4OZGF

D2 protein complex
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
240
structure length
240
Chain Sequence
GVSQSPSNKVTEKGKDVELRCDPISGHTALYWYRQSLGQGLEFLIYFQGNSAPDKSGLPSDRFSAERTGGSVSTLTIQRTQQEDSAVYLCASSFRFTDTQYFGPGTRLTVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class II histocompatibility antigen, DQ alpha 1 chain
publication title T-cell receptor recognition of HLA-DQ2-gliadin complexes associated with celiac disease.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 47
structure length 240
sequence length 240
chains with identical sequence H
ec nomenclature
pdb deposition date 2014-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ozgF01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ozgF02
2VL4A 1XF4A 1RUKL 5DRWA 5I75C 4WUKL 4XNQA 4NHCL 2Z35B 4P59H 1OAZH 1BIHA 5CD5C 2J5LC 4CVXB 4QRTA 3RY6C 1NEZB 2N1KA 5JOPE 4JY5H 1G7IA 4TSBL 5HGAB 5GGTH 4HF5L 5E6ZA 5TE6H 1KCUL 3TBYA 3DI2B 4EOWL 1M6OA 1IVLA 5F21B 1ZS8B 3KYOA 1N6QH 3DHMA 4GW4B 1J0ZA 3ROLB 1SJVA 1KCSL 1MCOH 4KUZH 4K8RC 5JZ7D 1J18A 3VG0H 2LTQC 4MNQE 4CKVX 4NQCA 1P7KB 3BDXA 3WL9B 3OR6B 3VA6A 1JZ7A 3S3SA 3U83A 4GG6F 4POUB 1CG9B 1AD0B 1TTUA 1J8HE 3SKOB 1GGCH 2DLGA 1IT9L 3BW9B 1I7RB 4RNRA 3SBWC 2GSGB 1FVCA 4NFCA 5BMFL 2CXKA 4YDKL 4YNYB 2PTUA 4PJFB 4PJ7F 1J12A 2JJSC 3CZFB 4MD5B 1CE6A 3AXLA 3O6FC 5CWSB 2R0KL 1KCKA 3TO4D 5DK2A 3VD9A 3QDMA 3S3PA 3PIQA 1R6VA 5E8EA 2LV4A 5TFSH 3NH7L 2QQKL 2ZUQB 5HI4D 3PDDA 5CJOL 4F57L 3GSWA 4N8VA 3RZCA 3QR2A 3JV0A 4DFIA 4HFWA 2DLHA 3QIBA 5EZJA 4R0LB 1UQSA 3JUZA 5FECA 1S7VB 5EUOE 2Q76A 5BJTB 3BKJL 3NBNA 3DUUA 1XIWB 2J8UE 4WHCA 4KRPC 1FL6B 3OWEA 1F6FB 3VU2A 4PJ9D 4EZMA 1LEIB 1E28B 4R90H 1VKXB 1FZMB 2X4QB 2XACC 3VWJC 1JNNL 4Y19D 4LCCA 4EI6B 4HJGB 1ZVSB 2GY7B 5SV4A 2G60L 4ODUA 4OD3L 2Y07H 4WCYH 2X40A 4OTXL 1T03H 1Y0LA 2A0LD 3KPNA 5C6WH 5J6GA 4XC3L 2R4SH 1ZLWH 3LEYL 3QDJB 4J8RB 4KGJA 2J6EH 2CKBB 1YEFL 5D2LF 1N5AA 1RVFH 2H2PD 4JFQA 2JJWA 1AGFA 2V2TB 4ZOCA 1NAMA 4MQXD 2DWEA 3FONB 5SWQA 3FFDA 5DD0H 1I9JL 1KENH 3Q3GB 2X4UA 2V2XA 5KSUA 3X11B 3HB3C 3MOQA 4LAQH 5JXAL 1J0HA 4HG4K 1INEH 2FX9L 1D5MA 3ZSSA 1GOFA 4FQXB 1TZIA 3G6JF 3S5LG 1J88A 2F53B 3ZDYE 4Z7NE 4UBDD 1EK3A 1Y18B 4X4ME 2MJWA 1IM9A 3ZKMD 1YMMB 3AS2A 4UV7H 4MNGE 4XCNA 3FB8A 3GSNB 3MREB 1IGYB 5H37H 4RA3A 3WFBH 4M6OL 4LLAA 5DHYB 5C0BE 4JDTH 5C2BL 1BEYL 3EJZD 2WLZA 4OIIH 4ZQKB 1WBXA 2CDFA 3OB0K 4NO0B 3FQRB 2NCMA 3SQOL 4YZFE 1IGTB 4NRZA 4UOW1 2QEJA 5IK3B 1QO3A 3LZFH 3WN5A 1CXHA 1WITA 3ILPB 4M1DH 4PJ8D 4PJHA 2XPGA 1NC4D 2OXGA 4HLZG 3LEVH 1HI6B 5D8JH 5E9DA 1E4WH 1RJZA 3FOLA 4X0KA 1MI5D 1JPGB 4RFNB 3OG4B 1IC4L 2R2HB 5C9KA 1UM5H 5BQ7A 4P2RE 3EZJB 5ITBL 5F7NC 5IFJA 2NYYC 5KSAD 3SDCB 1VFUA 2FSEB 3RBGA 1EGJA 2DQTL 5CILL 5GS1B 5A40E 2B5IB 1B0WA 1B4RA 1MCRA 3LDBC 2W0KA 4C56B 4MA1C 1CI5A 4ZNEE 5F6IB 5T1KA 4HDIA 3RWJB 1MFAL 1FYHB 2FL5B 3HE7A 4ZFOB 1II4E 5A2LH 2ICEA 5FOBA 5IM7A 6FABH 1V3LA 4KJPD 4U6VH 4G9FB 5DURD 3VXNA 4PJEB 3RWCA 4JM4L 1T4KA 1N6VA 5HGHA 2A9ML 1GCFA 2EDTA 3BAEH 1KB9J 4ODXB 5A16B 2AK4A 3V5KA 1ACYL 3MRNB 3EDJA 3WUWG 1OAXH 3CX5J 4LP5A 4YWGL 4Y5YB 1MCKA 1OGTA 3WMSA 4XBPB 3QCUL 1FO0A 4PD4K 5B3JE 2UWEF 4PR5B 5ICXB 4AYFA 5I1CH 4GW5B 4MD4A 4MXWH 3NFPA 5C92A 5B39A 4Z18A 1HNFA 4Q6IC 1EFQA 1EZVX 1JUFB 3GFUA 4ODHL 5LBSL 1UJ3A 1CGSH 4QRRB 5EH1A 5IB1A 3VXUA 4IJ3B 1U8KA 1S7XA 1U8JA 2X1QA 3M8OH 5I0DA 3DYOA 5FK9A 2M26A 3L3HA 2ED7A 5I66A 1CTNA 3O6ML 1W0WB 3KYKH 4PJCB 3WHE1 3RTQD 1JJUA 5F6HI 5IB3A 2FYYA 5DZOA 4MA8H 4H20H 1JGEA 4GAJL 1JBJA 1KJ3L 4GBXC 1RZ7H 1OP5H 2XWTB 4RFEA 1WBZB 32C2A 5HBBA 1EEZB 4NUJA 5GSRB 2H1PH 3T0EB 1QNZH 4ZYKA 2AXGB 3BWAB 3U46B 4M1CD 1ZGLM 4JANA 1KJMB 4GQPH 1XGYH 3H9HB 3BMWA 3GB7A 4Q2ZA 1L7IL 5HSFA 4R4ND 3I6GA 5JTWA 2CSPA 5IEHB 2G5BB 4Y2DD 3KR3L 3GGWB 4M3KB 5JPNA 1Z9OA 1XGTB 3MJ9A 1DQML 3RL2A 4YLQT 3BUTA 1YEHL 1Z3GL 2WNGA 3FFCA 2R2EA 4OZFG 1F4WL 3SJVD 1HIML 3B2VH 4PRPE 5JOFB 3VFWA 4HZAA 1QSZA 1NANH 3H42L 4XVTH 1KIQA 2NY4C 5KVDL 3LN5A 2MFNA 4AQ1B 1KEGH 4A6YL 4J6RH 2YD4A 3K8LA 1PLGL 1YPZE 3S4SB 1C12A 4LF3A 4P4KB 5K9KB 3BJ91 4IIQA 1E0OB 3K8MA 5MHSE 3KJ6L 5FCSH 1NBVL 3FT2A 3ARFA 3HLAB 3IS0X 4PJIF 1DBML 3RGVB 4PJAF 4L8DA 3IDXH 4NJAL 1QBLL 5DWUH 3UZVB 4G6KH 4FS0A 4I0PD 3AAZB 4BM7A 1IQDB 4JFYA 4AIXA 3FRPA 1OM3L 1JWUB 4DZ8A 1BVLA 1RZFL 5DRZA 1T80A 4LU5H 1UXWB 4PJGB 3VD7A 3W39A 5IHUH 2EH7L 4YHZL 4FQIL 2D0HA 3B5HA 5D7IF 5ID0A 4LQFH 5FFLA 2OMNA 3C6SA 3QO1B 1HYSD 4MD0A 3MRQB 5JW5B 4CN6A 2F8VA 5I18H 3H0TA 4L8SB 5DGQA 1U8OB 1W0VB 5ALCH 2BSSB 3KYAA 1AQKL 4I5BA 1FFNA 2YUVA 4ZSOE 3TPKA 4AM0A 2YBRB 4PV9B 3R0MA 2NPLX 3PQYE 3C60B 3RWHA 1PGRB 4WV1B 4LRIC 4MLIA 5J3HC 3TNMA 3WS6C 2NX5A 1BD2B 4FXKA 3IDNA 2Y6SD 4OT1L 4MJIE 4LNRA 1NJ9A 3BQUD 3F6IA 5DJ0B 5IBLC 3UTSA 5IKCB 2P5ED 1AXIB 1CT8B 5EFIA 2F54D 3N1QC 3VW3L 4NNYA 1P7QA 1IGJB 5EOCL 3I9GL 2V5RA 2BVPA 4OQTH 4X6CE 4AMKH 1LNUA 1M7DA 1EZVY 2AJXL 3DVFA 4NZUH 2VDOH 4XHJC 4NO2B 1JK8B 3HR5B 4CU8A 2O5YL 1VB9A 4U4BA 3LD8C 4EQ2A 1CK0H 1HKLH 1I1YB 3PWUA 4NKOB 3PDOB 4XNUL 1P5VA 4KZEL 3CLFL 1QRKA 2N7BA 4ZMAT 4U1HB 3PWVB 1T1ZB 2E8ZA 3CXDH 3CLEL 4G8EB 3P9MB 3N06B 3IB4A 4J7RA 1A9EA 1GGIH 5C0FB 2XNAB 3OJVC 2XWJA 3PHSA 1NGZA 3DXAB 1OTSD 3L9RA 4H1LB 3IKKA 5BS0A 2FWOB 1R5VB 2IAMC 2WUBL 2MTPA 1MLCB 3GMMA 2HYMA 4OLYH 5JLZB 1LP9A 5DMGC 1BBDH 1FV1A 4YHKL 4UUJB 3U9PL 1NC2B 3NCYP 2AXJA 2AERT 2FIKB 2FGWH 2W59A 1RJLB 5JMOC 3QA3A 1QR4A 5L6YH 2BRRL 4JVPA 1YZZA 1HHIB 3QPQD 1QYGL 3FMGL 4G6JL 3IYLW 1T5XB 3VJ6A 3VXSE 5KVGH 2VZUA 5EDXA 2D7MA 2CDGA 1FFPB 4NQXB 1RU9H 3CFIC 4EUPG 1U8MB 3QUYC 4OLXH 4L5FH 4PJ5A 1GC1H 3RWEA 1J8HB 2K3TA 1BF2A 5DO2D 5IG7A 1XIWD 4CL7A 4BQ9A 4XVSL 4M8QB 2AEPH 5AWNH 2R8SH 2CKBH 2R0ZH 1F2QA 2E27H 1S78D 2JCCE 1M05A 3JWOC 3MV7A 1IGCH 4W6YB 3MLZL 2ENYA 3WE6A 4HAGA 4OD2A 2R2BA 1L0YA 1AE6H 3DMMB 3T8XB 4BH7A 3WIFA 1EAJA 5T5FH 3X13A 5DVLA 3H9ZA 4BQBA 3DX7A 4JFXB 2EYRB 5F9DC 3QDJD 4DWHA 4GRMA 1W72B 1LE9B 3ULUL 4KK6C 4KUCD 5I75B 1T04A 2VZSA 4Q9RL 3OXRA 5EUOB 3SE3C 1XZ0A 2GK0A 2YD9A 4JCLA 4QLRA 1EUTA 2J5LB 2J8UB 2CDEB 3ARTA 4Q9CA 5DYOB 4XPBH 4JQVC 3GSNH 1UCBH 3MR9A 5A2KH 3WHXA 2WANA 4OF7A 5M94B 1RD6A 4PJBB 3S88L 4PJAA 3RVXC 2X1XR 1CDIA 2LTQB 25C8L 1XCTA 4FQXD 3ARED 1EXUA 1FLTX 4BA8A 4KVNH 2F53D 4KHXH 3DVNA 4WRLA 3T4YB 4QCIA 4QRPB 1LE5A 3UDWC 1YMMD 3MCG1 4X6DA 2DMCA 5TQ2L 4PRNA 1GRWA 1NBQA 3T2QA 3AU1A 1KB9K 1R5WB 4G6FB 4PGEA 2VUOA 2ID5A 4QWWC 3FJTA 3ZTJH 1DDHB 2DYPA 3O6FB 4N0UE 3I2CL 5GGUB 3TZVA 4CRPA 5C0RH 2IANB 5D5ME 3LH2L 4HXAH 2XYCA 1MCBA 3L3IB 4NO0D 3ALXA 4HWEH 3QG7H 4X8JB 2OJZL 4JFHD 3O3DB 3WKMH 2PXYB 5ID1A 1INDH 1D6EA 4RMWA 5BW7C 4UINL 4RDQF 3VH8B 3RA7H 3PV6B 1QEWB 3BH8A 4YJZL 3QIUA 1JGLL 2Q8AL 1P1ZB 1U8PB 5F7LB 4HQQH 4ELME 2Q87A 2XKSA 3HAEA 3D0LB 1IC7H 3MODH 1NCAH 1CDGA 4KRPB 4R4BA 1WZ1H 1KTKE 4R96B 3SDCD 2VNCA 1LK3L 5JW3L 1R3HB 2QADC 4YO0B 5C0BB 3ZE0E 1SYSB 3VWJB 3GHBH 1KCVL 5J9PB 1DBBH 1PJ9A 4NCDA 4C56D 1X5LA 2YUWA 3HMXH 4Q74A 4OB5L 3OAZH 3IJHA 3D9AH 3DV6A 4X5XA 3EYOB 1IM3A 1DN0A 3L1OL 1S7SA 2UZIH 4IRSC 4LIQE 4ONGL 3S35H 2VN4A 8FABA 2Y06L 4G9FD 4XMPL 1KNOB 2XZCH 4YE4H 3B3IA 4YDVA 5IROC 3EO1B 5CJXA 5EBLB 1JFQH 3O2WL 3NN8A 4JO3L 3X3GH 3H3KA 1K4DA 1I4FB 1HN1A 3FO2B 3P9LA 4LSRH 3QBTB 5DT1H 1Q9LA 3EDEA 2VXTH 4YFDB 2B7DT 2HJFA 1T2QL 1IGFH 4P5TA 1A02N 4C58B 2IG2H 4GXUM 3QJHA 1IQWH 4U1SB 2Y5EA 2HRPL 2B4CL 2A9NL 3BRFA 1UM4L 1AQDA 4U05A 3OGCA 1G7QA 3IVKA 4ZODA 4HJ0C 3LN4A 4QRRD 4UTAH 1A1NB 2QQQA 4YXKH 2AJUL 1IRAY 4K3EH 4BSWB 3HMWL 3GDBA 3FO0L 2Y36H 3L5HA 1BAFL 3QI9C 2ZPKH 3QNZA 3ZLQC 1LD9A 5GGTA 1X9QA 1BQHA 4I0CC 4BSVA 3RAJL 4JO1H 1HSAA 2CGRH 1K9TA 2X1PA 3AB0C 1NUFA 4P4RA 4YDIL 5ICZB 2FJHB 4W70A 4MWFB 2ZCLL 5CUSL 5E8PA 2X4RA 4U7KA 1RJCA 3WXWH 1EERB 1S9YA 3T0ED 3WFEH 3E6HB 5FGBC 3UMTA 4M93C 4YHNB 1BPVA 3QNYA 5IBUG 4ODBD 3UJTH 3IDIB 4J3VA 4KQ3H 3UYRL 1LO2H 1KF9B 4HUVB 3UX9B 4HH9B 2Q8BH 4Y4FA 4NSKA 3MO1B 1LK2B 2A77H 3QT2A 4HIJB 5GGSA 3MXVH 1ONQB 4G8FB 4U6XA 4XX1E 1KJVB 1OAQH 1HOCB 1WISA 4DOHB 3VRJA 5LQBL 3BO8B 3J7HA 4LEXL 1N0XH 4LDOB 1AJ7H 4E41A 3QFJB 4CNIA 2JB5L 5D70L 3ZE1E 5FYKE 2QV2A 4XC1L 4R2GC 3ZHKA 1T5WA 5TH2A 2W9EL 3LDBB 4OLVL 4MA1B 4O02L 4ODWA 1AGBA 4WO4A 3MLPA 4JY4A 5KTEH 4XP6L 3MROA 4QHUB 1UC6A 4DTGH 4P4KD 1HQRB 2OP4H 1EJOH 1A6TB 3T2OA 1ZWIB 1HHJA 1MFEH 3NFSL 3C9NB 3NIGE 4JDVA 1V7ML 2H3NB 3MGOB 2O5XL 3NZ8B 1I7UA 3RGVD 1PKOA 3S34L 1MCHA 1ZT4A 4JPKH 5ESAA 3T3MF 5H8DA 5DR5L 3P30L 2X09A 3GRWH 4B41A 5DDHA 3IDYC 4XPAH 1TENA 4UU9A 2Z4QB 4PRPB 5I8CA 2DTML 3V5HB 4Z7VA 5EA0H 5DMYA 3ULSA 2FLRT 1S9VB 5MI0C 3DROA 1FNEB 4X7CC 3F7YA 4HCRH 3FN0H 3MZTA 4G80B 4K3GA 3PP3H 5FM5O 3BIAX 1JZ5A 4N9GB 2DIJA 1B3JA 4Z7WA 3T09A 3HC0B 2X4OB 3VXPB 2PO6A 3BPCA 4X9FA 1QSEB 4PP2A 4GRLC 5I15L 1BX2A 3C60D 4OJFH 2A83B 5ELIA 1KTRL 3VRLF 4GJTB 1NCBH 4XMLL 1I8KB 1BD2D 4GBXB 5GRWA 1H15A 3FQWB 3SY0B 4HEPG 5JHDE 4BH8B 1H8OA 5ANMA 3QO0A 5TE4L 3HNSL 4DVRH 3QUKA 1NKOA 1PY9A 3KLAB 4LOUC 5I8OH 4PJ8A 5F96H 3QUMB 4ZS7H 4DGVH 5HD8C 1MCJA 1TPXC 3L5WA 4MJ6A 1NC4A 1IEHA 3BSZL 3INUH 4F7TA 3DX8B 5LGJB 1MI5A 3BP4A 2GITB 4RX4D 4ZUWB 4Y8DC 4ZSOB 2XZQH 1MCPH 4HIXH 3OG6B 2N56A 4H1LH 4XAKE 4DW2L 1JHLL 1MCIA 5KSVA 2PYEA 4Z7QF 4PLJC 3T0BA 1DBKL 3O8XA 3S9DB 3G9VA 3ETBF 2NLJA 3A6BH 1AI1H 5E2TH 4OZGA 2DQHL 3RPIA 1DQTA 4GMSL 3MZGB 4RCAA 2NY4B 1A1MA 4MJIB 5KJRH 3V4VL 3P11H 3QWOB 3VXOB 5F7EL 4MQ7A 3S6CA 4WWKC 3DXAD 5IV2A 2AI0L 2I9LB 1S5HA 1FGNH 1XH3A 4JN1H 3U7YL 4X83A 1A4KA 2MHAB 1DBAL 4FP8H 2NTSP 1KPRB 4PBXA 4DZBB 5IW1B 1NC2D 43CAB 3IDGA 3QEUB 3MYJB 4WUUE 1PX3A 2AGJH 3BN9C 4KJWC 1UWGH 2BVEA 5I19L 1VERA 4K9EC 3TIDB 2DIAA 5EPMB 3ULVE 4JCMA 1JTPA 3D25B 2IGFH 4Y4KC 4LFHG 3DO7A 4HFUL 3ALWA 3PP4H 5IMMA 4U3HA 5E2WL 3W0WE 4EXPX 1BBJB 4HKJB 1ZLSL 2GYSA 5AYUH 1UFUA 1T1YA 4WW2C 3H8NA 4EIGB 3V4PL 1J8HD 3O45B 2HFEB 1TNMA 4XPHL 3VGHA 3RTQA 2D7QA 3QHFH 2DB8A 1C08A 1MPAH 4WFED 1RSFA 2XWBA 1W72H 3RL1A 1XEDA 3LV3A 3Q0HA 3TM6A 1RV6X 5BZWB 3MV9B 5IVZA 4JHAL 1JMXA 1Q72H 3RZWA 1HQ4B 3D5OF 1RAMA 1PKQA 3GSOA 1CFBA 3O3BA 1LHZA 1FP5A 3L7FB 3OAZK 2V5YA 4GW1B 3DMMD 1JNLH 2Z91A 4PG9A 3H3BC 1G1YA 3MBXH 3O6LH 4IRZL 4X98A 3RDTC 3R1GH 3W9DA 3SDYH 3MLVH 2EIDA 2JELL 4HH8A 4K8RH 5I30H 1KB5L 1ORQB 4XMKL 2WP3O 1A6AA 1MIEL 5CD5D 4NYLB 3FZUC 3WJJA 4KI1A 4Q6YA 1M7XA 1I85C 2OL3L 4ZUTA 1UG9A 4GUPB 2DQJH 3SJVA 4TPRH 4F3FA 3AY4C 5INDB 1NLDL 1DLFH 3LMJH 2CR3A 3VXQB 2WW8A 3LD8B 4AG4L 5EWIH 5EOTB 3ZT5A 2XY1A 4FQLL 4K8RD 2FX7L 4QYOB 2XQBH 2D9CA 1YEIH 4P5KB 4RWYH 1QKZH 2VABB 4AIZB 3QAZC 1MHHB 3G04B 1J7VR 3TA3C 4U1JB 2EXYC 4X5LA 2O93L 5MP6H 2BNQE 1FORL 1GGUA 1QRNE 4NKDA 4W6WB 3O4LB 2YC1B 4U0RC 2IAMB 4G6FD 1J1XL 4PREA 4R3SB 4DGIL 3KAAA 1KT2A 1SJEB 5J6HB 4I0PA 3O6FD 3VFRA 3SKUD 2IAND 3MJ8A 5D7KE 1F3RB 5C0JB 3BH9A 5EC2A 5TGBB 5IFHH 5EU6E 3P0YH 5HY9B 1KJ2A 2KZ1B 1HH9A 1X4ZA 3SKJL 5I2IA 1LEKB 4NGHH 3SDAC 1Y6NR 2BCKA 2V9RA 1KLGB 2FR4B 1FPTL 4OSUH 5IVXF 2O61B 1VFAA 1G7MB 2IBGA 4DCQA 5ICYA 5DUBB 3QUYB 1X4YA 2OI9C 2MWCA 4KGLA 4KRPD 5TF1L 3BZFA 4GKSA 4N0RA 3VD3A 4BELD 4AT6B 1MCSA 3G5VA 2CMRH 1IGIH 1Z5LA 5C0BD 4S1DC 4ZO8A 4N0UB 3VWJD 2R15A 2P8LB 1A7RH 4P5MA 1B88A 5J12C 4QT5B 5E95B 4JRYE 5DJ8A 4DUWA 4JRXE 3U0PB 3PV7A 1CZ8L 5CLTA 3VWKC 5E4EC 1CCZA 1U8NA 12E8H 1NLBH 1JPSH 5CP3H 2ORBH 2BHUA 5DQJB 5IEKB 2QTEA 5DFWH 4NHCH 2XOTA 4XP9L 3I84A 3QXTA 2QL1A 1DSFH 4CVXA 2VLRB 4ELMB 4TSBH 1P7HL 1KCUH 5HGAA 1R3LB 2E6QA 3CPLB 4YPGA 2YEZB 1AGDA 1OQOA 4PBVC 3TWCL 2GUOB 1FIGL 4JVWA 1D9KC 5FM5M 1RMFH 3IRPX 4GW4A 3ROLA 4RRPA 3HB3D 3SKMB 3QQ4B 4WI7A 1YEEH 4LCIH 3WL9A 4H26B 1Q9OA 1R24B 3B6SB 4NQTA 4GT7A 1AD0A 1GGTA 2R4RL 3PP3K 3SKOA 3L7EA 1PAMA 4D0DA 5MEOB 3VFNB 5BMFH 3GEWB 3BW9A 1A21A 1I7RA 4YDKH 2GSGA 4RGNC 4OFYD 2DQIH 4ZUSB 4BQ8A 3ABZA 3HI5L 3CUPB 4YNYA 1ZA6A 4JB9H 4XP4L 1K6QH 1ZTXH 4OCXL 3RZCC 3O11A 4HMCA 3CZFA 4MD5A 5CWSA 2FO4B 5BV7L 1FC1A 4WGVB 4X4YB 5DJXB 5HYSG 1X7QB 4D9LH 5IHLB 4QHKI 3OL2A 1FZKA 1Q1JL 4ETQB 4LPXA 2IBZY 2FB4H 4ZDHB 4X9BA 3IAGC 4Z0BL 1IBGH 1U9KA 2VN7A 5CSBA 2B39A 4ALAL 2NY5L 3WIIL 1RFDH 3U30C 4O9HH 4EBQL 3ARVA 1RZKL 5JIIA 1KXVC 5CJ5A 4R0LA 1C1EL 3BKJH 2C3VB 4JPWL 4NRXB 5BJTA 2IFFL 1MH5A 3OV6A 2BY3A 1YECL 3RWGA 4QRQB 1XIWA 4WI3A 1FL6A 1W8NA 1UKSA 5TF0A 1ZEAL 3QFJD 1VKXA 1H9VA 3GSUA 1FZMA 4JKPL 1MHPH 3N1FC 4UOW0 5CIPA 4EI6A 2VH5L 1IEAB 2QADB 3DECA 1S8DA 1FG2B 1VCAA 3MX0A 2VISA 1CL7I 4FTVA 1I7TB 4LMQI 5FB8B 5HYQB 2NQCA 3K80A 4UAOC 4NQEA 3BHBA 4XC3H 5KS9F 4IRSB 1YC8A 3C8HA 3M07A 3TBWA 1FC2D 3QDME 3QDJA 5EU7C 4J8RA 1SEBA 5DMKB 5IHZA 5EIIA 3BZEB 3SDXF 3HZYB 4JR9L 3GNML 1I9JH 3HNTL 2KZWA 3FONA 4GRWB 4KK8C 1MELA 4JM2C 4BZYA 4JG0H 1VGEL 1J86A 2DQGL 4OAWA 5DC9B 3Q3GA 2FBOJ 5KOMC 3P77B 3X11A 5JXAH 1FNSH 1GPOH 5AAWA 4PRPD 5CZVL 1FLRH 4P9HL 3ELAT 2F53A 3MJ7B 1DANU 5F1SA 4WU5B 1B0GB 1LQSR 1Y18A 3VFOB 2R56H 5E08L 2ZSWB 4M5ZL 4XNMB 3QI9B 4XRCB 1ADQL 1FYTB 3GSNA 1IGYA 4ZUVB 4LLYA 5MHSD 3QUMH 1QSED 4TUJB 5IMLB 3AB0B 4M7ZC 2O5ZL 3LQMA 2VXSH 3V79C 3IAPA 5DHYA 1BEYH 1V5JA 2R1XB 2VZVA 2CK0L 5CP7B 4GBXD 4QNPF 3SCMC 3EOBB 3R4DA 3FQRA 4NC1C 4GMTH 4DQOH 4PLKC 1WWBX 1IGTA 5IK3A 2JJTA 3RPKA 4M93B 1UH2A 3GKWH 4AY0A 2R29H 1RUAL 3IT8D 3FB7A 5GS0L 1PEZA 2JKXA 3WHE0 3T0DA 1P9MA 5DQ9B 5IGXH 5HGDB 2V5TA 5EU7E 2YA2A 2DOCA 4ZPVB 1MCNA 3VMNA 4Z8FH 5ITBH 1S7RA 2R2HA 4G6AC 4QHKJ 3CH1B 5CILH 3F5WB 5CZKA 3SDCA 2FSEA 3VFPB 5GGVY 5GS1A 5GZOC 3I6KA 3QP3A 1ZXQA 1RZKC 4R2GB 1AXSB 1NGXA 3K1DA 1MFAH 3RWJA 3L5XH 2YRPA 3RJQB 4W68A 2NY4D 4ZFOA 2DBJA 2WV3A 2VERN 4MJID 4JQXC 4DKAA 5F3BA 3EDKA 4JM4H 4G9FA 3QCTL 4FFYH 1KG0A 3P3YA 1DUZB 3MYZA 3ZMRA 4J12A 1NCWL 2E7HA 4ODXA 3VRIB 5A16A 1F6AA 3UYPA 3G6AB 5TQ0H 1VESA 3WFZA 5CCKH 1DBJL 4Y5YA 1WBYA 4XBPA 5T3ZL 1DVFC 5ICXA 4B7IA 2OTUA 4FRWA 4PJHE 4GW5A 2D3VA 4Z7OF 2H8PB 3E3QC 3LS4H 4NC1E 4H0IA 4PV8A 5E9DE 2HT3C 4K94L 3IDYB 2QJDA 3FQXB 3KPOB 4NM8H 1A7PL 4RFOL 3SE8L 5KG9A 4XAWL 5MI0B 3ZDZE 3EO9H 3WKNA 4LSQL 5GJSL 3VI3F 3O6MH 1XF3B 3K1KC 3HFMH 3FN3A 5JW4R 4KKBC 1RJYA 5L8KB 3SE9H 3RUGF 2BFVH 2D31A 4P9HC 4KV5E 4TN9A 5CEXB 1YY8B 1MAJA 4GAJH 2R69H 4HWBH 1KXTB 4GRLB 1T22A 3V95A 1KJ3H 1EMTH 3GBNL 1G9NL 2L0DA 3JTTB 3MV9D 5CSZA 5J3HD 3A0OA 4JLRA 1HEZA 1UA6L 1CL7H 1EEZA 3B9AA 5GSRA 3T0EA 3C08H 5CINH 4UIKL 3U46A 2AK4E 3S3JA 2P24B 3THML 1WFTA 1KJMA 3DURB 2YMXH 1L7IH 2UYLB 3IXAB 5JIHA 3W0WB 1BLNB 3VGBA 2EDKA 2AJSH 5E70A 5IBLD 3UO1H 5JQHC 3RWFB 1TPXB 3KR3H 1QLEL 3GGWA 4PJ7E 1BF8A 1MUJB 4XB7A 5C08B 4XHJD 4AIOA 1Z3GH 2AVGA 3VXUE 3IFOB 2I9TB 5D72H 1BOGA 3GMLA 5GS0C 2VOTA 1XFPA 2EKSB 4UB0L 4IIQC 3WO4C 3E3QE 4NBZB 5JOFA 4BFEA 4YIQA 1H3WM 4UOJA 4U2YA 1A9BB 4HIIB 1OCWH 1PLGH 2UVEA 4L3EB 4NFDA 3JV4B 5L0QC 2X5PA 4TNVK 4P4KA 4KXZI 5FDWB 5K9KA 4JKWA 4JQIL 1Y6MR 2QSQA 4WWKB 2E9BA 1UWEL 3FO9A 2Q7NA 1QVOB 3O4LD 4Z0XB 3ZTNH 2IAMD 3F7QA 4Y0GA 1TETL 1QFUH 2HP4A 1YNKL 2ZKHL 5DMGD 1HKFA 3AAZA 4JGUA 1IQDA 4LKXB 2BOBB 5FEBA 1JWUA 4XNYL 3P40A 4MCZB 4PG2A 4WI8A 2VL5A 4PJGA 1UXWA 2EH7H 3V0WH 4FQIH 4K3HA 3BIKA 2EDNA 2ARJA 4RDQG 2RQ8A 1MCQA 1WLHA 4ZO6A 2CLZB 4Y4KB 4JE4B 3QO1A 3MRQA 1OY3B 3FOMA 4EDXB 1FL5A 5JW5A 3JWOH 5FYLE 5EG6C 2DWDB 3FFCE 3MC0A 1YUHB 4HZLB 1W0VA 4XGZB 1KC5H 4WW2B 1RQ5A 1OVZA 4PB9L 3G08B 3QUYD 3GRWA 3HNVH 2BNUA 4K94C 1O7SA 2YUXA 4PV9A 1QRNB 1BHGA 5KVEH 3C60A 3MRGA 4V2BA 4WV1A 3TGXA 5HDLA 2DLIA 2X4SA 2XTJC 5TE7L 3LQZA 2VDPH 1BD2A 2WBJA 2FH8A 5J1AB 3NIDF 4MA3B 4A2LA 1EVTC 3D85B 5D1XC 5FGRA 1UYWL 5J7CC 2R0LH 3P4MA 5T33L 3QXUA 3LRSB 2BHZA 3Q5OA 1J0IA 1X5KA 2VE6B 5J56B 1FDLL 1DQLL 4LARH 1RUML 5JPMB 5DJ0A 3IKCB 3VW3H 1A14H 1CT8A 1NFDF 2VLLB 3RDTB 1M71B 2IJ0C 4MB3A 5DJZB 4LSPH 1IGJA 5GRVL 3WFDL 4AEIL 2AJXH 2DBLL 4QKXB 1QR1A 1MJ8L 4KK6D 2VLRD 1D5IH 4LIQH 3TN0A 2NXZC 3MLWH 2PTVA 1G0XA 5ENWA 4LK4A 4BQ6A 4NO2A 5HYIA 2YPVL 2O5YH 3JWNC 1G7JB 2HFGL 5EO9A 1TCRA 3RIAF 1I1YA 3AMLA 1LO3L 2DQDH 3PDOA 4NUGL 5T5NF 2BNRA 2P1YA 4LLQA 1QLFB 3BPLC 4MAYC 4U1HA 3PWVA 3RVXD 1T1ZA 3JV6B 1CD9B 4G8EA 3P9MA 5ECJE 4ZOAA 5CS7A 2WWKT 3IGAB 5C0FA 2XNAA 5IB5B 2NX5E 3DXAA 3QAZB 2R0WH 4MMXC 3MRLA 1RPQA 4H1LA 1LEGB 4LSSH 2RB8A 2FWOA 4U7MA 3D69B 5ESVA 5GGSY 5GSVB 3CVHB 3U9PH 4U0RB 5JLZA 4FQQB 4RBPH 3VFTA 4P57B 1KBGL 2IC2A 3QFDA 4QWWD 4UUJA 5I1DA 1IKFL 3G6DH 3UTSE 2DF3A 4GO6B 5HJ3B 3FQTB 1HXMA 3O0RL 1RJLA 4O2CB 3MLXL 4RZCB 2BRRH 4WI5A 1JP5A 3ZKND 3HPLB 3FMGH 4UDUB 1S7TB 5EORL 3R8QA 1HHIA 4HWZA 2X4NA 3HRZA 3QXWA 5DHXB 2YD6A 3SDAB 3MXWL 1HDMB 1B4JL 3PJSB 2YS4A 1U2CA 4WDIA 1G6RL 4K7PY 1NBZB 5EUKB 1CQKA 1T66C 2IPTL 5JQ6L 3OTTA 4XVSH 2BVQB 3KPMA 4WEBH 1JRHL 3BUYB 4NNPL 1KSRA 2OI9B 3QCVH 1PEWA 4CW1A 4MA7H 2DQEH 3VXMB 2EIZB 4YHOL 5JO5B 2QADD 3MLZH 4HUKB 1MQ8A 1XF4B 5BS0E 1S3KL 4O4YL 5FYKU 5J12B 1HWGB 3FHAA 3DMMA 3T8XA 5FYKH 4UQ2B 3UTPE 4KXZH 3L3OB 5DF0A 4QRTB 1JL8A 1LP9E 4N90E 3VWKB 1KCLA 2IPUK 3QWRD 1G7IB 3LPFA 5E4EB 5I8KH 4HKBB 1PSKL 4IRSD 2EYRA 3GM8A 1LE9A 1YQ2A 3KYOB 5FM8A 5HXMA 1NCUA 1X5ZA 1DE4B 3MACL 2ZJSL 1VGKB 5DYOA 1SEQL 1I9RH 1R3JB 3PWPA 1TITA 5FYKD 1MNUH 3HZKA 1R0AH 3MRDA 4Y8AA 4PJ5E 3HHRB 1D9KB 1IAKB 3SN6N 4H88L 1F11B 1KB5B 4PJBA 25C8H 2BY0A 3PDGA 3PHOB 4HJ0D 1ULVA 4S11A 5FOJA 4FQCL 1YJDL 5CAYB 5BOPA 3T4YA 3AXLB 3TZVC 2JIXA 2Y23A 1QFWL 4QRPA 4YUEL 5TQ2H 2OL3B 3TIEB 3QI9D 3HUJB 5DJDA 1FYTD 1WK0A 1J11A 4JZNB 1DLHB 4JFOA 5E7FA 3SBWA 1RIVL 4QY8A 4RGNB 1AP2A 3GSWB 1BWMA 4YX2L 1DDHA 3O6FA 5GGUA 3GO1H 3U7AA 3QIUC 2DQCH 5GRYA 2IANA 1EBAA 3QIWC 3KNBB 3L3IA 2OR8A 4YAQA 4JRWA 3C8DA 4M61B 3CFDB 3WDIA 3O3DA 1Z9LA 2PXYA 2APXA 3DUUB 3QRGL 3MNWA 3EFFA 4J3WA 3VH8A 3LRHA 5JR1L 1OPGH 4LVOC 3W5NA 5C6PB 1EHLH 3U30B 4N1EA 1PG7X 1WAAA 3KYNB 2AABL 1CD8A 3BDYL 1PBYA 4PJAE 1EV2E 4NZJA 3SDDC 3IRZA 2VLJA 1X6NA 1R3HA 1VEPA 1OLZA 1NDGB 1SYSA 3VWJA 4R2GD 4E42B 5J9PA 4X6DE 5D96C 2HFFB 2AQ3A 4X6FB 2UV3A 4UILH 2HN7A 4OCSL 3L1OH 2ATPB 1N5AB 4ONGH 3EYOA 1SM3L 4X7FC 3MV8B 1KLFA 5E99H 4XMPH 1NAMB 4UAOB 5DD1L 2DWEB 1KNOA 2LVEA 4JO3H 5D7LA 2X4UB 2V2XB 5KSUB 1T2JA 3CC5B 4EI5A 1UENA 1I4FA 3ET9F 3H9SB 5D71L 1D5MB 3AMKA 1TZIB 2CXGA 2HRPH 4XAKD 4JM2B 5C0AB 2A9NH 5ISZB 1EO7A 1UM4H 5F88B 5IT2H 5EB9A 3OQ3B 4QTIL 1FAIL 3H3PL 4XCNB 3UTOA 5IB2A 2XA8L 1NCCL 1A1NA 4P49A 3FO0H 3MRIA 1U3HC 4BSWA 1NGYB 5FUOH 2XV6B 3QRFM 1CU4H 2ZP0T 1WCQA 3BKML 1MFBL 3B8YA 4FFVC 2FX8L 2WINB 5ICZA 4NRZB 4MWFA 4GRLD 4LLUB 1QO3B 1CFTB 4M7ZB 2OS7A 2IQ9L 4P2YA 4Y4FC 1WWCA 1A5FH 5F8RC 4PJHB 3UAJC 5CEYB 2VDQL 3SCMB 4LSTH 4WUUD 3E6HA 3CCHA 4YHPB 2NW2A 4X0KB 3UJIL 4NM4L 3UJJL 4EVNA 1WSST 3OZ9L 2EO9A 3NCFB 4NZTL 3W0WD 4HH9A 5IFJB 4MGXA 2AEIT 4LOUD 1LK2A 5BV7B 1ZLUH 1A6VL 5BVPL 1WCBB 1TMCB 5HD8D 1ONQA 2KUTA 4G8FA 4P48A 1KJVA 1G9ML 4TTDC 1HOCA 4JFZL 5K9JL 5LQBH 3C5JA 4Z78B 3BO8A 4WO4C 2E7BA 4I2XA 2P49B 3QXVA 2I25N 5DVOA 5T1LB 3QFJA 1MAMH 4HDIB 5C08D 1YY9C 3CIQA 2V9TA 2YPKA 1E4JA 5FOBB 1F3JB 1CVSC 1BOYA 4PLJD 3FKUS 4HKXA 2CRIA 4OKVB 5DEZA 3RWCB 1T4KB 4OLZL 2G2RB 3MFFB 5DGRA 1K3IA 2BDNH 1MF2H 3Q48A 2AK4B 3V5KB 4L3ED 1BVZA 4TSCH 4K2UL 2PN5A 3T0VA 4OF8A 4QHUA 1HQRA 1FO0B 1J05B 3OAUL 1A6TA 4K9EH 4JZJC 3NFSH 4X5WB 4WWKD 3H7LA 4MD4B 3OBAA 4NC2B 2H3NA 3MGOA 3TYGL 5B39B 3HRPA 4PJ7B 3JTSA 1VDGA 3P30H 4R7NB 1S9KC 1F4XL 5DEFB 5IB1B 1DVFB 2XRAH 2HG5A 5SWZB 1U3ZA 1FVEB 2B8OT 1KTLB 2Z4QA 1TJIH 2G75A 2PO6C 3V5HA 5C0EB 3BN9D 3WBDA 3K4AA 1A4JA 1S9VA 4Y4KD 4E41E 3MLUH 2FYYB 3IFLL 5FHAH 4G80A 3R0NA 4XPFL 4FXGB 4PJXF 4RFEB 3HC0A 2X4OA 3AS1A 2F5AL 4QOKB 1XGQB 4ZYKB 1QSEA 1QRND 4XCCL 2ZUWA 4LP4A 3QJFB 1I8KA 1KN2L 1U8IA 2CLVB 3FQWA 5D7KD 4NHUB 3D85D 3B5TA 3MA7A 3OKMB 4BH8A 3FRUA 3IFNH 3U0TA 3HNSH 2JB6A 4IEFB 1IGML 5JPNB 4D9QE 1N5YL 3RL2B 1FZJB 1RZIB 1WFUA 3RDTD 4XPTH 3O8XC 4OZHA 2CK2A 3FFCB 4LPWA 4PS4H 3V6ZA 1TDQA 2P8PA 3DX8A 5LGJA 1A22B 5D2LB 2GITA 3C2AH 3VFWB 4Z7VE 4ZUWA 2SEBB 1KIQB 1W2KT 2LVCA 3BT2H 3LN5B 2IALA 3SGDI 3FZUD 3ZE2E 4U7SA 1I8IB 1U93A 2D0FA 1C12B 1E4KC 3NIFF 3CVHH 5HHVH 3IXTA 4Z7WE 4IIQB 3WO4B 4NPYA 2W91A 1G9MC 5EZIL 2X10A 5FKAB 3P4OB 3U82B 4GMSH 1A3RL 1EHNA 1C5DB 5CLWA 3IF1A 4HAFA 4XPGL 3G6JB 3NAAL 4L8DB 1X5JA 5L0QB 2FATL 2QKIB 3GMRB 3CNKA 5DQDH 5L2JA 4ODVH 5TPWL 3TA3D 3EHBC 4TVPL 4LHUG 2EXYD 5IBTH 3LIZL 4PJFF 4M48H 5ANME 3W39B 2MHAA 1KPRA 5IW1A 3OF6D 4XHQA 5ID0B 3ZYJA 2YHGA 3C6SB 1JZ4A 4NJ9H 3QEUA 3QWQB 4NKIL 3MYJA 5I19H 3H0TB 1B0RA 3TIDA 4HFUH 2DLFH 1MI5E 5E2WH 3D25A 3CD4A 1FFNB 1WT5A 4AM0B 4OUOA 3RWHB 2P45B 3Q1SL 4DN4L 2PYEE 5FHBH 3SDAD 3V6FA 3V4PH 4QGYA 4RAHA 4HK3N 3O45A 2XKNB 2QHLA 2HFEA 3IDNB 1T1XA 1NGPL 2QQNH 4OZGE 4DGYH 1FFOB 4LNRB 1NJ9B 5F7UA 1GJIA 4P0DA 3SHSA 3MV9A 1RHHA 3GMNA 3WS6A 1FGVL 2XTJB 3UTSB 1L9NA 5EFIB 4BQCA 4S1DD 3OXSB 4BJLA 3L7FA 2YZ8A 5D1XB 1WFOA 5B8CB 1M7DB 4GW1A 4NO3A 1AGEA 2FHCA 4I3RL 2ZCKL 3HS0A 3U7WL 3HI6H 2JELH 2CUMA 4TNWK 5CGYC 1MIEH 4YHIB 4JKKA 3PF2A 2P7TA 3PWUB 1FBIL 4RA0C 3X12A 4FQPA 4KK9C 5FV1L 4XBGB 4NYLA 5JA9A 2NXZB 4KAQL 5I76B 4FFZH 1IAMA 2UWEB 1P84K 1A9EB 5INDA 5GZNC 2XWJB 1OGAB 1D9KD 2Q3ZA 4M62L 3IDJB 4S1SL 4FQLH 5EOTA 5GRUL 3L9RB 3WXVL 3UTTB 1GGBL 4NO5B 3BPLB 7FABH 4P5KA 1VHPA 4MAYB 1EAPB 1QFPA 4KMQA 5MERA 1LP9B 4PYHA 3EGSB 3G04A 4U1JA 3V7AE 4PGCB 1PKQE 5ILTL 5LCVL 3N1MC 2J12B 3O4LA 3QA3B 2IAMA 2W9DL 2F5BL 3CFJB 5DUPH 4RGND 5CGMA 3ULUF 4I4WA 3TBTA 5I1JL 4R3SA 3VFMB 3RZCD 2HH0H 1JWSB 2OX5A 4WTWA 1ZKAA 1SJEA 5D1QA 4A6YA 5J6HA 3VJ6B 3CFCL 4KPHH 4PJXA 4ONFL 4F7EA 4NQSA 5C0JA 1ODAA 5HYSB 1I3RA 4PJ5B 3DNKA 5GRXG 2ATKA 1LEKA 3DWTA 5GRZA 1P6FA 3MOBH 4WENB 2B2XL 5E8NA 3SJVE 3FO1B 2O61A 1G7MA 2EKJA 5DUBA 1A3QA 1KELL 3QUYA 2NY0D 1T6VN 3WNOA 1M05B 1NAMH 1MRFH 1I3GL 3SGDH 4S1QL 2DM2A 4OD2B 2GEEA 2R2BB 3MRKB 3VCLB 3WIFB 4NOFA 4AT6A 1JWMA 3IU4L 1EEYB 3T2NL 2FJGA 4XVJH 6CGTA 3OHXB 1UXSB 1CZ8H 1ND0B 4YQXL 3MQIA 3VFSA 1GSMA 2F58H 3MV8D 1XZ0B 4KZDL 1F8TH 3QB7C 3DV4A 5DQJA 1NBYB 4PJEF 1YC7A 1HSBB 1KOAA 2A6JB 1XT5A 4P2QB 2VLRA 3U79A 3WHXB 1FH5L 1JV5A 1RIUL 3H9SD 4PJAB 1I3VA 2Y4SA 3CPLA 3CVIL 2YEZA 3K2UH 3BEVA 4KK8D 4JM2D 4X9GA 2GUOA 1DP0A 3F7RA 5ISZD 1UACL 4IRJC 1LE5B 5FCUL 4X6DB 3SKMA 1N2RB 1GH7A 3DX6B 5GXBB 3AU1B 2DLTA 5HHPB 4LEOA 2R4RH 5AEAA 4HMDA 4IOIB 3S5LA 2A38A 4U1KA 5CHNA 2DYPB 3TZVB 2RCSL 1WZMA 1AR1C 3VFNA 3UDWA 4YDLC 4PJCF 3VFVB 1J5OL 2CQVA 1EO8H 2A6KA 4N9OB 4OCXH 1EGJH 15C8L 1HZHH 5JIPA 1JNHB 4Z7QE 5DD5H 5DJXA 3RI5K 3TT1L 3VGEA 1MFCH 1A7NL 3SGEI 4APQB 1N64L 5HDOA 3QIUB 2E8YA 1CXKA 5GPRA 3E2HC 3QIWB 3SCMD 5FO9B 3OB8A 4Z0BH 3CXHK 4ZDHA 4X6EA 4HV8B 2ERJC 3WIIH 2B0SH 3NFNA 3HAEB 5BW7A 1AC0A 3O41B 4M9OA 1RZKH 1DTUA 1C1EH 1YEJL 1IJ9A 3ESVF 4LVOB 4JPWH 1QFOA 2IFFH 1EX0A 2C3VA 4NRXA 2ICWB 4R8WL 3L3DB 2IH1A 4QRQA 1ZEAH 1CDHA 2YKLH 4UIMA 3IJHB 5T1LD 1FO0H 1W0YT 5L9DL 3DV6B 4JKPH 4X5XB 5SWSB 4G6AD 5C1MB 4LPTA 1S7SB 5AAMA 3SDDB 1IEAA 1I1FA 5GZOD 1FG2A 4F80A 3B3IB 2Z31B 2R1WB 5D96B 3WSQH 3NN8B 4OZIA 1G6RB 1I7TA 5HYQA 1QPPA 5INCB 3P9LB 2AK4D 4HS8H 5GISL 2MPAL 4Z77B 1G7HB 1Q9LB 1YNLL 2GKIA 2HJFB 5IWLA 3RX5A 3GSVA 4L3CB 4JHWL 4N8PA 5DSCB 4JR9H 1RULL 2DJ4A 5FKPA 4YBLB 3HZYA 3SPVA 1EO5A 3F58L 5L88H 2MCPL 3BWUC 1UVQB 1G7QB 2ARJQ 1VGEH 2DQGH 3WUWA 1UADC 5CSGA 2VDKL 3BKCL 4K07A 1DVFD 4WW1B 5SWZD 1MAKA 5CZVH 3QNZB 3EW3B 1LD9B 1AD9A 1BQHB 5D1ZC 3EJYC 2HT3D 4BSVB 1HSAB 1TZGH 4LFHD 1UH4A 1B0GA 4G43A 4IOSD 5E08H 3VFOA 3PE9A 1U3HB 4L29B 2ZSWA 2X4RB 1ADQH 3KPLA 3QI9A 4XRCA 1MSPA 3LHPH 3S36X 3BP7A 1FYTA 4ZUVA 3MJ9H 3I50L 1S9YB 4QOKD 1Z0NA 4UI2A 2XIDA 2JJTC 4FTVE 4KKBD 5DD6B 5C3LD 5IMLA 3DIFB 5FYLH 4KQ4L 4NQEE 4NN7C 2R1XA 4KROC 3I85A 4HC1L 2FECL 5CP7A 5LGHL 2H45A 4Y4FB 3QDJE 3EOBA 1FE8H 2VDRL 2CRZA 5EZLA 1CVRA 1A3LL 4U6XB 1BFVL 2VKWA 5CJ8A 5FGBA 4PRIA 5F9OL 3IJSB 4J4PC 4E41B 4CNIB 2ZNXA 1T7YA 3BPNC 3CU1A 1QSFA 1CS6A 5DQ9A 5FYLD 3FFCD 4ZPVA 2EDQA 1OHQA 5LKNA 3G9AB 5TH2B 2M1KA 2NY3C 4DUXA 2AQ2A 4CDGC 4UT6L 2CD0A 2GJ6B 3HC4L 4ODWB 5I1GL 5JDJA 3CH1A 3F5WA 3IFPB 1XF2B 3U4BL 2ZNWA 4M6MH 1YEGL 3VFPA 2F53E 4UTBL 1LO0H 5M95B 5T5NG 1AXSA 2NZ9C 5GS0D 1CLYH 4OZFA 2X4PB 5L7XL 3RHWF 3NVQA 4JDVB 3MRMA 4ZG1A 1TFHA 1SJXA 3WIHL 4GSDH 1L0XA 4XWGH 3ZSTA 2OTWB 5GHWH 3ARGC 2EEDA 1QACA 4X6BA 3TCLB 3WEXB 4JZJB 5A2JH 3VRIA 5DDHB 4UU9B 5JA8B 1DBJH 3V8CA 2HT2C 3WV0A 3ULSB 3TCXA 2MQ3A 4LVNC 3LVEA 3DROB 1P6AB 5DD3H 2Z93A 3QUXA 2B1HL 4K94H 3OKEB 5F1NB 2C3XA 5DLMH 4Z7WB 3UTZB 2PO6B 5JUEL 3EYSH 4M6NL 4ISVB 5DVMA 2YPLA 1DJSA 4LLVB 3HPJB 4LSQH 1QFWM 1BX2B 1NQBA 2BX5A 4RGOH 4G9DB 4ZD3L 2VC2H 3K4DA 4FQ2L 4CGTA 2EDHA 1DEDA 5J8OA 3OKYA 4V2CB 1MCWW 1U92B 5CEXA 1YY8A 4HXBH 4EJ1C 3QO0B 1RZJL 1CLOL 5B4MC 2J4WL 4IMKC 3MRBA 4G9FE 5C0CB 2XTJD 3UTSD 4K3JH 1HXYB 1WTLA 4D3CL 4MMZC 3L5WB 3HA0A 5BO1H 1P7QD 3THMH 2VQTA 5D1XD 2P24A 2D03H 3HC3L 5E00B 3BP4B 3DURA 1ZMYA 2UYLA 4YXHL 3IXAA 1YMHB 3O3EA 3OPZL 5E8DH 1BLNA 4DKEL 3BN3B 4AQOA 5KSVB 2PYEB 1WVZA 4L4VA 3RWFA 4ZO7A 5GGVH 2NY7L 5CKGA 1TZHB 2C3GA 2YD1A 4BK4A 5EUOF 4YHLL 3AM8A 5FYJL 5MEPA 3S37L 4XTRC 4HG4J 2J8UF 1MUJA 1D6VL 5C08A 4AK1A 2NXZD 4OZGB 3IFOA 1A1MB 1JCKA 4NQVB 1MRCL 4XP1H 1IKNC 2AK1L 2EKSA 4MQ7B 4QEGA 5C7XL 1OGAD 4FQJH 4LASH 3N9GL 4G7YH 3VXRA 1XH3B 3UTTD 4YXLH 1NAKL 4L3EA 2ADFH 5E94B 3JV4A 3UTPD 2YN5A 4MAYD 3WO3B 4F7PB 5FDWA 4GAGH 5HPMB 5F7DA 3E8UL 4MNHB 1EDQA 2X6MA 3IDGB 4PY8I 4GXVH 4PG2C 4WWKA 5FDYA 4E0RB 4FG6C 3T0EE 4OFPA 1H3VA 2FNBA 3MLYL 1TETH 1QVOA 3MNZA 2ZKHH 4UNUA 3ARQA 4RISH 4I18A 4Q58C 1NMBL 2BERA 4LKXA 2BOBA 2V9QA 1INQA 1N0LA 2HKFL 1T1YB 4N0YL 3MPCA 4PJ5D 1L7TH 1UH3A 2CLZA 3QHZH 4HT1L 4PB0L 4HPYL 1F45A 2BHYA 4EDXA 4BZ2L 2XWBB 3ZDYF 5KANG 3LV3B 2DWDA 4Z7NF 3AS3A 5IVZB 4WW2A 2WBJC 1SHMA 2H41A 4EUPA 3EFDL 2NY2C 2ZUSA 1PKQB 5CEZL 5B38G 3MBEA 1T66D 1HHKB 4PG9B 2C1PB 1J1OL 5KVFL 2ADGB 1D5XB 3CDGB 5J1AA 4X8XA 3PGFL 4MA3A 4O51B 2AQ1A 3N85H 1NDMA 3TN0C 4YZFF 1DQLH 5K9QI 2FBJL 1FHGA 2R2CA 4MVBC 5JPMA 4N1CA 3IKCA 1JTTA 1RZJC 1RI8A 4PD4J 2VLLA 2HAZA 3WFDH 5A1AA 2FD6L 5IVNA 3RDTA 4AEIH 5DJZA 4S2SA 1AY1H 2VXUL 3WD5H 4F3FB 1UZ8B 3BE1L 4PJGE 5I1HH 4XI5C 4P2QD 3KPQA 3EOTL 5I1IL 5AZEL 1RUPL 2HJLB 1U8LA 4M7KL 2QBWA 1YYML 1G7JA 1QA9B 4TOYL 3CK0H 5IVOA 1I85A 4QNPE 4NUGH 4QF1B 1SBSL 5SV3A 3QULA 4ZOEA 4FNLL 5IQ7H 2QHRL 1OAKL 1CICA 4NQUA 5J11C 4RAUA 4PREB 3WLWC 3JXAA 2EYSB 1Q0XL 2F15A 3IGAA 4RGMC 2W1NA 1KT2B 1BD2E 5MEQB 2DYPD 3TZVD 1MRDL 1V7NL 1GAFL 1GIGL 2B1AL 3HAEH 3MJ8B 1JGDA 4OGXL 4X7SL 1AXTL 3M1BB 5DUML 4F37F 1EVUA 3BH9B 2OR7A 3WS3A 1A6WL 1URLA 4FQQA 2BMKB 4QXGL 3WFHA 1H3PL 4P57A 3OF6A 5B3JF 4XP5H 3FQTA 4TSAL 3MV11 3MLXH 3QIUD 3MOAL 3QIWD 4LPYA 3GJFB 2DMBA 1EFXA 5EORH 4DCQB 3HPLA 5ICYB 4ODSL 4UDUA 1S7TA 4JVUA 1TJGH 4B7LA 3WNMA 3W2DL 3MXWH 1NGWB 1NUGA 4H0HB 1B4JH 3MUJA 3BGFC 3SDAA 2OJEB 1ZA3A 1HDMA 1G6RH 1YN6A 2IPTH 3CX2A 3LRGA 2BNRE 2YWYA 1E6OH 4OGAD 3RX8A 2BVQA 2X70A 1U8QA 3BUYA 5DJ8B 4ZOBA 3DGCR 3WNKA 3PL6C 5SWSD 4YHOH 1BQUA 2EIZA 5C6TH 5TE6L 3SDDD 3VXMA 3TV3H 4D0CB 1MWAL 4Z7OE 4R97C 3DXAE 2YXMA 1T1WB 4O4YH 2ZG1A 1OSPL 1N6QL 1T3FB 4MZ2A 5DTFA 1XGPA 1MCOL 4KUZL 5C09A 4UQ2A 3L3OA 1LO5A 4MYWB 1PSKH 3VWKA 4MJ5B 5FO8B 3NA9L 4HKBA 4YPGB 3VI3E 1P2CB 1AGDB 4P5TD 1A0QL 2CIKA 5DZLA 2VJXA 4LCYB 5SX5K 3MFGB 1GGCL 3GI8L 4G5ZH 3DYMA 1PZUB 1Q38A 3KXFA 1DE4A 5D2NC 1U2HA 1VGKA 1SEQH 5DMIH 3TJEH 1GL4B 3C5SA 1Q9OB 1R3JA 3R06B 3O2VL 3WYRA 5C07B 1D9KA 1IAKA 1H3TA 3L7EB 4D0DB 4IRJB 5TFSL 1F11A 1KB5A 3C6LC 2XG4A 2Z9TA 4BFGA 2V6HA 4WFEE 2HKHH 1ZA6B 4DAGH 3PHOA 1AKJA 3O11B 4YUEH 5GIRB 1YPZF 2ZZUT 1AO7A 1U3HD 2OL3A 4JO4H 1Q9WB 3TIEA 3HUJA 1FZKB 1RIVH 1OAYH 2WIMA 4JZNA 2QLVB 1DLHA 1W8OA 4YDLB 1WFNA 2PXYC 1U6AH 4FFVD 4OCRH 1CFVH 2EE6A 4YX2H 4WFHE 2EDWA 4R90L 1RZ8A 4JPVH 5F7YC 1BJMA 4LCUB 2YRZA 4TQEH 4JAMA 1TTFA 4Y4FD 3KNBA 2A2QT 4H8WC 4M61A 1O5DT 3CFDA 3E2HB 4TULH 1IARB 3UAJD 3CFKB 1MH5B 2Y07L 3J8F7 3RWGB 5CEZE 4K7PH 2ERJB 1S9XB 4WCYL 3UXFA 4E41D 3BEWB 3GSUB 3PWPE 5CD3A 3KYNA 5JDSB 3BDYH 5CIPB 3D1MC 2WM0A 1NEZG 5DEGA 1S8DB 5AD0A 2J6EL 3MLSL 4TTDD 4PJBE 2VXVH 2VISB 1RVFL 4WO4D 1YNTA 4FTVB 1MEXH 3QZWG 1N59B 1NSNH 3KPTA 1YY9D 4NQEB 5DD0L 3BHBB 5D93C 1NDGA 4HUUB 1KENL 4QRPE 4Q9QL 5T1DL 1CFSB 4E42A 2HFFA 4I77H 3TBWB 4X6FA 4EI5C 1SEBB 4YBQC 5IHZB 5EIIB 4LAQL 1KFAH 2ATPA 3P2TA 4MAUH 3MV8A 3EYUL 1NGQH 5DD1H 4HX1B 4M3JA 5IW6B 4D94A 3ESUF 1GZPB 1R3IL 4D9QD 2IANE 5JMRA 2XQYG 4OAWB 4AEHH 3CC5A 4X6CF 3UPCA 3H9SA 1OAUH 4FXLA 3WFBL 1S5IH 5KN5A 3MCLH 4JM2A 5C0AA 4JDTL 1WAAE 5ISZA 5F88A 4TTGA 4QTIH 3D6GA 3H3PH 2HFTA 1MCDA 2XA8H 3U36B 1NCCH 2PO6D 4X4ZA 4ZO9A 5D1ZB 1PFCA 4LLYB 4PY7A 2VLJE 2DS4A 5C70A 1NGYA 2EXWC 4LLWB 2EDRA 4M1DL 2GFBA 3BKMH 1OT1A 3P0GB 1UCTA 2FX8H 3LEVL 5KSBF 5D8JL 1E4WL 5F9JB 2WINA 5BRZA 2I5YL 2C26A 4LLUA 3BJLA 1CFTA 5I74C 3PUCA 3KPSB 4GKZA 4LHQB 1GZQB 4NN7B 5C0CD 2VKXA 3FB7B 1TJHH 4KROB 5L8LB 2DQFB 2VDQH 3DSFL 5D7LE 3VMPA 1LVEA 5CEYA 3SCMA 3M17B 1WV7T 4NM4H 4YHPA 1T21B 2CKNA 3OZ9H 3TT3H 3TH2T 2UY7A 1S7RB 4YHMH 2H6PB 4LL9A 1A6VH 5BVPH 4ZPTB 5GRVK 3MGTA 4EQ3A 2CJUL 4U6VL 3BPNB 1G9MH 1WCBA 2PYED 3I6KB 3B9VA 1ZGLB 1R3KB 3TYFB 3O8XD 3PG2A 1NGXB 4RWHA 3BAEL 4Z78A 5T1LA 2NY3B 1GYAA 1LDSA 1OAXL 4BKLB 1F3JA 5F3BB 2ZCHH 3PWNB 1BZ9B 4OLZH 2JCCF 4OKVA 1AFVL 1KG0B 4Y5XC 3TO2A 4MXWL 1ZSDA 4O58H 2G2RA 3MGAA 3MFFA 3K74B 3T65A 3RVUC 2Y1VA 1F6AB 5E2UH 1DR9A 2LU7A 3EKCA 1ETZA 1WBYB 1NCNA 4JQXA 4GG6A 3GSRB 1J05A 3ARGB 3M8OL 2VSDA 2OTUB 4S1RH 4X5WA 5GJTH 2RAMA 3TYGH 2I24N 4ENEC 3EHBD 3LKQA 4PV8B 3KYKL 4PJ7A 4Q0XH 2CLRB 1ZHLB 1MCWM 4R7NA 3KGRA 3WNLA 3KS0J 5DEFA 5KG9B 4LVNB 4H20L 4MA8L 3HG1E 1DVFA 4U6YA 1RZ7L 5SWZA 2W0PA 3VE0B 1FVEA 1KTLA 5EU4B 5ITFB 5C0EA 1QNZL 4D8PB 4DOHE 4I2XE 1RJYB 3AS0A 3IFLH 3QFJE 2D31B 1XGYL 2RHEA 3CGTA 3BVNB 1T22B 2RR3A 2WQ8A 3ZTJG 3DTXB 4FXGA 5CSZB 4JLRB 3RJDA 1HEZB 4QOKA 1XGQA 1L6XA 4XCCH 3UTQA 1A6PA 2VZ1A 4F33B 1TIUA 4QTHB 3UCRA 3QJFA 3KS0H 1ZT7B 2CLVA 1UM6L 4LLDA 1MHEB 5D5MF 1MVFA 4G3YL 4NHUA 3B2VL 3OKMA 2P43B 1MQKH 2F19H 1K5NA 1ADQA 5HPOA 1N5YH 5T3XL 1KEGL 1XGUB 4UNVA 1ZHBB 4J23A 3OJDA 4J6RL 5KS9B 1FZJA 1RZIA 1BOGB 3GMLB 3D39B 5CGYD 3BISA 1H5BC 3SDXB 5D2LA 4ELMF 4J3TA 4YIQB 1HWHB 4LRNL 1SVCP 2SEBA 3VDAA 3WJLA 3LB6C 4KK9D 3CSYB 3PGCA 2HTKC 4PRBA 1PYWB 5C3TA 3IDXL 2XN9B 1XF1A 5EULV 4G6KL 1I8IA 4Y1AA 3M45A 3JWDH 4P2CG 1H0DA 5EZIH 2VZ3A 5GZND 2LU4A 1KJ2H 3W11C 1A3RH 2LFGA 5FKAA 2A6IA 3P4OA 4WTXA 4LU5L 1K8IB 1QSEE 3FO9B 1C5DA 5EC1B 3NAAH 3K4ZA 3G6JA 2K7PA 4MS8C 3F6LA 2QKIA 3GJFH 3GMRA 3RU8H 2H26B 3V6OA 4MB4A 1K3ZA 5I18L 2DD8L 4ZFGH 3DYPA 5ALCL 1PG7H 1OLLA 1VPOH 2EE3A 2VL5B 4HGKC 5DK0A 3ARSA 3BIKB 4MHHG 3BYYA 1WT5C 2ARJB 3B9KB 3BP5B 4OV6F 3P4LA 1E27B 3ARDA 1F4YL 1QUNA 4Y2OA 4FQ1H 4NKIH 1JZ6A 5HGBA 1HK6A 3FOMB 4WIQA 1FL5B 5ACMA 2ADJB 4UT9L 2MKWA 4OZHE 1CWVA 2BJML 1G84A 4AEFA 5IUSA 4TVPD 3MNVB 5BXFA 1A1OB 2BNUB 2AKRA 4HHAA 3MRGB 4X80L 1DQDH 4WI2A 5HYFA 3UBXG 5I71C 2X4SB 5C0GB 4HLJA 4O2FB 3LQZB 4KDTA 4CDHA 2F8XC 4OD1H 5ETUA 2XKNA 2WBJB 4IOFC 5H94A 4OQTL 1M1SA 2DKSA 1F5WA 5EU5A 2NY2B 3ARWA 4ZUUA 3P4MB 4L8CA 1P4IL 2OQJA 4KKCC 2VDOL 4KTDH 4NDMB 1FFOA 3DX9A 5TDOB 2BK8A 5BZDA 1QBAA 1BZQK 5D7JA 1BQLH 5M7QA 1HKLL 2BRQA 3OXSA 4NQDB 5F6HJ 5D1XA 1UB5B 3EUUA 5B8CA 4OI9A 2ZCKH 3S4SG 4KY1H 1HCVA 1QR1B 3TN0B 1JN6B 5ENWB 3D18A 3RVTC 1RY7B 1X3DA 1BGXH 3MTRA 5DHVB 4Z6AT 1DQJA 5EO9B 1C5CH 1FBIH 1TCRB 4G8GB 3VXTA 4YHIA 3V0VB 1CLZH 5E4IA 3RWDA 3FCTB 1KGCE 1U36A 2BNRB 4LLQB 4MX7B 4XBGA 3OKLA 5J13C 2V5SA 5I76A 3T1WA 1BBDL 2EECA 2UWEA 1A7QL 1TQCC 2COQA 2OR9H 4QRSB 4M62H 3HKFA 4S1SH 5C07D 2FGWL 1OGAA 5GRUH 3IDJA 1T83A 3WXVH 4IRJD 3MRLB 2YD5A 1GGBH 2F8OA 1A6UH 3UTTA 1F58H 3NCEB 2EIEA 3QEQA 4P46C 5CBEA 4NO5A 5ESVB 5HHMB 4MAYA 1EAPA 4P3CH 5D1QC 5J11B 3VFTB 3EGSA 5KVGL 3MV9E 2NZIA 3QFDB 5I1DB 4RGMB 1RU9L 4PGCA 4OLXL 2W9DH 4L5FL 1GC1L 1HXMB 1AR1D 3V52L 3U6RA 3CFJA 4IBLT 1OWRM 4NRYB 5FXCH 3VFMA 1IE5A 2AJYH 4HWZB 5CIPH 1JWSA 5JXEA 1BJ1H 2X4NB 3HRZB 3OR7B 5AWNL 2UUDK 5E2VH 4WHDA 4EXKA 1H8NA 2CKBL 3T77A 5HYSA 3QEGH 2YK1H 1KN4L 2W07A 4WTZG 4WDIB 2MQCA 3O2DL 2AJVH 4LMQE 4BZ1H 1AE6L 35C8H 1REIA 4WHYG 3KPMB 2WK2A 2B2XH 5HDQH 4CW1B 3CZJA 5KZCB 3SQBA 1CD0A 3BGFB 3FO1A 1X5XA 3FT3A 3P0VL 2NMSA 4TRPL 1O7VA 3I3EA 1L4IA 4HJJH 3OKOA 3HZVA 1IL1A 2ED8A 5FGCB 4NZRL 3MRKA 3T0XA 4FTVD 2P8MB 1Z9SA 3VCLA 5T3XE 1UZ6E 3PL6B 1EEYA 3ZHLA 4XPBL 4NQED 2A1WH 1NL0H 2PR4H 3D3VA 2FECI 1ACZA 4R97B 3ZYZA 4OBRA 4YQXH 3OHXA 2XFXA 1UXSA 1ND0A 3O4LE 1JGUH 5J1TC 5ALBH 4HK0B 4JO2H 2VLKA 1XF5A 4N0CC 4P2OA 4HGMA 3LKRB 4KVNL 1E4XL 1NBYA 4KHXL 2Z8VC 1HSBA 4PJXE 1Z0MA 3PWPB 1GXEA 2X1OA 1FCCA 4A2MA 3HZKB 2A6JA 2VLME 1FH5H 3MRDB 4P2QA 2YSSB 1ROWA 3BZDA 5CGTA 4PJIA 1FCGA 3C09C 3KJ4C 5D2NB 3KWWB 3GIVA 1UACH 3QUZA 2KL6A 4M5YH 2IMNA 2APWA 5HHXH 5C0RL 3OX8A 2JIXB 2GJZB 4HBCH 4HXAL 2ITCA 4HWEL 1N2RA 3QG7L 3DX6A 4F8QA 5DJDB 5D1ZD 3EJYD 4JFOB 5D7IA 5CJQH 1INDL 3C6LB 4QY8B 5HHPA 3C2SA 5K9OA 1F6LL 1AP2B 1NEUA 3UZEA 4IOIA 1BVKB 5F1IB 2RCSH 3D0VA 3RA7L 3V7MA 3RP1A 1J5OH 4QHLB 3VFVA 2RGSA 4HQQL 4YAQB 4JEGB 4Y16A 5EZOL 4XBEL 2UZYB 1X4XA 1IC7L 3MODL 1JNHA 5E0QA 1NCAL 1MJJB 4JFFB 3V2AR 1WZ1L 3MNWB 3EFFB 4APQA 5HGGS 2IADB 4KROD 4XCFH 4P3WA 4QRUA 4ONOA 3GHBL 3QIWA 1U91B 5FO9A 1DBBL 3HMXL 4X7TB 2VLRE 3DGGA 4HV8A 3VMOA 5HI5C 3ULVF 3D9AL 3O41A 5MENB 1YEJH 4B0MM 2OCFD 4J4PD 2L4OA 3PABA 3S35L 1NFDB 2VLJB 4NFBA 4N8CL 1U3JA 2XZCL 4YE4L 4OKDA 2ICWA 4XNZC 3L3DA 1VACA 2H2SC 2IPKB 1SMAA 4JREC 5F89A 1JFQL 1LDPH 2NY3D 2HN7B 4LSRL 5SWSA 3T0WA 3JV5A 2VXTL 3SDDA 1RURH 1FNLA 1IGFL 4U1IB 5IWLC 2IG2L 2XZAH 5D93B 2Z31A 2NZ9D 2R1WA 5D7LB 3NGBC 2EYTB 4OCWH 4EI5B 1G6RA 3AREC 2MOVA 5INCA 5GISH 3O81A 5F70A 3QXAA 1XR8B 1P4LA 4Z77A 1G7HA 3KLSA 4UTAL 5ACZB 3GJFK 1J1PH 4K3EL 3ARGD 1TVDA 2Y36L 4L3CA 5E6YA 1MWAB 4KHTH 4U2ZA 5DSCA 3V8OA 1T89C 1D3CA 2MCPH 1N4XH 2W0LA 1IAIM 3ULUC 3EYVB 1UVQA 2CGRL 4JDZB 2WWMC 3STLA 1T0NB 5IB2B 2OLDA 2HT2D 2VDKH 5AUMB 1UKQA 4OGYH 3MRIB 3LS5L 4WW1A 2HLAA 1MVUB 3QPXL 3UROR 4IMLA 4POYA 3WFEL 2OM5A 1WF5A 4JFPB 4C54A 3UJTL 1OB1A 5HYJB 1LO2L 1WZKA 3GK8L 3DUHA 2CIIB 1U3HA 4L29A 1KCRH 1PZ5B 5C0IB 3DUSB 2A77L 5DMJB 3MXVL 4MSWA 4OZIE 5DD6A 3VGAB 3HZMB 3CCHB 3DIFA 2NW2B 4WHTB 1AJ7L 2Z8WC 4EVNB 5K93A 3H7BB 3VFGH 5A2FA 1MJ7H 5B4MD 5I74B 2DI7A 2W65A 3HG1B 2GSIB 2J88H 2Q86A 2GTWA 3Q6FA 3MRHA 1K4CB 5F9OH 1KYOJ 4JFEB 3C5JB 1MY7A 4KI5F 3NOIA 4WY7H 3IJSA 5KTEL 4I2XB 2A6DB 4GRWE 4OV5A 2BXZA 2YPKB 3C5ZC 3L3GA 4OLWL 1EJOL 1MFEL 1EA9C 4HKXB 1UT9A 4UT6H 4PRDB 3ULUE 2GJ6A 3V5DB 4XTRD 5IHBA 3IFPA 1ED3A 1XF2A 2YOCA 4JPKL 1RUQH 4R6UA 1QBMH 4C57C 2XN9D 1C5BH 3K8KA 5I8EA 4Q9BA 2X4PA 2CR6A 1FYTE 4F7MB 4XPAL 4Y5XB 2P44B 1HINL 5EA0L 4CN1A 2QSCH 4UQ3B 3KYMA 7CGTA 2OTWA 5B21A 3JTSB 4DN3H 4HCRL 3LPGA 5EBMB 1LMKA 3FN0L 1AIFA 3TCLA 3QUXC 3WEXA 5DJ2A 3DPBA 4JZJA 1JHKL 2HG5B 2C1OA 4CMMA 4M9PA 4G7VH 4FG6D 4P23A 2G75B 1VADB 4PRIE 2O26U 1A4JB 1CIUA 4OJFL 2B1HH 1QSFE 4HUMB 3B8SA 3OKEA 5F1NA 3L95B 5JUEH 4M6NH 4KVCH 4CVZB 2B4CC 3UTZA 4GQ9L 2CUIA 4ISVA 4LLVA 3WUZA 3HPJA 4ORGB 4FZEH 1JPTH 4N1HB 3TC9A 3T4AA 5FV2A 4FQ2H 4G9DA 2VB5A 5IB4B 2ESVB 3PWLA 3ZT6A 3ROOB 4ERSL 3U1SH 1U8IB 1KULA 4PTUB 2WBJD 3INUL 5EBGA 1U92A 3TH3T 2NY2D 3MA7B 5HDBE 3O9WC 1CLOH 5ESQB 3FRUB 5HVGB 5DHVH 3U0TB 1R5IB 1HHHA 5B38B 2JB6B 5IR1B 1CF8L 3MRFB 4HIXL 4UV4H 1I1AC 5C0CA 1HXYA 3GMQB 4ZS6C 4AH2B 4OZHB 3DBXB 4NQDD 5B22A 5E6IC 3V6ZB 3PXHA 2P8PB 3A6BL 3AM8C 3RIFF 5E00A 3N50A 4YXHH 3DVGA 4TUKL 1I75A 2W0FB 3TN0D 1YMHA 2OK0H 1TVHA 4MVBD 2HT4C 5HYEA 5KJRL 2IALB 2NY7H 1U93B 2EDBA 1TZHA 3IXTB 5AG8A 1H5BB 1D6VH 1CGTA 4JN1L 4NPYB 2BNRD 4XI5D 4NIKB 2G5RA 2YPLE 2P42B 2EZ0C 1G6VK 4FP8L 3IF1B 4NQVA 1KXQE 5FA4B 1NFKA 5L2JB 1E4KA 1UWGL 3S96A 1I3UA 5FYJD 3PP4L 5E94A 1KACB 4I18C 4F7PA 5AYUL 3WLWD 5HPMA 1RIHL 4MNHA 4F7CA 3MLRH 2DDQL 3MLYH 4E0RA 4LGSB 1PY4A 4GS7C 5I1KH 1B0RB 4QXUH 4DEPC 4X4XB 2LABA 1AGCB 3O3UN 1W72L 4ODTL 4KKAC 4C83B 3V6FB 4L4VE 5L8JB 1Q72L 3OMZA 1OSZB 1YYLL 4F9PA 3F12A 5KVMC 3CAFA 4HPYH 3MBEC 1T1XB 3IETB 3NMEA 5C08E 4K23H 1HYRC 5DA0B 5EBWB 3MBXL 3O6LL 5KZCD 1CR9H 3R1GL 3SDYL 4Y89A 1RHHB 3GMNB 5I71B 3EFDH 3HTLX 1FRGH 4MXVE 3UC0L 1J9CT 5CEZH 3JVGC 3K0WA 4NOBA 3VXRE 5DC0A 4WEUD 3GI9L 3MMEA 4L3EE 1HHKA 3ZL4L 4NO3B 1AGEB 4NWUH 2C1PA 3A67L 3PL6D 3HS0B 4W81A 4WFHD 4OM1L 3LKPB 2ADGA 1D5XA 3CDGA 1N8ZB 3NACL 2DQJL 4WJ5A 4O51A 3BP6B 1DLFL 3F65A 2FBJH 2P7TB 3X12B 3DHJA 5CEZD 2FD6H 4RWYL 1UKTA 2NR6C 2X44D 3PWPD 3U0WH 1KPUA 2VDNL 1KIUA 2J7LA 4WFGD 1UZ8A 2VXQH 1MIML 1RUPH 5J4MA 4S10A 2HJLA 3S36H 4AEEA 5EU3B 4LSDA 1CICC 2FHFA 2YWZA 4DJMA 2VAAA 3NZHL 4JY6B 1QA9A 5K33A 1YN7A 3L5JA 5J13B 1SBSH 1A7OH 2VRAA 5MERB 4QF1A 1P4BH 1TQCB 3C87A 2JIXD 4QRPD 2BOCA 4XXCC 1JTOA 5I9QC 1OAKH 5IFHL 4Z7UF 1OWWA 3D87B 4U1MB 3MRJB 2WIIB 3C6LD 4F9LA 4P46B 1MFDH 4I4WB 1G7LB 3TBTB 1MREH 2EYSA 1MCEA 2ZUUA 4NGHL 4H8WH 5D1QB 3BZ4A 4A6YB 1H8SA 3BKYH 4X7SH 5MEQA 4OGXH 1AXTH 3MUY1 2ZUXA 4NKMB 4PJXB 4F7EB 4NQSB 1CE1H 3RWIA 3M1BA 1I8LC 1I3RB 4M43H 1H3PH 2HWZL 3GJEB 1S9WA 3KDMA 3FT4B 2PXYD 3CMGA 2BMKA 2E7MA 4XB8A 1BZ7B 2HJKB 3EO0B 2QR0A 4JFFD 4IDJL 2ATKB 4ZFZB 1F00I 3RY5A 1OD9A 3TESA 4DKFH 3MOAH 4PUBL 2PW2A 4PJHF 2CMRL 3REVB 1IGIL 2X1WL 5AYQA 5E8NB 1A7RL 3GJFA 4OZ4A 5IOPA 1ZV5A 5MEND 1X6LA 1NGWA 3ZDZF 5CKAA 12E8L 1NLBL 1JPSL 2F54B 2OJEA 2VLJD 2ORBL 3A6CH 2ZG2A 1JWMB 4IM8A 4KRNA 3O6KL 3U48A 4KTEL 1JYVA 2FJGB 4TUOB 1DSFL 3BMVA 4U0QB 3FTGB 1I1CA 4KV5F 3VFSB 1MWAH 1X5AA 4KMLB 4Y7MA 4CAGA 3QZWB 4D0CA 4IHOA 3TJHC 3DV4B 1RUKH 1OSPH 4XNXL 1T1WA 4WUKH 5DI8B 1RMFL 1T3FA 5D7LD 1A47A 4EI5D 2FZ3B 2X89A 5FA3B 4YBQD 1KYOK 1Q94A 3NA9H 1JV5B 2IWGA 4HF5H 4MJ5A 5FO8A 1YEEL 4LCIL 2WWKO 1A0QH 1P2CA 2ZOLB 4GOSA 4EOWH 5GS2H 3BEVB 4LCYA 3GI8H 1EEUA 1G0YR 1KCSH 1YEKL 4NP4L 1CN4A 5F7WC 2DQIL 4JB9L 3RVVC 4C4KT 1K6QL 3C09B 3KJ4B 1ZTXL 4U33A 4Y5VA 3O2VH 5TJWK 3R06A 5DJCB 3FQNB 4LEOB 2Y72A 4D9LL 1U8HB 5C07A 3S5LB 4U1KB 5CHNB 1IT9H 4IRJA 5GS3A 2FB4L 4CUCA 5GS2D 5CMAA 2A6KB 1MLBA 1IBGL 2DJSA 5HYJD 5LGKA 2R0KH 5GIRA 3VXME 1RFDL 4O9HL 2GAZB 5HVWA 2EXWD 4KRLB 4NN5C 1Q9WA 2MKLC 3NH7H 2QQKH 5JNYA 5DVKA 3B2UC 1GOHA 5CJOH 4YFLF 4F57H 5C09E 4X6EB 5E1AA 1Z9MA 1FAKT 3GHEL 3NFNB 4HIHB 5L2KA 4LCUA 2VDLL 4RMSA 1MHPL 3HG1D 4P3DA 4Y4HA 5EO0B 5DS8B 2ITDB 3CFKA 3WLBB 5J06A 3KXFE 4JFED 4DVBB 1ORSB 2IH1B 3RQ3A 1S9XA 1IC5L 4MQTB 4UIMB 3GIZL 1DCLA 3BEWA 2BZDA 1AC6A 1JNNH 4HUWB 2NYYD 2EDEA 5JDSA 2ILLA 3SOBL 3MLSH 1I1FB 2VR4A 2G60H 3HE6A 4M7LL 4OD3H 1JYWA 3OGOE 1PVHA 2AW2A 1ITBB 4XNZB 4JREB 3EZ8A 3EYFB 1YEDA 2UVFA 4OZIB 4OTXH 1N59A 4KMTL 4Q9QH 3TBSB 5T1DH 1AO7E 1V3JA 4HUUA 4JG0L 3LEYH 1CFSA 5IQ9B 3BGMB 4JZOB 4KK5C 1U95A 3HUJE 2NXYC 3GSVB 1YEFH 1FNSL 1KLUA 1GPOL 3EYUH 5AZ2L 4E9LA 5FKPB 3NGBB 4RGNE 1FLRL 1NANI 4HX1A 3SPVB 3AREB 3PGDA 1R3IH 3RVUD 5IW6A 2Y7QB 1GZPA 4ZXBA 3VDBA 3WUWB 3ARRA 1M7IB 2R56L 3BRGC 4UT7L 4RMVA 3H2WA 1LWRA 4Z7UA 2D9QB 4ENED 1AD9B 2FX9H 5EOQL 3QUML 3U2SA 3ZDXE 5DJYA 2NTFB 1QHOA 2FGZA 2HVJA 2VXSL 1KIPB 4LSVL 4OLEA 1SY6L 4G43B 2MCG1 5DFVC 1SJHA 4L8BB 3KPLB 3U36A 4GMTL 4DQOL 4S0SD 3BP7B 5D1ZA 1KIRA 3FB5A 4M6OH 5C0DA 2P5WA 3GKWL 2R29L 4NT6A 4U1GC 4LLWA 4S0TD 4KFZC 2ZUTA 5C2BH 5FUCC 4XCEB 2ESVD 5IVXA 5H2BB 1SMOA 2K7QA 5IGXL 4O5LL 3OKDB 3TNNB 3IAQA 3SQOH 5GGQL 2I5YH 4LGPB 5EZLB 5F9JA 4M1GL 4Z8FL 1JI2A 3MV8E 1D5ZB 4PRIB 4I8DA 5FO7B 3TEUA 4JJHA 3KPSA 3DSFH 1GZQA 3SO5A 5BV7C 1ITCA 2DQFA 4U31A 1QSFB 1CD1B 3M17A 4MZ3A 4PRHB 4AENB 5JHLL 1T21A 1IC4H 3H9SE 3L5XL 2H6PA 3KPPA 2DQTH 2CJUH 4BK5A 4J4PA 4ZPTA 2NY5C 5IJVA 4PLOB 1QSVA 5C0AE 4XX1G 5ISZE 3C5ZB 4FFYL 3EYQC 1ZGLA 1R3KA 3TYFA 4IS6A 1VFOA 4OZFB 1MJUL 5TQ0L 5CCKL 3MRMB 3LB6D 3MSPA 5C0NC 1FFQA 2YRLA 2HTKD 4BKLA 3T04D 4FHBD 3PWJA 1AFVH 1T0PB 3PWNA 1BZ9A 4QXTA 2A9MH 4X6BB 1JPFB 3LS4L 5T1MA 3T3PE 3BD3A 3O4OC 4LVHC 3W11D 1ACYH 1F02I 5BRZE 3IJYA 5K59E 4YWGH 3QQ3A 4HWNA 4NM8L 1LP9F 3QCUH 2V5MA 3EO9L 1X5GA 4MS8D 3GSRA 3ARGA 5FUCE 2NY1C 4EDWL 2V7HA 2Z93B 3QUXB 3HFML 4ETYA 2V2WB 4ODHH 5LBSH 4JGMA 4LHUA 3SE9L 2BFVL 2CLRA 2VIRA 1ZHLA 4POZC 1KGCD 2K1MA 1G1CA 1QLRA 4HWBL 2R69L 2YPLB 1CFNA 2DTSA 5LWYL 1FN4B 1X44A 1EMTL 1FG9C 3VE0A 1CDYA 5F71A 5EU4A 1CL7L 5ITFA 4ONHB 3OKNA 3C08L 5CINL 5KOVC 4D8PA 2IF7A 3RIAK 1ZVHA 2YUZA 2YMXL 4JFDB 4M02A 4OCLC 3BVNA 2FJFB 1F97A 3DTXA 3MRBB 2AJSL 1ZAGA 4RSVA 3UO1L 1IFHL 1ZT1B 2FRGP 3UBXB 3LOWA 4IOFD 3X14B 2D7PA 4GFTB 4LLMB 4F33A 3DRTA 4QTHA 3O9WB 3P73B 4KKCD 1CQYA 1UM6H 3O3EB 4GG6E 4IMKA 1FNGB 1ZT7A 5D72L 4G3YH 1B6UA 1I1AB 1MHEA 5J0BA 2Z0BA 3GSQA 4L4VB 3OKKB 1G7PA 5DRXA 5DJ6A 2HLFC 2K9UA 3HCVA 5E6IB 5T3XH 3WJLC 3ARYA 5MEPB 1DQMH 3FB6A 3DLQR 1OCWL 1XGUA 3TLRA 1CFQA 1C7TA 1YEHH 1ZHBA 5KS9A 3RVTD 1F4WH 1JZ8A 4EKXA 4PTTA 1HIMH 2C4FU 4WNQB 2FEEL 5SWZE 4K7FA 4PGDB 3D39A 4HC1A 2BSRA 5KAQF 3SDXA 4LRNH 2DMKA 3H42H 2OZ4L 4L4TB 2X9YA 5KVDH 4L1DA 3ZTNL 3VXRB 3CSYA 4A6YH 1QFUL 4F2MB 1PYWA 4HPOL 2Q7YB 2XN9A 3V6OC 2GTZA 5T3XD 3BIBX 4XCYA 4KJYB 4B5EA 1IKNA 5F7DB 2E9IA 1S7WA 2C7UB 4X6DF 4V1DA 3KJ6H 4MDIA 3V0WL 4QOKE 1K8IA 1HCFX 1NBVH 1DBMH 5EC1A 2WMPA 1BECA 2DM4A 4BFBD 3MNZB 4P46D 3QDAA 4NJAH 3ARDC 1QBLH 5HHOE 2H26A 4N0FA 3R8BB 1Q9KB 4I18B 4B50A 2DD8H 5D1QD 3JWOL 4QGTA 2ZWLT 1E4XI 1OM3H 4MCYB 1RZFH 1KC5L 1VSCA 5C9JB 1INQB 4ZFFB 2VLMD 4YHZH 1FZOA 4GS7B 3HNVL 5EO1A 5HHQA 3BP5A 3B9KA 1F4YH 3CMOL 4N5EC 4DEPB 2H32A 1E27A 3ARBA 5KVEL 1WJ3A 2XG5A 3WIHA 4UT9H 2BJMH 2ADJA 4M6AA 3BFOA 5EOCJ 2VDPL 2V17L 4KDTC 1ZLVH 1AQKH 5D2LE 3I3DA 4CADB 4EUPB 2R0LL 3MNVA 1OP3H 1A1OA 4X80H 2BVOB 3MBEB 5KBNC 4LARL 3ECBB 3UPRA 2DJUA 5D7JC 5C0GA 1A14L 4O2FA 2BSTB 1ZLWK 4Y1AE 5A43C 3TP4A 2NNAB 4LSPL 3CSGA 1P4IH 5B8CC 4OT1H 1D5IL 1NDMB 1OW0A 4LIQL 3MLWL 1F3DJ 4NDMA 4OUUA 4WI4A 5TDOA 3G6JE 4OCMC 3LKSB 4TYUA 3V6OE 2A73B