA 3SFEB 3IG3A 5FR3A 2L3ZA 3S2AA 2LMCA 5LLIA 4HROA 1S1QB 3SD5A 1D5MC 1YX5B 2KK8A 2Z0DB 4NJCA 4OZBA 2N1VA 1CQVA 1OFFA 2NBUA 2NBWB 1T0QC 4NQKE 1AN8A 1GOZA 2Y5PA 2JQRB 1V6EA 2R2OA 4IM3A 3DHGC 3CIRB 2CHWA 1WJ4A 1SSNA 4M0WA 3AEFB 4HVBA 1EU3A 4JPSA 4ZDVA 1GJZA 2INDC 1N6ZA 1ZGUB 1UF0A 3N3KB 4J6IA 4ACFA 4Q2JA 2XBBC 1JCKB 4PK1A 4XC2A 2L0FA 3DCGA 3T9LA 4TV3A 4GGQA 1HZ6A 3UF8A 4QAYA 5LNK1 4DQOC 1SBBB 2JZZA 1FIQA 2KMCA 2M0XA 1WJNA 5FK9C 2MWSB 3A1QA 5AZGA 3M62B 3Q3MC 2JF5A 2JXXA 2REXA 3SHQA 4JWSC 3EFCA 1E8XA 1OEYJ 4C00A 3VRAB 1L4ZB 3MC8A 3PLVA 4IW0A 2PJHA 4A20A 4HCNB 1V5TA 2GMIC 4BFRA 2L1AA 2KYWA 3P4SB 3V60A 1P9DU 1WZ0A 2K0PA 3Q69A 3DDCB 5AEKB 1F1HA 1V86A 1YOVB 4RFBA 1FXIA 3P1MA 4I6PA 2ZPNA 5KHOA 4EEWA 3HVZA 3PZDA 3TJPA 1ZOYB 4RNAA 5AZFA 3APCA 4PYZA 1WY8A 5JHAA 3CWIA 1V2YA 1ET6A 2CU3A 4LCDE 2AEHA 1STEA 3ZTCA 4GDLB 1EF1A 4HEA1 1TGZB 1KLVA 5AUIA 3QAQA 2WX1A 4REZA 3W5VB 5DPRA 4ZOHC 5CHFA 1MG4A 3EUB2 1RM6C 1WF9A 1WE6A 4OVZA 4OHJA 4ARIA 1I4XA 4LJOB 3WAPA 3B9JA 2BTEA 4N59A 1WRIA 3PS6A 1JWMD 4HDOA 2WXRA 2ZVNA 2OJWA 1K50A 2WXLA 4ICUA 1WMHB 1C4PA 5FKAC 3AE1B 2OEDA 2O6VB 2BWES 1FD6A 1NI2A 2MJ3A 1WZ3A 1HA5A 1K52A 1QOFA 4AJWA 1LM8B 3DVGY 1P7EA 4DHZB 1X1MA 2OHFA 4MSMB 3FILB 2RDHA 4NZLB 2LFIA 4DXGA 3R8BA 3ZNZB 3RNGC 1LGRA 1Q1OA 4BAXA 1WE7A 4KIKB 3W1SA 1AWDA 4AOFA 1GNUA 4PYUA 2O2VB 2FIDA 3AECB 2JYTA 2GBRA 5HG2A 1N5WA 3AH7A 2IO3B 2WWZA 3TBLD 1TKGA 1Q5WB 4LK0M 3H7SA 1RYJA 2M4NA 4CYEA 2QSDA 4LNNA 1XCTL 3ZNID 1YX6B 2ON8A 4D2KA 2E6XA 1HTOA 5C3JB 4ZHOA 3ALBA 1HE8A 1ZDVA 1D4BA 1C3TA 1DYQA 3GE3C 1R4NI 3I9V1 3NVZA 3PRPB 2FCQA 2ZVOA 2LGXA 1WXSA 3BY4B 1SE4A 3VUYA 1QOBA 2R2QA 1I4RA 2M17A 4WWOA 1C1YB 4M0WB 3Q8EA 2DYBA 3D32A 1PGBA 1K8RB 4ICVA 2DHZA 2GB1A 4TUUA 1L0VB 1N62A 2KJ6A 4GB9A 1TZOA 1I4PA 2G9HD 1SIFA 2KWDA 2V1YA 1KRHA 4MGZE 4KZ0A 1IBXA 2B3AA 2KVZA 1KOTA 4KSLC 3PPAA 2LEKA 5TR5A 3A1QB 4JLCA 3I5JC 3ZW3A 3GB1A 3EFUA 2KDBA 2AQ3B 1ZW7A 3N32A 2J0KA 3R66C 3J9CA 4LNKA 3QWZB 4BKSA 5DPSA 2IY0B 3AMZA 3RZWC 2WS3B 2KFKA 4P6VF 2JPHA 2MP2B 2ZNVC 4RCOA 4KGRA 3Q8BA 3GE8C 1L5PA 4M8NA 4HK2A 3ZYYX 3L17A 4URKA 1SXTA 1UD7A 3ZNHB 3EA6A 2KANA 4GU2A 3PSEB 1G6JA 4IWQA 4G11A 4WJQA 2N9KA 3AEBB 1KLUD 4AJYB 2KQSA 4L1BA 4EFOA 3T8MA 4JWUC 1FPYA 3Q3NC 1D3ZA 1WSPA 1TZ1A 4ANXA 3ZJTA 2WXKA 2R61A 1FEHA 4KZCA 3DBHB 4MACA 2KNBA 1WI0A 2KD0A 1E7PB 1TS2A 3RI7C 3R2IA 1CJEA 2LJIA 1J0GA 2NMQA 3DBLB 5C1ZA 1IUEA 2VZKD 1VLBA 1H4RA 2WXQA 4E3CA 3AXCA 2BYTA 3A33B 4ZRQA 5BMGA 3KQ4A 2N7JA 4JX1C 2XEWA 1FFVA 4KKIA 3HM3A 5G2NA 1XD3B 3U4EG 1TYGB 1NYRA 5E6PA 1AARA 1TY0A 4MM3A 4YSXB 1LO5D 4FA6A 1WJUA 3PT2B 1F52A 2BWFA 1QT9A 1JMLA 2PIAA 2KO3A 1SJED 4W9IA 3QIJA 1XEEA 2WXMA 4MJSA 3RT3B 3ZRFA 4ZRJA 1SE3A 1E90A 2GBNA 1YN4A 1KH0A 1FCLA 3PREA 4DK5A 4GLSC 3P4RB 4GSWA 3V61A 1HQRD 1OQQA 4HWIB 5G5GA 1FRDA 1WGRA 4W9LA 3E9SA 2IBIB 4US9A 4HJGE 2MA9B 3LB8C 1B9RA 4R3DA 3HHMA 5HFYA 5TSSA 1D6EC 3P63A 2ZW1A 2OOBB 2BT6A 3N9YC 2J0MA 1YJ1A 1TS3A 1IYFA 2WYQA 3TL5A 2JZ3B 4TMAB 4E71A 1UBQA 4GDLA 3IT4B 2MSED 4K1RB 1XLQA 3Q8CA 4PS8A 2GI9A 4DHJD 1RWSA 1L6UA 4M02A 3TEZA 4BKGA 1N61A 4RGOS 4WJNA 1JRPA 4OVUA 3QX1A 4PT5A 2AX5A 3Q6BA 5DCNA 4CQNA 4DXAB 2AQ1B 1UWMA 4K7SA 1JRUA 1WX7A 3KYCD 2MBEA 3R7RA 2KZRA 1XLNA 4OZAA 4W9EA 2EKEC 2J4XA 2FAZA 2LZ6A 4AS1A 1DOIA 2NBVB 2W3SA 2WXGA 1J19A 2UYZB 2DBYA 4KGTA 1UWXA 2BPSA 2KLCA 2V4IB 3DHIC 2LVOA 2LGIA 2YEPB 3IXSA 2HJ8A 1VZ7A 4KIKA 4II3B 2WDTB 4H2AA 5DPWA 3FAHA 4XDDA 1D5ZC 2O2VA 3I57A 1GC7A 3RD2A 3H8HA 3ZDMC 4MGKE 4RM8A 4XZ4A 1JWBD 2GLSA 2K3UA 3MC0B 1IPGA 3IVFA 3NZ3A 1GB1A 1GAQB 3ZUNA 2DNFA 3ZLZA 4XWWA 3EHVA 4L23A 2G45B 5JH5C 3SU8X 1E7VA 2GRIA 2XN9C 1XQQA 3Q8AA 3RPFC 2PEAA 1L4DB 2LASA 2IGGA 3RULA 3AEAB 2PTLA 3M3JA 3NG0A 2K25A 2RSUA 2W9NA 2BKRB 3OJ4B 1VD2A 1V1PA 1ROEA 2GBMA 2MW5A 1YN3A 1MFWA 4HRSA 2C60A 3JYUA 2RD0A 2B76B 2WU2B 3ZJUA 4JGHB 4N58A 3VRBB 2Z0EB 5E6OA 3AE7B 3P4PB 3RCZA 3CSTA 2M1MA 4MDKE 2C7HA 2INNE 2PE6B 3ZGZA 3UGBB 4RF1A 1M4VA 4BBNC 3NHEB 1RAXA 2BKFA 3AEDB 2N1WA 2J42A 3NOBA 3R7QA 2G3QB 3U30A 3NZSA 4MM3B 3W9CB 3Q3JA 1S3SG 3AE5B 1DOYA 3RYTA 3ZXVA 2XK5B 3KWVA 1WR6E 1V49A 4AUQC 4FJVB 2MBHA 4F7ZA 4C56C 3NVVA 3N30A 4IWPA 4GXBA 4GDKB 1GG3A 2D3CA 2KKCA 4MJSB 2L00B 3HIZA 1FO4A 1MI0A 1WYGA 3KUZA 1MPEA 3L4PA 2NTTA 1ZXIA 3EC8A 3ZDTA 2RMMA 2JRHA 3APFA 3Q3OC 2LGSA 2K8HA 4J3OD 3KW5B 2C7MB 1LQBA 2MP2A 4C80A 2N7EA 4FULA 2W54A 4M01A 1YQ4B 1GUAB 3AULA 2YEPF 3L0WB 2MBQA 3AM9A 4A9AA 2LI5A 2LJ5A 3MHSD 1PFDA 4ZRPA 4P7IA 3Q14C 5EE0A 4N6EB 2AL3A 4HPPA 4B0MA 2AYOB 4WWNA 5LXIB 1VZ6A 4LJPB 2L32A 2PLPA 4EE2A 4AQ7A 5KHQA 3A4RA 3H7PA 3GS2A 4IUMB 2CS4A 4B95A 4USAA 3I63C 1LFDA 3RFZB 2W3RA 1OGWA 4W9KA 1JWAD 1E9MA 3QA8A 3U7ZA 2HTHA 1WGHA 2EMTA 3VFKA 3DBRB 5J2RA 1JWUD 1WYWB 4K7UA 3CF6E 3HVDA 5C23A 1MHXA 3KYDD 4K3BA 2AL6A 3DHHC 3R2TA 3Q2AC 1VR9A 2HJ1A 3ECIA 3U8ZA 3VUXA 1QILA 1WGYA 1YQ3B 3VHTC 4YL8A 2K22A 3PZ7A 3QARA 2LHEA 2KVRA 5BMHA 2I1KA 1ACCA 3ZKJC 4ZRKA 1NYQA 3IAS1 5IAAC 3SR6A 2NR2A 1EU4A 3BVMA 3PV1A 1U4AA 1ZKHA 3VDZA 1HTQA 2MRPA 4LNOA 3BZDB 2DZMA 3IT6B 1JQ4A 2NTSA 1RRBA 3B08A 2N9EB 1KF6B 4YTMB 5LXHA 3T3NA 3P42A 4G3XB 2KDIA 3AEGB 4ZHPA 3MHZA 2WHIA 1SB3C 2M19A 2DENB 1BUIC 1TKYA 2LUMA 4IM0A 2GBKA 4ASWC 3KUCB 2FCSA 4B9KA 1UH6A 2KTFA 3UQBA 3PGEA 1NENB 4FXCA 2MQJA 4DDID 1V1PB 1Q10A 4HDQA 1NDDA 3ZQ4A 3MJWA 2LGDA 5JHBA 3ENEA 2J0JA 2YVCA 2M56B 3UINB 1Y56A 2DYOA 2TSSA 5BYQA 2QCZA 2ONQA 1FNWA 3AV8A 2LRWA 5L95C 2JWZA 2L76A 2KJHB 4A8XC 3KLSX 2LD9A 2BGFA 3ML9A 4NNJB 1DOXA 4F1SA 2PKOA 2RDBC 4HXDA 2INPE 3O65B 2KMMA 2KTRB 1A5RA 2HDEA 1K53A 1YQBA 1ZE3D 3V62A 1WM3A 1UGMA 2QJLA 4CO7A 2O6VD 1HXYD 4IWOA 2G4DB 3DBHI 4LDTD 3LXFA 3L13A 3IHPC 3VTWA 1TTNA 3DWMA 2PVGC 3DVNV 4W9CA 3DBLI 4BKTA 1NEKB 1FCCC 1V80A 1AYFA 1EWCA 1WRDB 5AZHA 2IGHA 2WGSA 3N1XC 4GOCA 1OEYA 3MTNB 2MX2A 4FHKA 4IOIE 4C7YA 1CK1A 3SDLC 2LVPA 2IDYA 1F9JA 4FADA 2FCNA 2YLMA 1E5WA 1H8CA 3B0AA 2MBBB 1YD8U 2BYEA 1P0RA 2DX5B 2WXNA 4YSZB 3IFWB 2BQQA 1WJ6A 2D3AA 2KN4A 3BYYB 2IJ0A 1WXVA 3VR8B 4XE0A 3DVGX 2K39A 2X8XX 1M94A 2ZZPB 1WX9A 5D3DA 4G50A 4KV2A 2L8JA 2Y5BB 1V81A 3N1ZC 1E10A 5GXGB 2QMTA 1WIAA 2BYVE 1I7HA 4BOSC 3VH4B 3H6NA 3DBSA 1T5XD 1SE2A 1UNSA
chains in the Genus database with same CATH topology
2AX5A 5FK9C 1SEBD 2JZPA 1ENFA 1F2RI 3TEYA 4YXDB 5EE9A 3EGRA 4JWSC 4CQNA 3MFGA 2MJEA 3VRAB 4JE3B 1L4ZB 2SEBD 2AQ1B 3NVWA 1QF6A 1ESFA 1FMAD 1UWMA 1MHHE 2KAJA 4MH8A 5EE3A 2L1AA 4LTUA 1PGAA 3P4SB 1XLNA 4OZAA 4WQMA 2J4XA 1ZDXA 2BB5A 4AS1A 1RFKA 1DOIA 2W3SA 2WXGA 2K0PA 3Q69A 2DBYA 4KGTA 1UWXA 1F77A 2V4IB 4RFBA 1FXIA 3P1MA 3W2DA 2ZW0A 5HI1A 2LGIA 3AE9B 3OWEB 2YEPB 3HVZA 1N63A 3IXSA 2PVOD 1ZOYB 3NS1A 4XWTA 1KLGD 4RNAA 1YJIA 2I38A 4WIPA 1VZ7A 2FE8A 1C4AA 2Q5WD 4H2AA 4O1NA 1BXTA 2K5PA 2V0GA 3CWIA 2E3TA 1P7FA 2WXOA 3FAHA 4XDDA 1D5ZC 1F2RC 1ET6A 2CU3A 3I57A 2VZKB 3H8HA 5BMIA 5I4DA 1JALA 3AE8B 4WWMA 1JWBD 1STEA 4RGTA 2K3UA 3MC0B 2L83A 3ZJVA 3NZ3A 1AW7A 4GDLB 1N60A 4TQ0A 4WAFA 1GB1A 1GAQB 4HEA1 2LHDA 4IDIA 4XWWA 1ZUD2 3AEEB 5AUIA 2K9XA 3TEXA 4RGMA 4L23A 2V3PA 3RPFC 2GRIA 2XN9C 3NRZA 3Q8AA 4REZA 4ZOHC 3W5VB 1L4DB 2IGGA 1E6EB 3EUB2 1RM6C 1ZXHA 4WURA 4OVZA 3AEAB 3C8YA 4OHJA 3AB5A 3U2SC 2M0AA 4ARIA 1I4XA 3B9JA 2PTLA 2BTEA 1ZPSA 2CJOA 1R7SA 1WRIA 2MH7A 1VZ8A 4N59A 4ITKA 1JWMD 2FUG1 2WXRA 1OQRA 2RDGA 3HUIA 1K50A 2WXLA 1SJHD 1I4HA 2WQYB 2WXIA 1FNVA 1C4PA 1V1PA 2BW2A 5FKAC 1XXGA 3V05A 3AE1B 2Y5CA 1ROEA 2IGDA 2OEDA 1J7AA 1YN3A 1VJKA 1FD6A 4HRSA 2JXTA 2B76B 2WU2B 2PW9A 3TUOA 4N58A 2EELA 3VRBB 3ZJUA 2MJ3A 3AE7B 1HA5A 3P4PB 1K52A 3NVYA 1QOFA 3AN1A 2INNE 2WXFA 3GP7A 3ZGZA 4RF1A 1CZPA 1M4VA 1P7EA 4KKJA 5MPOA 2OHFA 3AEDB 3FILB 5D7GA 2J42A 2SAKA 3B2FA 3Q8FA 4DXFA 2RDHA 4NZLB 2N0SB 3VQIA 4YT0B 1FFUA 2LFIA 1YN5A 3R8BA 4DXGA 4KGSA 4MM3B 3W9CB 1TKEA 2D5GA 1FRRA 1B1ZA 2WXJA 3AE5B 3W1SA 1DOYA 1WWTA 2CJNA 3IAM1 1AWDA 3KWVA 3VR9B 1L0XB 3UI3A 1QKZA 3AECB 2JYTA 1TS4A 1EWYC 1TY2A 2I2YA 2J52A 3HRDD 2DYMA 5HG2A 4C56C 2WDRB 3NVVA 1PYWD 1N5WA 2RPVA 3AH7A 2FBWB 1XLPA 4GDKB 1TKGA 4LK0M 2JWUA 2J53A 1NI3A 1RYJA 1FO4A 1MI0A 1WYGA 1MPEA 3L4PA 1K51A 2NTTA 1PGXA 1ZXIA 2QSDA 4UDUC 1XCTL 3T3OA 2ON8A 4D2KA 2KQ4X 2RMMA 2E6XA 4J3OD 5C3JB 4ZHOA 1C78A 5D3IB 3AE4B 3AE2B 4C80A 5E6JA 4US8A 1ZDVA 4C7ZA 1D4BA 2W54A 1DYQA 1YQ4B 4A55A 3BWUD 2YEPF 2DLBA 3I9V1 1HZ5A 3AE6B 3BK1A 3BYTB 3NVZA 2DWQA 2BS4B 4RGNA 3AM9A 4A9AA 3KWLA 1SE4A 1PFDA 1YJJA 4ZRPA 1QOBA 4HKQA 1I4RA 4A90A 5G5HA 5EE0A 4N6EB 3Q8EA 1PUTA 1EM7A 1PGBA 4B0MA 4KX6B 4XDCA 1VZ6A 2GB1A 1L0VB 1N62A 2L32A 3MJ5A 2PLPA 4EE2A 4AQ7A 1TZOA 1UUPA 1I4PA 1UGJA 2Z8LA 2G9HD 2KWDA 4RF0A 1E0ZA 1KRHA 4YTPB 1J7CA 2KDMA 3GS2A 1IBXA 1PDXA 3WCQA 1YMHE 4USAA 2AQ2B 2LEKA 5AUKA 3U52E 4YSYB 3BIID 3MP9A 3RFZB 1IGCA 3V3XA 2W3RA 1F0ZA 2JSVX 3GB1A 3PZ8A 1JWAD 1VRAB 2MEKA 2WXHA 1E9MA 1DGJA 2BS3B 5BYRA 1QOGA 3U7ZA 1TS5A 2X38A 2WNMA 2AQ3B 3ETRA 3J9CA 1JWUD 1T6BX 1C4CA 1BMLC 1SIJA 4WH4A 3BVGA 3AMZA 3LYYA 3HVDA 3SFDB 2WLBA 1MHXA 5BYSA 2WS3B 3AE3B 2ACZB 3TEWA 1T3QA 5C2TB 1C77A 3R2TA 1VR9A 4L2YA 5H8YE 4P6VF 1QILA 1YQ3B 2G1EA 2JYEA 4RCOA 1J7BA 2K22A 3PZ7A 4KGRA 2LHEA 3Q8BA 2QILA 5BMHA 1L5PA 1ACCA 1NYQA 4ARCA 3B2GA 3IAS1 3SR6A 3NUHB 3ZYYX 4OW0A 1C9FA 4NAWB 1EU4A 2BS2B 3BVMA 1SXTA 4OZCA 3EA6A 1KTKA 2IPKD 4IKGA 3BZDB 1IGDA 2H89B 3IT6B 1JQ4A 2NTSA 2N9KA 2W55A 3AEBB 1KFYB 4YTNB 1KLUD 1KF6B 4L1BA 4YTMB 3T3NA 3P42A 4NAMA 4JWUC 3P4QB 3DWGC 1WXQA 1WSPA 3AEGB 4ZHPA 2BB6A 1XO3A 1VDVA 3MHZA 3ZJTA 2WXKA 1SB3C 2M19A 2R61A 2JX5A 1FEHA 2XNAC 1BUIC 1I4GA 1TKYA 4LLGM 5T8IA 2LUMA 4MACA 1IBXB 1FXAA 1ZP0B 2KACA 1E7PB 1TS2A 3R2IA 1CJEA 2LJIA 3BVZA 4A6QA 1XCQL 2ICIA 4TSSA 5H92C 2V3NA 2QIEB 2NMQA 1NENB 3FC4A 5EE1A 1IUEA 1N5XA 2VZKD 1VLBA 4FXCA 1V8CA 1Q10A 1V1PB 2WXQA 4MT5A 3ZQ4A 2WDVB 2BYTA 3URYA 1YNTE 1C76A 2M56B 2W82A 1Y56A 1QLBB 2DYOA 3SEBA 2Y3AA 4ZRQA 5BMGA 2TSSA 5BYQA 1I4QA 3O13A 3KQ4A 2N7JA 4JX1C 2ONQA 1FFVA 1FNWA 3AV8A 4KKIA 2EKIA 1HEZE 1QQRA 3FILA 4HKZE 3BK2A 1WGKA 1FM0D 3U4EG 1TYGB 1NYRA 4A8XC 1TY0A 2WXPA 3KLSX 1V1OA 1DOXA 3TSSA 4YSXB 1D5XC 1LO5D 2PKOA 2INPE 2QEJC 2PMVA 2KMMA 2MJDA 3E56A 5HHDG 2HDEA 1K53A 1ZE3D 2WDQB 1GPXA 1QT9A 1JW9D 2QJLA 2N9LA 2BBCA 1JMLA 2PIAA 1V97A 1HXYD 1QOAA 3LXFA 1SJED 2H88B 2WP9B 3DWMA 1XLOA 3SFEB 1XEEA 2WXMA 2PVGC 5FR3A 4TQ1A 1XF5L 1SE3A 1L6VA 2LMCA 1NEKB 1YN4A 1KH0A 1FCLA 1SF0A 1ET9A 1FNUA 1FCCC 1AYFA 1EWCA 1L0YB 2IGHA 4GLSC 3P4RB 1JROA 4HROA 1HQRD 1OQQA 5G5GA 1D5MC 1FRDA 3E9SA 4US9A 4NJCA 4HJGE 4OZBA 4B0EA 2HTME 1CQVA 4IOIE 1OFFA 3LB8C 4C7YA 1B9RA 3ABVB 1CK1A 4R3DA 1AN8A 5HFYA 1GB4A 1GOZA 2IDYA 2JQRB 2JU6X 2Y5PA 1A70A 2L52A 5TSSA 1D6EC 3P63A 2ZW1A 1MVKA 2BT6A 3N9YC 2WXNA 3CIRB 4YSZB 1SSNA 4M0WA 1TS3A 4YWGG 3AEFB 3PO0A 1EU3A 4JPSA 4TMAB 2KN4A 3BYYB 4Q2JA 2IJ0A 3IT4B 4RH6A 1JCKB 3VR8B 4XE0A 1XLQA 3Q8CA 4ZYSA 3W5UB 5D3DA 2GI9A 1HZ6A 4P16A 1E10A 1RWSA 5GXGB 1C79A 1JWSD 1L6UA 2QMTA 5LNK1 1I7HA 3TEZA 1N61A 1NVID 1TJEA 2WU5B 4RGOS 4DQOC 1SBBB 5JXVA 1JRPA 1FIQA 1T5XD 1SE2A 4PT5A 1UNSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YMH E;  2N7J A;  2ONQ A;  2JZP A;  1F2R I;  1HEZ E;  3FIL A;  1P7E A;  4HKZ E;  3MP9 A;  1IGC A;  3V3X A;  2JSV X;  3GB1 A;  3FIL B;  1MHH E;  4KGS A;  1PGA A;  4WH4 A;  4OZA A;  5HHD G;  1K53 A;  2K0P A;  1MHX A;  2N9L A;  4KGT A;  1UWX A;  1JML A;  3UI3 A;  1QKZ A;  2ZW0 A;  5HI1 A;  2LGI A;  2I2Y A;  2J52 A;  5HG2 A;  2RPV A;  4KGR A;  2LHE A;  5BMH A;  2I38 A;  1XF5 L;  2JWU A;  2J53 A;  1MI0 A;  1KH0 A;  1FCL A;  1FCC C;  1MPE A;  1K51 A;  1P7F A;  1PGX A;  2QSD A;  1C9F A;  1XCT L;  2IGH A;  1F2R C;  4GLS C;  2ON8 A;  4D2K A;  5BMI A;  2KQ4 X;  2RMM A;  4OZC A;  4IKG A;  4HJG E;  1IGD A;  4OZB A;  4IOI E;  1GB1 A;  2N9K A;  2LHD A;  5HFY A;  1D4B A;  1GB4 A;  2JU6 X;  1HZ5 A;  2ZW1 A;  1MVK A;  2IGG A;  1ZXH A;  2LUM A;  4MAC A;  2PTL A;  1IBX B;  1EM7 A;  2KN4 A;  2KAC A;  1PGB A;  1XCQ L;  1K50 A;  2GB1 A;  2NMQ A;  2GI9 A;  1HZ6 A;  2PLP A;  2IGD A;  2OED A;  1Q10 A;  2QMT A;  1FD6 A;  2KWD A;  2JXT A;  2PW9 A;  2EEL A;  1YNT E;  2KDM A;  5JXV A;  1IBX A;  5BMG A;  1K52 A; 
#chains in the Genus database with same CATH topology
 3H7P B;  2KFJ A;  1I42 A;  1SEB D;  2GOW A;  4MGY E;  2JZP A;  3ZRC A;  1F2R I;  2QDF A;  3ONS A;  2KDF B;  3BIN A;  3K9P B;  2SEB D;  3NVW A;  1QF6 A;  4MH8 A;  5EE3 A;  4E74 A;  4MEM A;  1PGA A;  5FR6 A;  4WQM A;  4CHK A;  4DHJ B;  4DDG D;  4C4V B;  2INC C;  3AE9 B;  1WXA A;  4MEL A;  1N63 A;  2PVO D;  3NS1 A;  4XWT A;  1KLG D;  4K81 A;  1YJI A;  1BT0 A;  2HE7 A;  2I38 A;  4HPM B;  4WIP A;  3DPD A;  1E7U A;  2FE8 A;  2DZJ A;  4W9J A;  1E8Y A;  4JIO U;  1WGG A;  2Q5W D;  4O1N A;  2K5P A;  2XK5 A;  1WFY A;  2E3T A;  4ANW A;  3RNE C;  4FHJ A;  2EMS A;  1JAL A;  3AE8 B;  3UIP B;  4RGT A;  2N9P C;  1OQY A;  4W9G A;  2KLG A;  2D2Q A;  4IDI A;  1ZUD 2;  4GDK A;  4RGM A;  2V3P A;  3AU5 A;  4W9D A;  3L16 A;  1RFA A;  2JT4 B;  2MCN B;  1E6E B;  3U7D A;  3U2S C;  2M0A A;  1V9J A;  2M8S A;  2CJO A;  2ASQ A;  2D11 A;  3H1U A;  2RDG A;  3CMM B;  3HUI A;  3HK0 A;  1FNV A;  1XXG A;  3V05 A;  2Y5C A;  3A9J A;  1VJK A;  3B1L X;  3VUW A;  2JXT A;  1KJT A;  3AI5 A;  3PVL A;  2PW9 A;  2EEL A;  4P1C C;  1SGH A;  3C19 A;  5CHV C;  2IZV B;  2WXF A;  1CZP A;  2FCM A;  4EUT A;  2JRI B;  3Q3F A;  3B2F A;  3Q8F A;  4DXF A;  2LWP A;  1YN5 A;  4KGS A;  1TKE A;  2D5G A;  3UIO B;  1FRR A;  2WXJ A;  4MGI E;  1WWT A;  2CJN A;  3VR9 B;  4W9H A;  1L0X B;  1Z2M A;  1QKZ A;  5HKH A;  5G55 A;  2I2Y A;  2J52 A;  3HRD D;  1PYW D;  2ZNV B;  3JVZ X;  2FBW B;  2JWU A;  2J53 A;  3TMP B;  4NQL B;  3N20 C;  4BVU C;  3VH3 B;  2RPQ A;  1PGX A;  3T3O A;  1PQS A;  3AU4 A;  2JVC A;  2HD5 B;  1C78 A;  2D3B A;  5D3I B;  2UU7 A;  4A55 A;  3QHT A;  2LXC A;  3AE6 B;  3BK1 A;  3BYT B;  2BS4 B;  4RGN A;  4JQW C;  4AP4 C;  1RLF A;  4HKQ A;  4A90 A;  1PUT A;  1EM7 A;  1UBI A;  4LNF A;  4KX6 B;  3KUD B;  4HCP B;  4ZYN A;  4XDC A;  2LRU A;  3OJ3 A;  3MJ5 A;  2BVC A;  2RR9 A;  3ZXR A;  2FIF A;  3A4S C;  2KJR A;  3NJT A;  4W9F A;  3RUI B;  3M95 A;  1E0Z A;  4YTP B;  2KDM A;  2K8C A;  2AQ2 B;  3K9O B;  4DBG A;  5AUK A;  3BII D;  1IGC A;  1TIF A;  1EUV B;  3PZ8 A;  2WXH A;  1DGJ A;  1TS5 A;  2X38 A;  4FJY A;  2WNM A;  3X0W A;  4IM2 A;  1T6B X;  2JY6 A;  1C4C A;  1SIJ A;  2QHO A;  4WH4 A;  4M8M A;  2LVQ A;  3WAL A;  2WLB A;  5BYS A;  3AE3 B;  2ACZ B;  2N7D A;  1T3Q A;  4S17 A;  5C2T B;  1C77 A;  4L2Y A;  4HJK A;  2G1E A;  4EZJ A;  1E8Z A;  5IKC M;  2QIL A;  4I6N B;  2KTR A;  5IP4 D;  2PPH A;  4WJP A;  4IG7 B;  4BOZ B;  3NUH B;  4NAW B;  2BS2 B;  2KDE B;  2NCN A;  4OZC A;  2I1J A;  2ZEQ A;  1KTK A;  2IPK D;  1Q0W B;  4IKG A;  1IGD A;  1UEL A;  2H89 B;  3FKY A;  5D94 A;  4XX5 A;  3PHX B;  4BKS D;  1KFY B;  4YTN B;  2LUE A;  4NAM A;  2V3S A;  3P4Q B;  3DWG C;  1WXQ A;  3DBR I;  2XNA C;  4LLG M;  2NVU I;  5T8I A;  3QC8 B;  2IYD B;  4PS7 A;  3X23 A;  1ZP0 B;  2J7Q B;  2KAC A;  5J18 A;  3BVZ A;  4A6Q A;  4TSS A;  2V3N A;  1WH3 A;  3FC4 A;  5EE1 A;  3N1Y C;  3OLM D;  2D10 A;  3A9J B;  4JL9 A;  1C76 A;  1QLB B;  3SEB A;  3JSV B;  1MG8 A;  2EKI A;  1HEZ E;  4HKZ E;  3UQA A;  1FM0 D;  2WXP A;  2K6Q A;  1VCB A;  4PS3 A;  3LJ3 A;  2QEJ C;  2PMV A;  3LDZ E;  2CHZ A;  3RNF C;  4OVV A;  2NPT B;  5HHD G;  3E56 A;  1MJD A;  2BF8 B;  2ZCB A;  1TBE A;  2V4L A;  2BBC A;  1V97 A;  3PTF C;  1QOA A;  3WIM A;  4AWJ A;  4NPN A;  2BYF A;  2AWT A;  2RGF A;  1WR1 A;  4TQ1 A;  1XF5 L;  1L6V A;  4B6W A;  1SF0 A;  1ET9 A;  1FNU A;  4FJZ A;  1L0Y B;  1JRO A;  2KC1 A;  2KMA A;  4C4V A;  4A3P A;  3ZIM A;  1P3Q U;  4B0E A;  4EZL A;  1P1A A;  2HTM E;  3ABV B;  4KVG B;  1GB4 A;  2JU6 X;  1A70 A;  2L52 A;  1E8W A;  5E6N A;  4NY0 A;  4LDT B;  1WXM A;  5CHW A;  3ZNG C;  4I6L B;  1Z5S B;  1MVK A;  3ZO5 B;  1GC6 A;  4HPL B;  2VRR B;  4X57 B;  4YWG G;  3PO0 A;  4KDL B;  4DWF A;  4HLE A;  4GN1 A;  2K8B A;  4RH6 A;  1UZX B;  4TKN A;  4ZYS A;  2QC8 A;  3PLU A;  3W5U B;  4DHZ E;  4NJ7 A;  4P16 A;  1OTR B;  1C79 A;  1JWS D;  4XGA B;  1NVI D;  1R4M I;  1TJE A;  2WU5 B;  3L10 B;  3OG5 A;  4EOY A;  2KT7 A;  2K1F A;  4FLH A;  5JXV A;  2KX0 A;  2KX3 A;  1T0R C;  5J17 A;  3QCA A;  1EF5 A;  3GZN I;  1ENF A;  4NJ6 A;  3TEY A;  3A9K A;  4YXD B;  5EE9 A;  1WX8 A;  3EGR A;  2LXA A;  5BO4 B;  3MFG A;  2MJE A;  3APD A;  4JE3 B;  1EO6 A;  2FNJ B;  5GMV A;  3W1Y A;  1ESF A;  1FMA D;  2GBJ A;  1MHH E;  2KAJ A;  1NBF C;  3H9D A;  4EZK A;  4LTU A;  2IO1 B;  4K7W A;  4WWP A;  3DVN U;  1ZDX A;  2BB5 A;  3L54 A;  1RFK A;  2KWC A;  2KWU B;  3W1S C;  2K6D B;  1F77 A;  3W2D A;  2ZW0 A;  5HI1 A;  2A4Z A;  2UWQ A;  3OWE B;  3GOE A;  2KOX A;  4WQO B;  2OJR A;  5IA7 A;  4MH0 E;  2KHW B;  1C4A A;  2A5U A;  1BXT A;  2V0G A;  1P7F A;  2WXO A;  1LXD A;  3WAN A;  4ANU A;  1F2R C;  2DZK A;  2VZK B;  5BMI A;  5I4D A;  1QZE A;  5D6J B;  4WWM A;  3RNC C;  2L83 A;  2KXJ A;  3ZJV A;  1AW7 A;  4TQ0 A;  1N60 A;  2LGY A;  4WAF A;  1YIW A;  1CMX B;  2LHD A;  2MHJ A;  3AEE B;  3KH0 A;  2K9X A;  3TEX A;  1R4M B;  2MBO A;  2V9H A;  4ANV A;  3NRZ A;  3I3T B;  4WUR A;  1ZXH A;  3C8Y A;  3AB5 A;  3VVW B;  3GZN B;  3RNA C;  1ZPS A;  2MH7 A;  1R7S A;  1VZ8 A;  4ITK A;  2FUG 1;  3WAO A;  1V5O A;  1I35 A;  1L7Y A;  1OQR A;  2ZCC A;  1SJH D;  1I4H A;  2WQY B;  2D3G A;  2WXI A;  2BW2 A;  2IGD A;  1J7A A;  2DAF A;  3VAW A;  4FBJ B;  3TUO A;  4ZRI A;  3NVY A;  3AN1 A;  2CR5 A;  1Y8R C;  3GP7 A;  2JUO A;  4KKJ A;  2WX0 A;  5MPO A;  3P2B A;  5D7G A;  1R4N B;  2SAK A;  2C7N B;  3OAW A;  2N0S B;  3VQI A;  4YT0 B;  1FFU A;  3HM6 X;  4A3O A;  3V6E B;  1B1Z A;  2VH1 A;  3KVF B;  1ISN A;  3IAM 1;  4GIV A;  2D07 B;  3DOW A;  3UI3 A;  1TS4 A;  1WM2 A;  1EWY C;  1TY2 A;  2NS5 A;  5DPT A;  3MC9 A;  2DYM A;  2WDR B;  2RPV A;  4BZA A;  4BBN F;  1XLP A;  4GMV A;  2L05 A;  4RM9 A;  1NI3 A;  5IN7 A;  3NS8 A;  2MLB A;  5EDS A;  1K51 A;  4UDU C;  3NZU A;  2Z59 B;  2KQ4 X;  3QJZ A;  2CU1 A;  2C9W B;  3AE4 B;  2KN5 A;  3AE2 B;  5E6J A;  3WA0 A;  4US8 A;  4C7Z A;  4MSQ B;  3BWU D;  2DLB A;  1HZ5 A;  2DWQ A;  5IOI A;  3KWL A;  3RN9 C;  4NAW A;  1YJJ A;  5L83 A;  3QQ8 B;  5G5H A;  4N9F 4;  4M00 A;  2PE9 A;  4G0N B;  3VTV A;  1IP9 A;  4EKU A;  3PHW B;  5CTR C;  1UUP A;  5IO9 A;  1UGJ A;  2ZPY A;  3PRM B;  3ZVV A;  2Z8L A;  1WGD A;  4RF0 A;  4WAA A;  3TIX A;  1J7C A;  1PDX A;  4P1B C;  4IC7 B;  3WCQ A;  3R3M A;  1YMH E;  4II2 B;  3VXW A;  1T0Y A;  3QK0 A;  3U52 E;  4YSY B;  3MP9 A;  1F0Z A;  3V3X A;  2JSV X;  3A9K B;  1VRA B;  2MEK A;  5BYR A;  2BS3 B;  1QOG A;  1FXT B;  3CSF A;  2IY1 B;  3ETR A;  3TCA A;  4S0R A;  1BML C;  3BVG A;  3RZF A;  3JSV A;  3LYY A;  3SFD B;  3ML8 A;  3TEW A;  3L08 A;  4WJO A;  3ZTD A;  5H8Y E;  1L2N A;  2N4F A;  2JYE A;  4FN2 A;  2KQ7 A;  4XYC A;  1J7B A;  4RMA A;  4F8C B;  2NPT A;  4KDI C;  4ARC A;  3B2G A;  4OW0 A;  1C9F A;  1SE9 A;  2L7R A;  3JW0 X;  5JZE B;  1XT9 B;  2CHX A;  3WAM A;  3RNB C;  2KWV B;  1J8C A;  2W55 A;  3V6C B;  3C0R B;  3RMK C;  2BB6 A;  1XO3 A;  1VDV A;  4LNI A;  2JX5 A;  1I4G A;  2VH2 A;  4KSK C;  3DQV A;  1IBX B;  1FXA A;  2CKH B;  3IBE A;  1XCQ L;  1WMH A;  2ICI A;  2DAJ A;  3M63 B;  5H92 C;  2C5L C;  2QIE B;  3VTU A;  2O6V A;  1N5X A;  1V8C A;  4MT5 A;  5CX3 A;  2WDV B;  2FUH B;  3URY A;  1YNT E;  2W82 A;  2Y3A A;  1I4Q A;  3O13 A;  1KM7 A;  3NY5 A;  1QQR A;  3FIL A;  2IO2 B;  3BK2 A;  1WGK A;  2KC2 A;  2KFK B;  1V1O A;  1P98 A;  3TSS A;  2DZI A;  1D5X C;  2ZJD A;  3PRZ A;  1TT5 B;  2N9X A;  2G4S A;  2MJD A;  2WDQ B;  1GPX A;  3EEC A;  1JW9 D;  4K3C A;  2N9L A;  2L0T A;  5D2M B;  2H88 B;  2IO0 B;  1T0S C;  2WP9 B;  1XLO A;  3SFE B;  3IG3 A;  5FR3 A;  2L3Z A;  3S2A A;  2LMC A;  5LLI A;  4HRO A;  1S1Q B;  3SD5 A;  1D5M C;  1YX5 B;  2KK8 A;  2Z0D B;  4NJC A;  4OZB A;  2N1V A;  1CQV A;  1OFF A;  2NBU A;  2NBW B;  1T0Q C;  4NQK E;  1AN8 A;  1GOZ A;  2Y5P A;  2JQR B;  1V6E A;  2R2O A;  4IM3 A;  3DHG C;  3CIR B;  2CHW A;  1WJ4 A;  1SSN A;  4M0W A;  3AEF B;  4HVB A;  1EU3 A;  4JPS A;  4ZDV A;  1GJZ A;  2IND C;  1N6Z A;  1ZGU B;  1UF0 A;  3N3K B;  4J6I A;  4ACF A;  4Q2J A;  2XBB C;  1JCK B;  4PK1 A;  4XC2 A;  2L0F A;  3DCG A;  3T9L A;  4TV3 A;  4GGQ A;  1HZ6 A;  3UF8 A;  4QAY A;  5LNK 1;  4DQO C;  1SBB B;  2JZZ A;  1FIQ A;  2KMC A;  2M0X A;  1WJN A;  5FK9 C;  2MWS B;  3A1Q A;  5AZG A;  3M62 B;  3Q3M C;  2JF5 A;  2JXX A;  2REX A;  3SHQ A;  4JWS C;  3EFC A;  1E8X A;  1OEY J;  4C00 A;  3VRA B;  1L4Z B;  3MC8 A;  3PLV A;  4IW0 A;  2PJH A;  4A20 A;  4HCN B;  1V5T A;  2GMI C;  4BFR A;  2L1A A;  2KYW A;  3P4S B;  3V60 A;  1P9D U;  1WZ0 A;  2K0P A;  3Q69 A;  3DDC B;  5AEK B;  1F1H A;  1V86 A;  1YOV B;  4RFB A;  1FXI A;  3P1M A;  4I6P A;  2ZPN A;  5KHO A;  4EEW A;  3HVZ A;  3PZD A;  3TJP A;  1ZOY B;  4RNA A;  5AZF A;  3APC A;  4PYZ A;  1WY8 A;  5JHA A;  3CWI A;  1V2Y A;  1ET6 A;  2CU3 A;  4LCD E;  2AEH A;  1STE A;  3ZTC A;  4GDL B;  1EF1 A;  4HEA 1;  1TGZ B;  1KLV A;  5AUI A;  3QAQ A;  2WX1 A;  4REZ A;  3W5V B;  5DPR A;  4ZOH C;  5CHF A;  1MG4 A;  3EUB 2;  1RM6 C;  1WF9 A;  1WE6 A;  4OVZ A;  4OHJ A;  4ARI A;  1I4X A;  4LJO B;  3WAP A;  3B9J A;  2BTE A;  4N59 A;  1WRI A;  3PS6 A;  1JWM D;  4HDO A;  2WXR A;  2ZVN A;  2OJW A;  1K50 A;  2WXL A;  4ICU A;  1WMH B;  1C4P A;  5FKA C;  3AE1 B;  2OED A;  2O6V B;  2BWE S;  1FD6 A;  1NI2 A;  2MJ3 A;  1WZ3 A;  1HA5 A;  1K52 A;  1QOF A;  4AJW A;  1LM8 B;  3DVG Y;  1P7E A;  4DHZ B;  1X1M A;  2OHF A;  4MSM B;  3FIL B;  2RDH A;  4NZL B;  2LFI A;  4DXG A;  3R8B A;  3ZNZ B;  3RNG C;  1LGR A;  1Q1O A;  4BAX A;  1WE7 A;  4KIK B;  3W1S A;  1AWD A;  4AOF A;  1GNU A;  4PYU A;  2O2V B;  2FID A;  3AEC B;  2JYT A;  2GBR A;  5HG2 A;  1N5W A;  3AH7 A;  2IO3 B;  2WWZ A;  3TBL D;  1TKG A;  1Q5W B;  4LK0 M;  3H7S A;  1RYJ A;  2M4N A;  4CYE A;  2QSD A;  4LNN A;  1XCT L;  3ZNI D;  1YX6 B;  2ON8 A;  4D2K A;  2E6X A;  1HTO A;  5C3J B;  4ZHO A;  3ALB A;  1HE8 A;  1ZDV A;  1D4B A;  1C3T A;  1DYQ A;  3GE3 C;  1R4N I;  3I9V 1;  3NVZ A;  3PRP B;  2FCQ A;  2ZVO A;  2LGX A;  1WXS A;  3BY4 B;  1SE4 A;  3VUY A;  1QOB A;  2R2Q A;  1I4R A;  2M17 A;  4WWO A;  1C1Y B;  4M0W B;  3Q8E A;  2DYB A;  3D32 A;  1PGB A;  1K8R B;  4ICV A;  2DHZ A;  2GB1 A;  4TUU A;  1L0V B;  1N62 A;  2KJ6 A;  4GB9 A;  1TZO A;  1I4P A;  2G9H D;  1SIF A;  2KWD A;  2V1Y A;  1KRH A;  4MGZ E;  4KZ0 A;  1IBX A;  2B3A A;  2KVZ A;  1KOT A;  4KSL C;  3PPA A;  2LEK A;  5TR5 A;  3A1Q B;  4JLC A;  3I5J C;  3ZW3 A;  3GB1 A;  3EFU A;  2KDB A;  2AQ3 B;  1ZW7 A;  3N32 A;  2J0K A;  3R66 C;  3J9C A;  4LNK A;  3QWZ B;  4BKS A;  5DPS A;  2IY0 B;  3AMZ A;  3RZW C;  2WS3 B;  2KFK A;  4P6V F;  2JPH A;  2MP2 B;  2ZNV C;  4RCO A;  4KGR A;  3Q8B A;  3GE8 C;  1L5P A;  4M8N A;  4HK2 A;  3ZYY X;  3L17 A;  4URK A;  1SXT A;  1UD7 A;  3ZNH B;  3EA6 A;  2KAN A;  4GU2 A;  3PSE B;  1G6J A;  4IWQ A;  4G11 A;  4WJQ A;  2N9K A;  3AEB B;  1KLU D;  4AJY B;  2KQS A;  4L1B A;  4EFO A;  3T8M A;  4JWU C;  1FPY A;  3Q3N C;  1D3Z A;  1WSP A;  1TZ1 A;  4ANX A;  3ZJT A;  2WXK A;  2R61 A;  1FEH A;  4KZC A;  3DBH B;  4MAC A;  2KNB A;  1WI0 A;  2KD0 A;  1E7P B;  1TS2 A;  3RI7 C;  3R2I A;  1CJE A;  2LJI A;  1J0G A;  2NMQ A;  3DBL B;  5C1Z A;  1IUE A;  2VZK D;  1VLB A;  1H4R A;  2WXQ A;  4E3C A;  3AXC A;  2BYT A;  3A33 B;  4ZRQ A;  5BMG A;  3KQ4 A;  2N7J A;  4JX1 C;  2XEW A;  1FFV A;  4KKI A;  3HM3 A;  5G2N A;  1XD3 B;  3U4E G;  1TYG B;  1NYR A;  5E6P A;  1AAR A;  1TY0 A;  4MM3 A;  4YSX B;  1LO5 D;  4FA6 A;  1WJU A;  3PT2 B;  1F52 A;  2BWF A;  1QT9 A;  1JML A;  2PIA A;  2KO3 A;  1SJE D;  4W9I A;  3QIJ A;  1XEE A;  2WXM A;  4MJS A;  3RT3 B;  3ZRF A;  4ZRJ A;  1SE3 A;  1E90 A;  2GBN A;  1YN4 A;  1KH0 A;  1FCL A;  3PRE A;  4DK5 A;  4GLS C;  3P4R B;  4GSW A;  3V61 A;  1HQR D;  1OQQ A;  4HWI B;  5G5G A;  1FRD A;  1WGR A;  4W9L A;  3E9S A;  2IBI B;  4US9 A;  4HJG E;  2MA9 B;  3LB8 C;  1B9R A;  4R3D A;  3HHM A;  5HFY A;  5TSS A;  1D6E C;  3P63 A;  2ZW1 A;  2OOB B;  2BT6 A;  3N9Y C;  2J0M A;  1YJ1 A;  1TS3 A;  1IYF A;  2WYQ A;  3TL5 A;  2JZ3 B;  4TMA B;  4E71 A;  1UBQ A;  4GDL A;  3IT4 B;  2MSE D;  4K1R B;  1XLQ A;  3Q8C A;  4PS8 A;  2GI9 A;  4DHJ D;  1RWS A;  1L6U A;  4M02 A;  3TEZ A;  4BKG A;  1N61 A;  4RGO S;  4WJN A;  1JRP A;  4OVU A;  3QX1 A;  4PT5 A;  2AX5 A;  3Q6B A;  5DCN A;  4CQN A;  4DXA B;  2AQ1 B;  1UWM A;  4K7S A;  1JRU A;  1WX7 A;  3KYC D;  2MBE A;  3R7R A;  2KZR A;  1XLN A;  4OZA A;  4W9E A;  2EKE C;  2J4X A;  2FAZ A;  2LZ6 A;  4AS1 A;  1DOI A;  2NBV B;  2W3S A;  2WXG A;  1J19 A;  2UYZ B;  2DBY A;  4KGT A;  1UWX A;  2BPS A;  2KLC A;  2V4I B;  3DHI C;  2LVO A;  2LGI A;  2YEP B;  3IXS A;  2HJ8 A;  1VZ7 A;  4KIK A;  4II3 B;  2WDT B;  4H2A A;  5DPW A;  3FAH A;  4XDD A;  1D5Z C;  2O2V A;  3I57 A;  1GC7 A;  3RD2 A;  3H8H A;  3ZDM C;  4MGK E;  4RM8 A;  4XZ4 A;  1JWB D;  2GLS A;  2K3U A;  3MC0 B;  1IPG A;  3IVF A;  3NZ3 A;  1GB1 A;  1GAQ B;  3ZUN A;  2DNF A;  3ZLZ A;  4XWW A;  3EHV A;  4L23 A;  2G45 B;  5JH5 C;  3SU8 X;  1E7V A;  2GRI A;  2XN9 C;  1XQQ A;  3Q8A A;  3RPF C;  2PEA A;  1L4D B;  2LAS A;  2IGG A;  3RUL A;  3AEA B;  2PTL A;  3M3J A;  3NG0 A;  2K25 A;  2RSU A;  2W9N A;  2BKR B;  3OJ4 B;  1VD2 A;  1V1P A;  1ROE A;  2GBM A;  2MW5 A;  1YN3 A;  1MFW A;  4HRS A;  2C60 A;  3JYU A;  2RD0 A;  2B76 B;  2WU2 B;  3ZJU A;  4JGH B;  4N58 A;  3VRB B;  2Z0E B;  5E6O A;  3AE7 B;  3P4P B;  3RCZ A;  3CST A;  2M1M A;  4MDK E;  2C7H A;  2INN E;  2PE6 B;  3ZGZ A;  3UGB B;  4RF1 A;  1M4V A;  4BBN C;  3NHE B;  1RAX A;  2BKF A;  3AED B;  2N1W A;  2J42 A;  3NOB A;  3R7Q A;  2G3Q B;  3U30 A;  3NZS A;  4MM3 B;  3W9C B;  3Q3J A;  1S3S G;  3AE5 B;  1DOY A;  3RYT A;  3ZXV A;  2XK5 B;  3KWV A;  1WR6 E;  1V49 A;  4AUQ C;  4FJV B;  2MBH A;  4F7Z A;  4C56 C;  3NVV A;  3N30 A;  4IWP A;  4GXB A;  4GDK B;  1GG3 A;  2D3C A;  2KKC A;  4MJS B;  2L00 B;  3HIZ A;  1FO4 A;  1MI0 A;  1WYG A;  3KUZ A;  1MPE A;  3L4P A;  2NTT A;  1ZXI A;  3EC8 A;  3ZDT A;  2RMM A;  2JRH A;  3APF A;  3Q3O C;  2LGS A;  2K8H A;  4J3O D;  3KW5 B;  2C7M B;  1LQB A;  2MP2 A;  4C80 A;  2N7E A;  4FUL A;  2W54 A;  4M01 A;  1YQ4 B;  1GUA B;  3AUL A;  2YEP F;  3L0W B;  2MBQ A;  3AM9 A;  4A9A A;  2LI5 A;  2LJ5 A;  3MHS D;  1PFD A;  4ZRP A;  4P7I A;  3Q14 C;  5EE0 A;  4N6E B;  2AL3 A;  4HPP A;  4B0M A;  2AYO B;  4WWN A;  5LXI B;  1VZ6 A;  4LJP B;  2L32 A;  2PLP A;  4EE2 A;  4AQ7 A;  5KHQ A;  3A4R A;  3H7P A;  3GS2 A;  4IUM B;  2CS4 A;  4B95 A;  4USA A;  3I63 C;  1LFD A;  3RFZ B;  2W3R A;  1OGW A;  4W9K A;  1JWA D;  1E9M A;  3QA8 A;  3U7Z A;  2HTH A;  1WGH A;  2EMT A;  3VFK A;  3DBR B;  5J2R A;  1JWU D;  1WYW B;  4K7U A;  3CF6 E;  3HVD A;  5C23 A;  1MHX A;  3KYD D;  4K3B A;  2AL6 A;  3DHH C;  3R2T A;  3Q2A C;  1VR9 A;  2HJ1 A;  3ECI A;  3U8Z A;  3VUX A;  1QIL A;  1WGY A;  1YQ3 B;  3VHT C;  4YL8 A;  2K22 A;  3PZ7 A;  3QAR A;  2LHE A;  2KVR A;  5BMH A;  2I1K A;  1ACC A;  3ZKJ C;  4ZRK A;  1NYQ A;  3IAS 1;  5IAA C;  3SR6 A;  2NR2 A;  1EU4 A;  3BVM A;  3PV1 A;  1U4A A;  1ZKH A;  3VDZ A;  1HTQ A;  2MRP A;  4LNO A;  3BZD B;  2DZM A;  3IT6 B;  1JQ4 A;  2NTS A;  1RRB A;  3B08 A;  2N9E B;  1KF6 B;  4YTM B;  5LXH A;  3T3N A;  3P42 A;  4G3X B;  2KDI A;  3AEG B;  4ZHP A;  3MHZ A;  2WHI A;  1SB3 C;  2M19 A;  2DEN B;  1BUI C;  1TKY A;  2LUM A;  4IM0 A;  2GBK A;  4ASW C;  3KUC B;  2FCS A;  4B9K A;  1UH6 A;  2KTF A;  3UQB A;  3PGE A;  1NEN B;  4FXC A;  2MQJ A;  4DDI D;  1V1P B;  1Q10 A;  4HDQ A;  1NDD A;  3ZQ4 A;  3MJW A;  2LGD A;  5JHB A;  3ENE A;  2J0J A;  2YVC A;  2M56 B;  3UIN B;  1Y56 A;  2DYO A;  2TSS A;  5BYQ A;  2QCZ A;  2ONQ A;  1FNW A;  3AV8 A;  2LRW A;  5L95 C;  2JWZ A;  2L76 A;  2KJH B;  4A8X C;  3KLS X;  2LD9 A;  2BGF A;  3ML9 A;  4NNJ B;  1DOX A;  4F1S A;  2PKO A;  2RDB C;  4HXD A;  2INP E;  3O65 B;  2KMM A;  2KTR B;  1A5R A;  2HDE A;  1K53 A;  1YQB A;  1ZE3 D;  3V62 A;  1WM3 A;  1UGM A;  2QJL A;  4CO7 A;  2O6V D;  1HXY D;  4IWO A;  2G4D B;  3DBH I;  4LDT D;  3LXF A;  3L13 A;  3IHP C;  3VTW A;  1TTN A;  3DWM A;  2PVG C;  3DVN V;  4W9C A;  3DBL I;  4BKT A;  1NEK B;  1FCC C;  1V80 A;  1AYF A;  1EWC A;  1WRD B;  5AZH A;  2IGH A;  2WGS A;  3N1X C;  4GOC A;  1OEY A;  3MTN B;  2MX2 A;  4FHK A;  4IOI E;  4C7Y A;  1CK1 A;  3SDL C;  2LVP A;  2IDY A;  1F9J A;  4FAD A;  2FCN A;  2YLM A;  1E5W A;  1H8C A;  3B0A A;  2MBB B;  1YD8 U;  2BYE A;  1P0R A;  2DX5 B;  2WXN A;  4YSZ B;  3IFW B;  2BQQ A;  1WJ6 A;  2D3A A;  2KN4 A;  3BYY B;  2IJ0 A;  1WXV A;  3VR8 B;  4XE0 A;  3DVG X;  2K39 A;  2X8X X;  1M94 A;  2ZZP B;  1WX9 A;  5D3D A;  4G50 A;  4KV2 A;  2L8J A;  2Y5B B;  1V81 A;  3N1Z C;  1E10 A;  5GXG B;  2QMT A;  1WIA A;  2BYV E;  1I7H A;  4BOS C;  3VH4 B;  3H6N A;  3DBS A;  1T5X D;  1SE2 A;  1UNS A; 
#chains in the Genus database with same CATH homology
 2AX5 A;  5FK9 C;  1SEB D;  2JZP A;  1ENF A;  1F2R I;  3TEY A;  4YXD B;  5EE9 A;  3EGR A;  4JWS C;  4CQN A;  3MFG A;  2MJE A;  3VRA B;  4JE3 B;  1L4Z B;  2SEB D;  2AQ1 B;  3NVW A;  1QF6 A;  1ESF A;  1FMA D;  1UWM A;  1MHH E;  2KAJ A;  4MH8 A;  5EE3 A;  2L1A A;  4LTU A;  1PGA A;  3P4S B;  1XLN A;  4OZA A;  4WQM A;  2J4X A;  1ZDX A;  2BB5 A;  4AS1 A;  1RFK A;  1DOI A;  2W3S A;  2WXG A;  2K0P A;  3Q69 A;  2DBY A;  4KGT A;  1UWX A;  1F77 A;  2V4I B;  4RFB A;  1FXI A;  3P1M A;  3W2D A;  2ZW0 A;  5HI1 A;  2LGI A;  3AE9 B;  3OWE B;  2YEP B;  3HVZ A;  1N63 A;  3IXS A;  2PVO D;  1ZOY B;  3NS1 A;  4XWT A;  1KLG D;  4RNA A;  1YJI A;  2I38 A;  4WIP A;  1VZ7 A;  2FE8 A;  1C4A A;  2Q5W D;  4H2A A;  4O1N A;  1BXT A;  2K5P A;  2V0G A;  3CWI A;  2E3T A;  1P7F A;  2WXO A;  3FAH A;  4XDD A;  1D5Z C;  1F2R C;  1ET6 A;  2CU3 A;  3I57 A;  2VZK B;  3H8H A;  5BMI A;  5I4D A;  1JAL A;  3AE8 B;  4WWM A;  1JWB D;  1STE A;  4RGT A;  2K3U A;  3MC0 B;  2L83 A;  3ZJV A;  3NZ3 A;  1AW7 A;  4GDL B;  1N60 A;  4TQ0 A;  4WAF A;  1GB1 A;  1GAQ B;  4HEA 1;  2LHD A;  4IDI A;  4XWW A;  1ZUD 2;  3AEE B;  5AUI A;  2K9X A;  3TEX A;  4RGM A;  4L23 A;  2V3P A;  3RPF C;  2GRI A;  2XN9 C;  3NRZ A;  3Q8A A;  4REZ A;  4ZOH C;  3W5V B;  1L4D B;  2IGG A;  1E6E B;  3EUB 2;  1RM6 C;  1ZXH A;  4WUR A;  4OVZ A;  3AEA B;  3C8Y A;  4OHJ A;  3AB5 A;  3U2S C;  2M0A A;  4ARI A;  1I4X A;  3B9J A;  2PTL A;  2BTE A;  1ZPS A;  2CJO A;  1R7S A;  1WRI A;  2MH7 A;  1VZ8 A;  4N59 A;  4ITK A;  1JWM D;  2FUG 1;  2WXR A;  1OQR A;  2RDG A;  3HUI A;  1K50 A;  2WXL A;  1SJH D;  1I4H A;  2WQY B;  2WXI A;  1FNV A;  1C4P A;  1V1P A;  2BW2 A;  5FKA C;  1XXG A;  3V05 A;  3AE1 B;  2Y5C A;  1ROE A;  2IGD A;  2OED A;  1J7A A;  1YN3 A;  1VJK A;  1FD6 A;  4HRS A;  2JXT A;  2B76 B;  2WU2 B;  2PW9 A;  3TUO A;  4N58 A;  2EEL A;  3VRB B;  3ZJU A;  2MJ3 A;  3AE7 B;  1HA5 A;  3P4P B;  1K52 A;  3NVY A;  1QOF A;  3AN1 A;  2INN E;  2WXF A;  3GP7 A;  3ZGZ A;  4RF1 A;  1CZP A;  1M4V A;  1P7E A;  4KKJ A;  5MPO A;  2OHF A;  3AED B;  3FIL B;  5D7G A;  2J42 A;  2SAK A;  3B2F A;  3Q8F A;  4DXF A;  2RDH A;  4NZL B;  2N0S B;  3VQI A;  4YT0 B;  1FFU A;  2LFI A;  1YN5 A;  3R8B A;  4DXG A;  4KGS A;  4MM3 B;  3W9C B;  1TKE A;  2D5G A;  1FRR A;  1B1Z A;  2WXJ A;  3AE5 B;  3W1S A;  1DOY A;  1WWT A;  2CJN A;  3IAM 1;  1AWD A;  3KWV A;  3VR9 B;  1L0X B;  3UI3 A;  1QKZ A;  3AEC B;  2JYT A;  1TS4 A;  1EWY C;  1TY2 A;  2I2Y A;  2J52 A;  3HRD D;  2DYM A;  5HG2 A;  4C56 C;  2WDR B;  3NVV A;  1PYW D;  1N5W A;  2RPV A;  3AH7 A;  2FBW B;  1XLP A;  4GDK B;  1TKG A;  4LK0 M;  2JWU A;  2J53 A;  1NI3 A;  1RYJ A;  1FO4 A;  1MI0 A;  1WYG A;  1MPE A;  3L4P A;  1K51 A;  2NTT A;  1PGX A;  1ZXI A;  2QSD A;  4UDU C;  1XCT L;  3T3O A;  2ON8 A;  4D2K A;  2KQ4 X;  2RMM A;  2E6X A;  4J3O D;  5C3J B;  4ZHO A;  1C78 A;  5D3I B;  3AE4 B;  3AE2 B;  4C80 A;  5E6J A;  4US8 A;  1ZDV A;  4C7Z A;  1D4B A;  2W54 A;  1DYQ A;  1YQ4 B;  4A55 A;  3BWU D;  2YEP F;  2DLB A;  3I9V 1;  1HZ5 A;  3AE6 B;  3BK1 A;  3BYT B;  3NVZ A;  2DWQ A;  2BS4 B;  4RGN A;  3AM9 A;  4A9A A;  3KWL A;  1SE4 A;  1PFD A;  1YJJ A;  4ZRP A;  1QOB A;  4HKQ A;  1I4R A;  4A90 A;  5G5H A;  5EE0 A;  4N6E B;  3Q8E A;  1PUT A;  1EM7 A;  1PGB A;  4B0M A;  4KX6 B;  4XDC A;  1VZ6 A;  2GB1 A;  1L0V B;  1N62 A;  2L32 A;  3MJ5 A;  2PLP A;  4EE2 A;  4AQ7 A;  1TZO A;  1UUP A;  1I4P A;  1UGJ A;  2Z8L A;  2G9H D;  2KWD A;  4RF0 A;  1E0Z A;  1KRH A;  4YTP B;  1J7C A;  2KDM A;  3GS2 A;  1IBX A;  1PDX A;  3WCQ A;  1YMH E;  4USA A;  2AQ2 B;  2LEK A;  5AUK A;  3U52 E;  4YSY B;  3BII D;  3MP9 A;  3RFZ B;  1IGC A;  3V3X A;  2W3R A;  1F0Z A;  2JSV X;  3GB1 A;  3PZ8 A;  1JWA D;  1VRA B;  2MEK A;  2WXH A;  1E9M A;  1DGJ A;  2BS3 B;  5BYR A;  1QOG A;  3U7Z A;  1TS5 A;  2X38 A;  2WNM A;  2AQ3 B;  3ETR A;  3J9C A;  1JWU D;  1T6B X;  1C4C A;  1BML C;  1SIJ A;  4WH4 A;  3BVG A;  3AMZ A;  3LYY A;  3HVD A;  3SFD B;  2WLB A;  1MHX A;  5BYS A;  2WS3 B;  3AE3 B;  2ACZ B;  3TEW A;  1T3Q A;  5C2T B;  1C77 A;  3R2T A;  1VR9 A;  4L2Y A;  5H8Y E;  4P6V F;  1QIL A;  1YQ3 B;  2G1E A;  2JYE A;  4RCO A;  1J7B A;  2K22 A;  3PZ7 A;  4KGR A;  2LHE A;  3Q8B A;  2QIL A;  5BMH A;  1L5P A;  1ACC A;  1NYQ A;  4ARC A;  3B2G A;  3IAS 1;  3SR6 A;  3NUH B;  3ZYY X;  4OW0 A;  1C9F A;  4NAW B;  1EU4 A;  2BS2 B;  3BVM A;  1SXT A;  4OZC A;  3EA6 A;  1KTK A;  2IPK D;  4IKG A;  3BZD B;  1IGD A;  2H89 B;  3IT6 B;  1JQ4 A;  2NTS A;  2N9K A;  2W55 A;  3AEB B;  1KFY B;  4YTN B;  1KLU D;  1KF6 B;  4L1B A;  4YTM B;  3T3N A;  3P42 A;  4NAM A;  4JWU C;  3P4Q B;  3DWG C;  1WXQ A;  1WSP A;  3AEG B;  4ZHP A;  2BB6 A;  1XO3 A;  1VDV A;  3MHZ A;  3ZJT A;  2WXK A;  1SB3 C;  2M19 A;  2R61 A;  2JX5 A;  1FEH A;  2XNA C;  1BUI C;  1I4G A;  1TKY A;  4LLG M;  5T8I A;  2LUM A;  4MAC A;  1IBX B;  1FXA A;  1ZP0 B;  2KAC A;  1E7P B;  1TS2 A;  3R2I A;  1CJE A;  2LJI A;  3BVZ A;  4A6Q A;  1XCQ L;  2ICI A;  4TSS A;  5H92 C;  2V3N A;  2QIE B;  2NMQ A;  1NEN B;  3FC4 A;  5EE1 A;  1IUE A;  1N5X A;  2VZK D;  1VLB A;  4FXC A;  1V8C A;  1Q10 A;  1V1P B;  2WXQ A;  4MT5 A;  3ZQ4 A;  2WDV B;  2BYT A;  3URY A;  1YNT E;  1C76 A;  2M56 B;  2W82 A;  1Y56 A;  1QLB B;  2DYO A;  3SEB A;  2Y3A A;  4ZRQ A;  5BMG A;  2TSS A;  5BYQ A;  1I4Q A;  3O13 A;  3KQ4 A;  2N7J A;  4JX1 C;  2ONQ A;  1FFV A;  1FNW A;  3AV8 A;  4KKI A;  2EKI A;  1HEZ E;  1QQR A;  3FIL A;  4HKZ E;  3BK2 A;  1WGK A;  1FM0 D;  3U4E G;  1TYG B;  1NYR A;  4A8X C;  1TY0 A;  2WXP A;  3KLS X;  1V1O A;  1DOX A;  3TSS A;  4YSX B;  1D5X C;  1LO5 D;  2PKO A;  2INP E;  2QEJ C;  2PMV A;  2KMM A;  2MJD A;  3E56 A;  5HHD G;  2HDE A;  1K53 A;  1ZE3 D;  2WDQ B;  1GPX A;  1QT9 A;  1JW9 D;  2QJL A;  2N9L A;  2BBC A;  1JML A;  2PIA A;  1V97 A;  1HXY D;  1QOA A;  3LXF A;  1SJE D;  2H88 B;  2WP9 B;  3DWM A;  1XLO A;  3SFE B;  1XEE A;  2WXM A;  2PVG C;  5FR3 A;  4TQ1 A;  1XF5 L;  1SE3 A;  1L6V A;  2LMC A;  1NEK B;  1YN4 A;  1KH0 A;  1FCL A;  1SF0 A;  1ET9 A;  1FNU A;  1FCC C;  1AYF A;  1EWC A;  1L0Y B;  2IGH A;  4GLS C;  3P4R B;  1JRO A;  4HRO A;  1HQR D;  1OQQ A;  5G5G A;  1D5M C;  1FRD A;  3E9S A;  4US9 A;  4NJC A;  4HJG E;  4OZB A;  4B0E A;  2HTM E;  1CQV A;  4IOI E;  1OFF A;  3LB8 C;  4C7Y A;  1B9R A;  3ABV B;  1CK1 A;  4R3D A;  1AN8 A;  5HFY A;  1GB4 A;  1GOZ A;  2IDY A;  2JQR B;  2JU6 X;  2Y5P A;  1A70 A;  2L52 A;  5TSS A;  1D6E C;  3P63 A;  2ZW1 A;  1MVK A;  2BT6 A;  3N9Y C;  2WXN A;  3CIR B;  4YSZ B;  1SSN A;  4M0W A;  1TS3 A;  4YWG G;  3AEF B;  3PO0 A;  1EU3 A;  4JPS A;  4TMA B;  2KN4 A;  3BYY B;  4Q2J A;  2IJ0 A;  3IT4 B;  4RH6 A;  1JCK B;  3VR8 B;  4XE0 A;  1XLQ A;  3Q8C A;  4ZYS A;  3W5U B;  5D3D A;  2GI9 A;  1HZ6 A;  4P16 A;  1E10 A;  1RWS A;  5GXG B;  1C79 A;  1JWS D;  1L6U A;  2QMT A;  5LNK 1;  1I7H A;  3TEZ A;  1N61 A;  1NVI D;  1TJE A;  2WU5 B;  4RGO S;  4DQO C;  1SBB B;  5JXV A;  1JRP A;  1FIQ A;  1T5X D;  1SE2 A;  4PT5 A;  1UNS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...