4OZLA

Glnk2 from haloferax mediterranei complexed with amp
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
119
structure length
104
Chain Sequence
DLPNDGGIKLVMAIIRPDKLADVKTALAEVGAPSLTVTNVSGRGSDLHQKVKVECVVADTPAEDVADAIADAAHTGEKGDGKIFILPVENAIQVRTGKTGRDAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrogen regulatory protein P-II
publication title The structure of a PII signaling protein from a halophilic archaeon reveals novel traits and high-salt adaptations.
pubmed doi rcsb
source organism Haloferax mediterranei
molecule tags Signaling protein
total genus 22
structure length 104
sequence length 119
ec nomenclature
pdb deposition date 2014-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00543 P-II Nitrogen regulatory protein P-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ozlA00
4D3HA 1GNKA 3TA2A 4OZNA 2V5HG 2J9CA 2J9EA 3DFEA 1V9OA 4AFFA 4CO3A 2RD5C 1UKUA 2VD3A 1V3SA 2ZOMA 5DS7A 3CE8A 1O51A 2DCLA 2XULA 3AA9A 1HWUA 2PIIA 4WK1A 2GNKA 2GW8A 3O5TB 4USIA 2ZFHA 4Y6IA 4USHA 2GX8A 3N5BA 4NYOA 5DRKA 4Y65A 1VHFA 4C3LA 4CO0A 1J2VA 3L7PA 3NCRA 4R25A 2NUHA 5D4PA 3M05A 4CO4A 3HLUA 4OZJA 4IYQA 3T9ZA 2O67A 3MHYA 4CNZA 1V3RA 2J9DE 3AHPA 2NS1B 3TA1A 1H3DA 5D4OA 4RWXA 5D4NA 4CO1A 3AA8A 1NH8A 1Q1KA 2XBPA 1VFJA 1NZAA 1V6HA 2NUUG 3OPKA 3LF0A 2CZ4A 3O8WA 1UL3A 2EG1A 1O5JA 1QY7A 3TA0A 4ZK7M 4C3MA 1OSCA 4NYPA 4CO5A 4YB6A 1NH7A 1UMJA 1P1LA 2JJ4D 4CNYA 4RX6A 3BZQA 3GSDA 4D3GA 1XK8A 3NCQA 1PILA 1UFLA 3AH6A 4OZLA 4CO2A 2XG8A 2J9DA 4E98A 5D4LA 4YB7A 2E66A 2Z0GA 4C3KA 2XZWA 2EG2A 4YB5A 5L9NA 4RWWA 1KR4A 3NCPA 3X3UA 4USJC 2O66A 4WK3A 1NAQA 4RLEA
chains in the Genus database with same CATH superfamily
1JXEA 1FNMA 2B0GA 3G8QA 2FZCB 2H1YA 2ZKUA 1V3SA 3DRPB 3O2IA 1S1UB 4CLZA 4OHVA 4X65F 1JNZB 1E6VB 2V63A 4F8RA 4WYWA 5G4DA 1SKUB 4B08A 2HPUA 2R42A 3BGRA 4DL5A 1N32F 3MR7A 4C8MA 5IT9U 1VQYA 1RI7A 5D4OA 5BJRA 4ZPVR 5IV3A 5IXUA 4JI5J 5HVHA 1QSSA 2GCFA 4LBHA 1U2CA 1ULRA 2HAFA 4F0MA 2JVRA 4ZP8A 4HR2A 1CJVB 1GH8A 4ENOA 3CW2C 3ZZZA 2MHNA 3E01B 5KFDA 1WHYA 3NGSA 4CLKA 2KG1A 1V5IB 3VAJA 3M8QA 4MYTA 1GX5A 3JSYA 4DL6A 1UW9A 2KXNB 3CJ4A 4LUBA 1EB0A 3S6EA 2V4RA 2HFUA 3AOAA 2VJUA 1HNIA 3MECA 3J7AN 1PJ5A 2AKWB 2VHGA 3RW7A 1Q5VA 5IWAF 1HMVB 1FKOB 2ILYA 4DSJA 2YNIB 1FDDA 1OMSA 4HI2A 2XY6A 1F60B 2UXCF 4DU7A 3A3NB 3KWMA 3CMAS 3HHDA 4RO0A 2AGOA 3KLGB 7FD1A 1RZMA 5F8GA 2BR0A 4LF9J 1RACB 2EC2A 4LF7J 1XMQJ 4LFBF 2AJQA 2FTRA 3K7RA 5JXSA 3K57A 4CO5A 4HL9A 3HJFA 2IJNA 3H2UB 4YN3B 4QWAA 1H6KX 3MR2A 3RB3A 1UETA 4NLWA 1WUUA 2HQIA 4LR9A 1JKHA 4X65J 3SSRA 2VQEF 2Q3PA 3H59A 4KFBA 1IBKF 2MY8A 5B0EA 3SSQA 1VHIA 2FVCA 4LQ9A 1TV6A 2JEFA 5EWFA 3WX4A 3PG9A 1WHXA 4K4YA 4CO3A 1LWEA 3V6JA 2RNEA 4DQPA 4ZN3A 2E1AA 2DNMA 2GIFA 1D9DA 4AL7A 2VPZB 4F4WA 4DHVA 1NPPA 4DV5F 3T1YF 4M5NA 4YB1P 3RAMA 1TR0A 2V8PA 4BC9A 3SEOA 3ETOA 1TL3B 1TZ0A 2F4FA 1AUSL 3A8JA 3EXCX 1SJRA 2DGOA 3R7BB 2H5JB 1YDLA 4H54A 1ZM4A 2DK2A 2YKPA 5HVGA 2YWGA 3OL6A 2YNGB 2F1FA 3M9NB 3G82B 3M8RA 2OSQA 2VUGA 4WU2A 4MFBB 4PWUA 1HFEL 4NLTA 1FCAA 2CXEA 3LUYA 1ZH5A 3V81B 2VA2A 4BHQA 1S9GB 3MURP 3G2XA 5AT1B 2DHSA 2MQPA 4P10A 3SYZA 3MR6A 2IBKA 2BVZA 4USJC 5IWAJ 1RHRB 2Z2ZA 3TAPA 3AJ1A 4Y2IA 4A4JA 1VRQC 2E7WA 4DN0A 3VAHA 1S59A 4J9MA 4RNOA 4ZHRA 2DGTA 2UXCJ 3MEGB 5KFGA 4ZPTR 3HZEA 4RBTA 4A8SA 1PAUB 2GAGC 1C0TA 4WZMA 1W25A 1RGVA 2V9WA 1SH2A 1T03B 4RNNA 3B78A 2Y8YA 4IDKB 4A46A 2CQPA 5KT4A 4QQBA 2E5JA 2BE2B 3KFWX 4TXSA 3VWSA 5D4PA 3FRYA 3WBZA 4O44B 1TUGB 3TI0A 3N6MA 4Q8FA 5DJBA 3IP0A 4YS2A 3KK1B 2AW0A 4PCQA 4FYWB 2NS1B 1RWPB 2C22A 2R7VA 3AA8A 1IBKJ 4LFCF 4J9QA 3UCUP 3O8WA 2AZ1A 5KFFA 4NYPA 1X5SA 5SUHA 2XEXA 2JEIA 3GG0A 2FGOA 3IAM9 4X4TA 2MB0B 3A8KA 4PPZA 4GKJF 4DV5J 3MMJA 3T1YJ 1S6QB 3MCMA 1RWMB 3J7YI 2BKOA 4OYBA 2VC0A 2DR5A 3GYNA 1HBOA 5D15A 2H4WB 2KVQE 1HNZF 4XPCA 1LK5A 1JLQA 2OPPB 4Z7YA 3DYAA 1S7HA 3N6NA 4GC6A 1LNQA 3V6DA 3MM8A 4LR8A 1UPPA 3OXLA 3H42A 4DV0F 5ITHA 2QLBB 3EVMA 4P7TA 1U8SA 1OY8A 2UUWA 2Z4PA 5I3QA 1LKZA 3GU0A 4USTA 4OZJA 3MHYA 2EC0A 2ILZA 4NZ0A 4OV6A 1RWKB 4LF6F 4FYYB 1PG5B 1P9YA 3T5HA 1DAXA 2D9PA 4IRDA 2W1BA 4LJMA 4ZK7M 3CO9A 2Y8WA 3GP9A 4LF8J 3EPGA 4KH0B 3JTPA 3W2VA 4ELVA 4Q0BB 5GAHU 1W2IA 1SC4B 4RBVA 4ED3A 1VLOA 1LQ9A 2NPFA 2MEWA 2PA3A 1GQEA 1PKUA 4BWJA 4IG3B 4OJ1A 4RLEA 4P7VA 2BJDA 4X66F 3L95X 3UDCA 2MJUA 5B0AA 2BXJA 1RHJB 3MM6B 4DWIA 1FJEB 1ZZFA 4ZVHA 2H48B 4DPWA 2MGZB 4F4ZA 3GFYA 4YEAA 2ZH8A 4XPEA 4J9RA 4LFCJ 2HNZA 4WIIA 2EWHA 3BGOP 3C2PA 5DRKA 1HBNB 3OJUA 3A1YG 4AXIA 4PXEA 3NS5A 1PBUA 2R7QA 2GIQA 3HD2A 1MWQA 1FXRA 3NY0A 4ZPDA 1HI1A 1TL1A 3M8PA 3CDEA 3M8WA 5KFBA 2XLIA 5IM0B 4RR5A 4A8KA 1M1HA 4QWEA 4UOCA 3RJMB 2J8AA 5CCMA 3BQ1A 4YB6A 4ICLA 3RG6A 1HNZJ 1FRKA 2HIQA 1T3NA 2V50A 3ZTPA 3GILA 4JI2F 2VG7B 4ECVA 2HS3A 2MZRA 1Y4ZB 4F25A 2QMWA 4DV0J 2GFFA 1R8BA 5C42B 2G9OA 3MUTP 2C3OA 4ETXA 3IM9A 3PR5B 5J1NA 3GMGA 5E3PA 2FVPA 2B56A 4KGKA 1HQ2A 3SQOP 2D9OA 1HBUA 1NMEB 4F04B 1RT3A 4LF6J 1XBWA 1DBDA 2ZZNA 1H98A 2V68A 2QL9B 1FXDA 1DARA 2QC3A 2LYVA 3I5CA 4CM0A 1IN0A 2JFDA 2AIRB 3Q22A 3HF5A 4J7CA 1Y5LB 3M6VA 4R25A 5J1PA 4XDCA 1BGXT 2AJ2A 4WP3A 3G86A 2MY7A 5F0UA 3K58A 2XBPA 1LWFB 4ZMMA 4JI1F 4NLYA 2ZM6F 3G6XA 1S1WA 1RSCA 1X0FA 5C25A 1U2RA 5LJ3Y 2E9TA 1EQ0A 2ZBIA 4M5DB 3DI6A 1NSAA 4UOHA 1ELOA 1IJEB 2HRYA 4YDXA 3CD0A 1AYEA 3D54A 4YR3A 5L9NA 1HNVB 2HHXA 1RT2B 4LSNB 3M6WA 4IG0B 3UWTA 3KK2A 4Q2MA 1LFPA 3ZNUA 3NAHA 4FF3A 4URSA 1RAAB 5AXKA 4CH7A 4C97A 1T9VA 4NL5A 4H4OA 1PJ6A 2E5LF 4QW8A 3MXHP 1F1BB 1J27A 3IRXB 2VBYA 2GVDB 1PC4A 1X9MA 3GIJA 1K9MT 1Y7PA 4JI2J 3M2RA 3C3LA 2P2CB 2RRAA 4X84A 1PBAA 4I7FB 1VOMA 4BWMA 4DEZA 3NG8A 1F5BA 1RWWB 4A47A 4KB7A 2OP5A 3HZGA 3GR0A 5IQQA 1R6YA 4FS1A 5KFAA 3VAIA 4JUZA 1MROB 4U96A 1IKWB 4DR1F 1JX4A 3UNYA 3PZPA 2DR6A 1HQEA 2AGQA 2M52A 1TQLA 3T6JA 3B82A 2QZ8A 1MMDA 1U6FA 1W7WA 5DS7A 4DFPA 4X64F 2ZM6J 4NE9C 3W60A 2A6OA 3DLEA 3P4UB 3OUYB 3ILIA 4M5IA 1X5OA 2GZOA 2C1EB 2VKZG 4DV3F 1MWYA 3JSMB 3ETMA 4I6YA 1GMVA 3HHLC 1EAYC 4K4WA 1KQSR 3DMJB 2CQ0A 2IJFA 2XY7A 1IWGA 2UVWA 2DHXA 4ZVFA 1S1XB 2YX1A 4WYLA 4C8ZA 1JIHA 3GV8B 1YK9A 4NI2A 1VLYA 2BE7D 1OQ3A 1Q78A 4I2PB 3J81U 2ZHAA 4J9KA 4F50A 3UW1A 1X8DA 2CJXB 3TJAA 3HT3A 3LWLA 3K5PA 2DBBA 3N01A 2GIRA 2XNQA 5E3CA 5IZHA 2CPIA 4KTQA 1M1GA 3JQMA 1TUVA 1U0HA 2DNLA 3MTJA 4PUOB 2VD3A 2KI2A 1B0VA 1YRXA 1AZSB 4OI2A 1Z2ZA 1U4BA 2BRLA 2CG4A 1YZ7A 2HHPA 3LALA 4AL5A 3F44A 2B8PA 3TNVA 2QMUB 5A8WB 3I5AA 4L3KA 3TEHB 4J9SA 2MLYA 2Z2LA 2VFRA 3DU5A 3V4MA 3QATA 5KFZA 4F2RA 2BQ3A 2CNNB 1M90T 4UQTA 3I96A 4DR1J 2W7OA 3UD5A 3GE9A 3CSKA 2LFVA 2DYAA 4FN5A 4X4PA 1LWCA 1LW2A 5HMWA 2DGVA 1TKTA 4X4OA 2HK2A 1KFSA 4N56A 4X64J 1CQMA 1WEXA 4I1TA 2CYYA 1AA1B 4NMLA 4DV3J 2VG5A 4FZVA 4PRFA 2N4DA 2RS2A 4YDDB 4IO1A 2MKKA 2DH9A 2RMLA 3W2WB 4I6WA 5H9FJ 2ZE2A 4ZCIA 2GGPA 2B9XA 2OD4A 2CNKB 1C1BB 2VODA 5I3UA 1HQUB 2HLUA 2HVEA 3LA0A 3DXSX 1FE4A 1FESA 2FGCA 4FXVA 2NXCA 3SDEA 3AXKA 1BQMB 2FLNA 2BV3A 1CJUB 3GFZA 5G0RB 5CYMB 3DHWC 1T05A 4OJHA 1F2GA 3KLHB 3BKTA 3KKFA 3PX4A 3K5NA 3D0HE 3J7YU 2QFIA 3FBFA 2FZGB 1GT8A 2W9CB 3NNHA 4BCAA 1NH7A 2AEFA 4IH6A 2RQKA 1FK9A 3MCNA 1D3WA 2ZWPA 1UVIA 3QQCD 5ETPA 2WOMB 2PSZA 3VAGA 1WF2A 2PGCA 4LFAJ 1UFKA 3NCPA 3CULA 3GZ7A 1S6PB 3E51A 2O66A 3BSOA 4JBCA 1N5SA 1VC5A 3DRPA 2CJYB 1S1UA 5GAEU 3PO5A 3H40A 1E6VA 2FC9A 1RP5A 1FD8A 3PNIA 3TAQA 2GS8A 3D9BA 1FDAA 3AY0A 2YWFA 4K59A 3WIUA 2FB0A 1U25A 2DH8A 3ZTQA 2I9SA 3B6BA 2IIHA 3Q2SC 2CUYA 2HEKA 1KVKA 4J9OA 4OI0A 5M2PA 3FFIB 3ULHA 1Q7YT 3KJVB 4EYIB 4N41A 4XO0A 2CQHA 3TAMB 3RR8A 2W4CA 4O0NA 1CG2A 2M9KA 2DISA 2QFJA 3BS9A 1CJVA 4KGMA 3JAMY 1NSKL 2DCUB 2B9YA 4CNYA 2VOPA 3E01A 4ZKAA 1U1LA 3IC1A 2J76E 2IMOA 2V8VA 3C15B 3P96A 2BJ3A 2ZVIA 2E66A 2IVMA 2H54B 1BLUA 2VDHA 4GC7A 2NXUA 1WJ9A 3H4DA 1FFGB 4B17A 3GPAA 1Q4RA 3D3CJ 3CCMS 5LSLA 2KXFA 2VDIA 2XS5A 3PJ9A 3GJTB 4DDFA 1C1CB 4U95A 1N52B 4RJVA 1FJ7A 1UA1A 4DPUA 2NPIA 2VKRA 1S76D 1HMVA 2PMWA 1TK0A 4QJVA 1FKOA 2YNIA 1RTHB 4IQMA 1HWKA 4JI7F 4F3MA 4CQ1A 4RW4B 3KLGA 1RYRA 3DU6A 1DRZA 3ENVA 4NOHA 4A8OA 3D6HB 5I3PA 3R5DA 1S10A 4ANDA 1NBEB 3FBCA 2X7IA 1P27B 4ITSA 1TAQA 2LDIA 1VYAA 1DQAA 2V2ZA 3MWBA 3P6YC 1UVJA 2XO7A 3DOKB 3M9OB 2AT1B 4MYUA 4N76A 2J9DA 1XR6A 4MKBA 4N77A 2UUTA 1OSDA 4CLTA 3IWNC 3QIPB 2M8DB 1U1QA 5HI7A 2EKYA 1T9YA 2YXLA 1IBMF 2MQ8A 3M8ZA 2C3PA 2Q43A 3Q86A 1VBZA 7AT1B 2F40A 2QG9B 4HHJA 2FPHX 4LREA 3R9LA 4ECZA 3BO2A 2DGQA 2DR9A 1VQNS 3ENWA 3A13A 4U6PA 1NSPA 4PAAA 5DM7Q 7FDRA 1FJGF 2WW8A 3ZZ0A 1HA1A 4RPFA 1TL3A 4NLSA 4TU8A 3U1LA 5GAGU 2AZ3A 3AD7C 4RWXA 4HVZA 3NNCA 2OELA 1X0PA 1Q8BA 1HKAA 3KJFB 2F8MA 2YNGA 1OYEA 1T9XA 2A1BA 3G82A 1SQEA 4MFBA 1KVJA 1YWXA 3GSDA 3V81A 2CIMA 1CBKA 1S9GA 2JNJA 3D1OA 4XAKA 5DZ6A 3VAFA 4WBFA 6FDRA 3MOZA 4JI7J 5DDOC 4A8QA 5A2QY 3MEGA 5KT3A 2QGFB 3QYYA 3DRRB 4NXMF 2UUBF 2E1PA 2ZC3A 5EWEA 4S0MA 2JWNA 5I42B 1BHNA 1IR2A 1T03A 4IDKA 5AE1A 1FRLA 1R0BG 1H2TZ 5D8HB 3PXGa 1FE0A 3C6UB 2BE2A 4OIXA 4CDIA 1WC1A 3LP2B 4X62F 4O44A 1Q53A 3R6GB 3KK1A 2OAUA 2B5JB 3MMBB 3L3CA 2AU0A 4Y00A 5A0YB 3GYXB 3M8YA 2OPRB 5HATA 1IBMJ 1WOPA 2A10A 1HARA 1AFJA 4R5PB 3TA0A 1L3SA 3GCWP 3BBCA 2LXUA 1VBXA 3C19A 1FDBA 2CJKA 2KM8B 1S6QA 2MKCA 1OO0B 2B4VA 1RT1B 5M2RA 2R8HA 4WE1B 1W2BR 3HJVA 2DNKA 4E2FB 3VZHA 5K5MA 5SZTA 1RHKB 3ZZRA 2YKMB 5B7WA 4FYXB 3EGWB 1G6BA 3BPSP 5DDPC 4Y2MA 6FD1A 3NNAA 2OPPA 3BF4A 3CNQP 3MMCB 4OV1A 2GV1A 1U26A 5KFLA 1LOUA 1NDCA 4DL3A 3KHRA 3FK4A 5F8IA 4DSIA 3IXQA 4KPCA 1M5VC 4Q44A 4QPXA 5F8HA 3BKUA 3E3XA 2Y9HA 3I4PA 2DIUA 4FXWA 1SL2A 5L46A 1X9SA 1F0XA 1XEZA 1Q16B 3PM9A 1RE1B 2L48A 4LIWA 3HT0A 1S6OA 1H3DA 5A6PA 5KG0A 3QGPA 4M5KA 4NXMJ 3L4BC 2UUBJ 4Q0BA 2D3UA 2D3OR 4I6AA 2LXIA 4LRAA 3DGPB 2M88A 4IG3A 1R8HA 4K4SA 2ZJRQ 2B7CB 1MMNA 3CXCR 2FVRA 5IT4A 1R27B 3KHHA 3QFHA 4X62J 1QSLA 2OHDA 3ISNC 1S49A 1UJ5A 2RE1A 3MM6A 1GXTA 4ES2A 5MLCV 3AOBA 1ZPWX 2YKOA 1M5SA 2MGZA 4FF1A 1BC6A 3A3OB 3CUNA 2ROEA 2RD5C 8ATCB 1KNZA 3SI8A 3AB4B 4AUKA 1UPMB 3GONA 1KONA 2HFOA 5AJ3F 2F7VA 2ZOFA 2A0FB 2WZ1A 3M2VB 1ZTWA 1UP1A 2BRKA 5CYJA 1I1GA 4ZITA 1HBNA 1SJ1A 5HK4A 3VZIA 3OSPA 2ZH3A 4RKUC 3JQJA 2ZDPA 2CQGA 2DNQA 4QIFA 2F8HA 3GIRA 2BKPA 4X4NA 3IGVA 3DRXA 2E1RA 2K7KA 2JLFA 5IM0A 2DGXA 2GMLA 4M95A 1VRUB 5DG8A 4DZDA 4H4KA 3AJ2A 1YBTA 2GO9A 3HO1A 2VG7A 3HVRA 3UN3A 4G3IA 5IOLA 2R4FA 2G0IA 4ZP9A 2XB2D 3ZTRA 5K14B 4U8VA 3FMWA 4ED5A 5C42A 2X3GA 1IBLF 2W8LA 3RR7A 4YHHJ 2CNLB 1RTJB 2VIHA 3RRGA 3QGHA 1WKKA 5C2CA 4B3MF 2DHAA 2FJWA 2AYEA 1F3VA 4NLRA 1N48A 2R8KA 1TVRB 2Y0SD 2J6SA 4O3NA 1EJ7L 3IN5A 3VF0B 3D68A 4LT6A 2CPEA 4MH8A 1RK8A 1Y5IB 2KM8C 4EEYA 1N0UA 5KFIA 3DXBA 4CO4A 4B3SF 2W7PA 2OPQB 1LWFA 2RQMA 3P45B 5KFKA 1XR7A 4KO0B 4LSLB 3M30B 2MLZA 4C2MA 4Y0FA 4DG1B 2QYCA 5EX0A 2MSSA 3HVWA 1ITPA 4M5DA 2H65B 3Q8YA 1YJNS 2JLEA 3FCVA 3BH7B 2OSRA 4RX6A 4ZJLA 2W8KA 4FKXA 4NMXA 3I87A 3DOLB 1GXLA 3MEKA 2VV5A 1HNVA 4ELTA 3ZZTA 1KQGB 1RT2A 4LSNA 4IG0A 4F4YA 1IM6A 1H0HB 1S1VB 2HNYA 1IKVB 5CCLA 4OZ2A 2BEFA 3KUEA 2KRRA 4NZ7A 3IR6B 4QZVB 4ZVUB 2LVWA 1S7IA 3I4HX 3IRXA 1ZM2A 2GVDA 1K47A 4ED8A 3N5BA 4Y65A 4AXJA 2DY9A 1N56A 4YUDA 3M05A 2CQ2A 4CNZA 4A8YA 4L6V3 2GHWA 3GB0A 4I7FA 2R2RA 1IBLJ 3GJSB 5F8LA 4DSEA 4NASA 3L7UA 3F56A 3Q23A 2C42A 5HROB 3D28A 5H9EJ 2L9DA 1JNRB 4CP5A 5E5NA 1UMJA 2AYGA 4MMOA 3I0SB 2FHKA 2VOOA 3EGZA 1MROA 3EYZA 1KRPA 1IKWA 1S9FA 4ZJOA 3PO4A 3I31A 5B0DA 4F26A 1YJ9S 1KTQA 1OWXA 5HVFA 4C0BA 4ILLA 1NAQA 1UJ6A 2AP6A 4B3SJ 1S1TB 1H74A 4TLQA 4F3QA 5L8RC 1FKPB 3OUYA 2I8EA 4DL7A 4TNOA 5KFOA 2AWZA 4GRSA 3QJPA 2C2RA 2GX8A 3JSMA 2JSXA 1Q8LA 2OEJA 1WD6A 4TN2A 3BGFA 3DMJA 4ATNA 1FI4A 3G9CA 2HS0A 1S1XA 2DRBA 1D09B 4JP8A 2UXBJ 3UD3P 3KLIB 5KG2A 3LP0B 4C11B 3RB0A 4I2PA 1Q95G 2DNNA 2B4PA 3R7NB 2XGQA 3TW0A 1F3FA 3FDSA 1L5UA 3TANA 4D3GA 4KGZB 3AH6A 3M32B 4OX8A 2QLXA 3VVTA 3W5ZA 4WXWA 3GV5B 2VJVA 3GWCA 2PI4A 3P8BB 2JC0A 3RGIA 4JV5J 5F8NA 4PUOA 5KT7A 3SMZA 2M3DA 2AJ1A 4QPTA 1AZSA 2K7JA 3H2VE 3A4TA 4WCEQ 3IAS9 2R8JA 3W8GA 5LMUF 5A8WA 5LSRA 1R7IA 2CJAA 2ZH7A 3J80Y 1F6TA 1VHFA 4EBEA 3EZUA 4KT0C 4CLSA 1H7XA 1N88A 3IWLA 4DV1F 3MGJA 3DLKB 4ID8A 4DX7A 2WBRA 2ROGA 3PRDA 1WKJA 4B02A 5D4NA 3CTRA 3CCTA 2WRMA 1ZS6A 1MN9A 3C14B 4P2XA 4K4UA 1RCOB 1OY9A 4NLVA 4DR6J 2KFZA 2LA4A 2DPIA 2ZH6A 4FS2A 3QT6A 1UEKA 4UTGA 5B09A 5C5JA 1FWLA 1NXIA 4I64A 1RT7B 2WBMA 4FYVB 2C3MA 5L39A 1N36F 4EWTA 3DLJA 1KS2A 5BR8F 3M8SA 1KR4A 3UE2A 4J9VA 5HMZA 1X9WA 3W2WA 2HWTA 1H2VZ 4OZNA 1C1BA 1HQUA 3MAHA 1LV5A 2BJ8A 1VQKS 1WC6A 2XMTA 4ILMA 4FNHA 4K50A 1RUSA 4ZCLA 3NAIA 4K5RA 1TK5A 1HI0P 4Y34A 2JC1A 1D1UA 1UEVA 1TP7A 5IV4A 1BQMA 3TQEA 5KG7A 1CJUA 5G0RA 4DR7F 4J37A 4YQWA 1KOOA 4PG4A 2GMHA 4CLFA 5CYMA 2EBGA 1R8CA 3RBEA 2J0WA 5ETSA 4CT9A 3KLHA 1QUPA 4ZLLA 3SV4A 2WAQD 3FSXA 4ECSA 1FTCA 1HPZB 2RQ4A 3BGLA 1EX8A 4B3OB 2GHVC 5ETQA 2W9CA 3BO4A 3HHEA 4KAIA 1X4HA 1H73A 1R6VA 1WG5A 1XR5A 2HW3A 3R2DJ 2WOMA 4EZ9A 2DNOA 4I2QB 4PPDA 3FC9A 1M5HA 1VK8A 3GFHA 5LMUJ 2CVEA 1JLEB 1RISA 1S6PA 4DX8H 4YR2A 4GO7X 2DVIA 2OIHA 1FRHA 2KKHA 3OJSA 1RTZA 1QAIA 3NS6A 3VQSA 4NWBA 4DV1J 5LMNF 2DR7A 3EDQB 5K8MA 4KHRA 2WTFA 2CVIA 3QSIA 4OJ3A 1YBAA 2QA1A 1QE1B 2FLOA 3FFIA 1RA6A 3KJVA 3AB2B 2DHHA 2HQ3A 3THPA 2XWXA 1SBRA 3TAMA 3Q8QB 2LECA 1S5ZA 1N36J 4QYZK 5DZ7A 4TY8B 4BLGA 3CC7S 3K0JA 2L3MA 2UVUA 4F02A 5A8KB 2QA4G 4KQZA 3PKMA 3RUBL 3C15A 1HNXF 3BZQA 2R7XA 2LXFA 4BS2A 4F4XA 3FQLA 5B0GA 1B70B 3MR3A 3FCWA 2AF6A 2V4JB 1SC3B 2A3JA 3R3TA 2KZMA 5HJXA 5FD1A 4DR7J 3MCOA 1C1CA 4HTJA 3TZZA 1QM9A 2G2ZA 2QX0A 4USUA 1B0TA 3UR0A 4RNFA 3A8EA 3BBFA 4A8WA 1NB7A 1NLKL 3GV7B 2WVDA 1RTHA 1PCAA 2DITA 4G1IA 3ZZUA 1TMJA 4RW4A 2X3DA 1TELA 3EZ5A 3PHEA 3R97A 3W9HA 3D66A 3BDPA 1A9NB 1X4BA 4C98A 5THWA 5GMEA 3ZNJ1 3AHPA 2MZTA 4G1PA 3TYTA 2WVFA 2Z2YB 3GIIA 4E0DA 1SC1B 4ZVSB 1K44A 3AQOA 4QBUA 1HHTP 5M2UA 4LRBA 5LMNJ 3DOKA 1SJ4P 4QIWD 1UVNA 1RJJA 4OHWA 1FTRA 1Z1ZA 3QIPA 1PC5A 3R27A 3UDEA 2ASLA 2GJIA 2J8SA 5DLFA 1P9QC 1IR0A 4RZRA 3IRWP 5DQIA 2H5EA 4P2MA 3CCES 5LL6d 2V2VA 2XYHB 3V6KA 2HVHA 3NGUA 5D3GB 5ETVA 5T14A 3S7RA 3PYEA 1WDDA 2HK3A 3OT9A 2DCLA 3S01A 4OYOA 2LDYA 5J2MB 1RAJA 1HNWF 2A6MA 2NCKL 1IQTA 2CDQA 2MQQA 1HNXJ 2GC8A 3L7PA 4UW2A 2XC9A 5FLXU 1VQ8S 2LA6A 3BSNA 4NX9A 2XCAA 1ZETA 1RKIA 2K3KA 3QJJA 1YIJS 3T19A 4IFVB 3SCKE 5H1SV 4OYXA 2XTJP 2VF3A 3OD2A 5IC6B 4QWCA 2FJEB 2R8IA 1FRIA 4W98A 1K8AT 3CD7A 2XLKA 1T9TA 2ZJPQ 5GAHI 4AD6A 4JI8F 1BE4A 2IVYA 1X4DA 2RAQA 3JXOA 3DRRA 2BYCA 4I68A 2ZH9A 5I42A 5DDQC 4C6AA 2V94A 3VGTA 5U47A 4HTIA 2EFQA 3C6UA 1GMWA 3UCZP 2N4CA 1A6LA 1SQFA 2KJWA 4YMEA 3LP2A 2DNRA 4CCHA 2DH7A 1UA0A 4WK1A 3BO3A 4CM2A 2B5JA 3MMBA 3Q8SB 2YQ1A 5D0GA 4RW9B 1A7GE 4KKOB 5A0YA 2CADA 1GK8A 4OFZA 2OPRA 4IR9A 3HPOA 1X5TA 1NO8A 2WONB 4YR0A 2ZZMA 2MKHA 1VFJA 2HFZA 1IQZA 4R5PA 2OD6A 1LWXA 5J2QB 4PG8A 1CVJA 3F41A 4QU7A 4G1QB 1V3ZA 3UN5A 4WP9A 5IT9Y 2H3EB 3EM1A 1RT1A 4WE1A 5KFQA 3IBCB 2YKMA 3FEYB 1UEUA 5ETLA 1HNWJ 4O0IA 2DNPA 5A2QU 5KFVA 2LQ9A 3BV8A 2VPYB 4DXLA 3MMCA 3BYRA 5FDLB 3PW0A 5BXIA 5LM7E 2BJ7A 2V67A 4B9SA 2V8GA 5DETA 2OFHX 1H2UX 5ETNA 2R7RA 2CPJA 3NLCA 4X2BA 3ZTSA 1QJHA 4B9TA 2PEBA 4KGVB 4OYMA 4NZ6A 1T0TV 1AXQA 2P6SA 1D8YA 2MHEA 2LEBA 4DU8A 1NKCA 4JI8J 1U6BA 2ROPA 2XI3A 4KJIA 1M0SA 4HH1A 2HKEA 2Y1LB 1SVDA 2SXLA 3FCHA 1KWMA 3DGPA 5C24B 1BY9A 5CZVA 2E9RX 2D41A 4CLYA 3NCQA 5JVGQ 1KFDA 1R8PA 2XI2A 2XM3A 4Z2XA 4DR5F 2GVZB 2DY1A 3BJYA 4KBIA 3CJRA 2W4DA 2NR0A 3EPIA 1RBAA 5KFNA 3FKBA 3L7OA 3CCWA 4NXNJ 1RT4B 3AFGA 1XJWB 3W7BA 3W9JA 3M2VA 4FDFA 4XDDA 3M2UB 3NRBA 1U1MA 4O4GB 3CIZA 3QPIA 3K5LA 1JXVA 1BQXA 3MAQA 4DPTA 2X1AA 2VL1A 2QO3A 2AHOB 3EGNA 2PA8D 1Z2LA 3HLUA 3T1AA 1VRUA 5EDWA 2KL8A 3DGVA 1VQMS 4I0WA 3DDIA 3CCVS 2L41A 2VFSA 2NUUG 3KJNB 4Y2KA 1WORA 1NKBA 3HK2A 4R0JA 4ZN1A 5K14A 3PJWA 1MLAA 1IR1A 3OQ2A 1WF0A 3OR2B 1H38A 4ED0A 3BSAA 3QLHB 1RTJA 4LF2A 1Q8KA 3VV2B 4DQRA 3K8VA 1QAJA 1O8BA 3LW5C 1X60A 2KH9A 3HFZB 2O1PA 1TVRA 1G4CA 3Q8VA 1M5OC 2IC3B 4N8NA 3QZ7A 2BM1A 5KFEA 2PT0A 1MMLA 2C2EA 2GA7A 4F4KA 2AGPA 2OI2A 4WFYA 1G3OA 3NGDA 1X5PA 2DJWA 2HHUA 2FJXA 2OPQA 3O44A 3EUNA 4HEA9 2C2KB 2QSWA 4KO0A 4LSLA 3M30A 5JJBA 2LU2A 4DR5J 4DG1A 4TU7A 3SBMA 3W61A 2GQCA 3KK3B 1HHQA 1NHVA 3OL7A 3I82A 5KG1A 3IBWA 2K1RB 3CT9A 3DOLA 4WU3A 3RW6A 3HI9A 4IQXA 1B99A 4WZQA 1N32J 3B4MA 3CJQA 3NP5A 3G8SA 1UW4A 5C7PA 3MD3A 5CXTA 4AT1B 1S1VA 1DQ9A 1IKVA 1DURA 1MG7A 1PYSB 2B51A 3VAKA 2CKWA 1S0NA 1RWNB 3G87A 1EKSA 3NOCA 1XNQF 4C0HA 2W24A 4K0KF 4U67Q 2CPHA 1B3TA 3UI3A 2YKQA 4PZVA 2IRUA 2OGUA 3PR4A 3RAQA 1S48A 5CQGA 3OVBA 3HFVA 3A8IA 5HL7Q 4JI3F 4U7CA 4DV2F 4GKKF 4QR2A 4KHPF 1BD6A 1Y10A 2HYIB 4CYUB 1RABB 3BSCA 1PIEA 3H5YA 3THVA 1XIQA 2YX4A 2M70A 2HG4A 1O6XA 1CS4B 3PX6A 5HROA 2LP4A 4DR2F 1VDHA 5CYQB 5JUMA 2UV8G 1WNEA 3D3BJ 2MQOA 1RCXB 3NOGA 1TMMA 3M1VB 1DQ8A 4DV7F 2IM2A 2KJVA 3I0SA 1QY7A 5A76A 2HHQA 2HVZA 4DUZF 5KFWA 5AXMA 5ETOA 1DTQB 2AYBA 1SI9A 3KTQA 2AD9A 2B3TB 1FERA 2G0CA 2VU5A 2XZWA 1N4LA 5DG9A 1U48A 1S1TA 4LFBJ 2M8HA 5BYSA 1URNA 1FKPA 1M1KT 2ZUGA 5HAOA 3ILLA 4FXDA 2DRDA 4KV8B 4U7UK 3GYGA 1RWOB 3M6XA 2VQEJ 4IUFA 4LMZA 2CRLA 1N8RT 1S72S 4HKQA 2POKA 2ZKTA 3KLIA 2FY8A 3LP0A 1R0CB 4C11A 1B4SA 1KP6A 2KG0A 2BJEA 2HIYA 1WC0A 4M5GA 1V6HA 3CWJA 3IR7B 1RAGB 2NQPA 3PW2A 3PHTA 1XNQJ 5CABA 4K0KJ 3M32A 4ECTA 2W2NP 3RB4A 2HFNA 4JI0F 5L9XA 3SV3A 4N8OA 3W5YA 4X4SA 2R9LA 4FVMA 3MUVP 4JI6F 4NRUA 2FVQA 2V8DA 4JI3J 3MMAB 2EG2A 1TKDA 4GKKJ 4KHPJ 3CJ2A 2CQIA 2KRBA 1CQNA 2AQ4A 1V9OA 4DR2J 2YVSA 5GAEI 1HW8A 2M4MA 1YGYA 4DV7J 1KN6A 3EE3A 3OFGA 3DLKA 3CJTA 1HW9A 4DUZJ 2LKZA 1NK8A 4OZ0A 1IKXB 2HHHF 2IRYA 3C14A 3PW7A 1GTHA 4KGXB 1YVFA 5HMYA 3M6UA 2AV5A 1FRJA 2M2BA 4WWSA 4F2SA 4UZCA 2XMWA 2H51B 3W3SA 1KLMB 1RT7A 3GIMA 4OZLA 4DCPB 2HHSA 3DDKA 2FJAB 3DKDA 1VGYA 2OJ3A 1KTVA 1WI8A 4ILRA 3WHIA 3M9MB 1XMOF 1CLFA 4A8XA 5KT6A 1FNXH 4HYKA 1SKRA 5I4MA 3DFEA 2NXJA 1KDNA 2KT2A 2RHSB 2R2TA 3T41A 1Y3JA 4GKJJ 1C2PA 3J80U 1J2VA 2FLPA 1ZTTA 4ZVTB 4UY8T 2U1AA 1HPZA 3DHXA 3P5BP 4HH0A 4DUTA 4B3OA 3CDBA 4JI6J 1JMTA 3HP6A 3RAXA 1JJ2R 3UFCX 4K5SA 1XERA 2YNHB 2JEGA 3THTA 3MPYA 1U1KA 4DV6F 3EDRB 3HHLB 4I2QA 4OYPA 2P5VA 4ED7A 3OTEA 5CHCB 2NZCA 1JLEA 4OHXA 4KYZA 3ZZOA 1JWWA 5D0EA 4URGA 1NNDA 2R8GA 5KG5A 3X1LB 1VQ7S 1F5AA 3OTOF 2V69A 3UCGA 3RYLA 3BN4A 2YQ3A 1Q86T 3NWRA 1EHWA 3N0VA 2FDNA 2HHHJ 1NCLA 1QE1A 1ZAXA 1QVFR 2V2QA 4OI6A 4PQAA 1UZHA 3CDUA 3OLBA 4WFAQ 4MKYA 3KLEB 2DEJA 3EWGA 5KFXA 3POTB 1GX6A 4RNMA 1YKWA 5DGAA 4NLUA 2GJFA 1VK3A 4X66J 2W9BB 1WDTA 4TY8A 1G1XA 4LR7A 4DV4F 5A8KA 4G65A 5GAGI 3PW4A 1RBLA 2IYGA 1R8AA 1RBOB 1U1NA 2CPFA 3HHKA 1WHWA 3CJ8A 1NEEA 3LP1B 4MK8A 2WVBA 2IYIA 1T11A 3QIDA 2B7BB 3SFGA 1ZPVA 2LQJA 2V4JA 4Q8EA 2EFGA 4ED2A 2JH3A 2HNYB 3P49B 1HI8A 5LXYA 3WZ0A 1U45A 3J81Y 3W8PA 2J9CA 4Z37A 2DD8S 3UN2A 3O3LA 3Q89A 1YHQS 1BQNB 2HSEB 3QRRA 3AA9A 3TO8A 1X7VA 3SFUA 4DV6J 3OFHA 3CCUS 1GTEA 4NYOA 4ETZA 2XY5A 2BX6A 1I94F 4DOZA 4DLEA 1WELA 2NUHA 4OHYA 2L9WA 3KYLA 4WXOA 5KTQA 1SC6A 3KLVA 3HXMA 4DBQA 4IO9Q 1FWKA 1N33F 4WP8A 2W9AA 3OTOJ 2BOAA 2LMIA 1UZDA 3FUYA 1NHKL 2VB6A 2DIVA 4Q5VA 1IWAA 3U02A 3KG4A 3HVTB 3RBDA 3N5FA 4M63A 1ZAVA 3MDFA 3R5JB 1Y0HA 4DQSA 4R8UB 2MQLA 1VQ4S 2KYZA 5D4LA 2JOQA 3MM9B 2X1FA 1EQMA 5HQ8A 4JI1J 2PC6A 4J91A 2UXDF 1LW0B 4C8YA 5D3GA 1N5VA 3FGVA 3K59A 3C6TB 4PWWA 5F9LA 2WVEA 4EO8A 1GNKA 2XMKA 5FJ4A 4M8LA 4OLOA 2M5YA 1QDUB 2MQNA 2OKQA 4B3TF 2ZZTA 4NLXA 4DV4J 2MDAA 5J2MA 1WTFA 1JJHA 1FX2A 2WSEC 2YPZA 1Y00A 1KKHA 1BMQB 3V4IB 3KNAA 3AAWB 2VFVA 5EX3A 4IFVA 2XGPA 4OX7A 2CQCA 3I9V9 3BKFA 1WEYA 3M4XA 5A8RB 2ZHOA 3OL8A 2E5LJ 4CLPA 1UWAA 2W01A 2JRSA 3ISZA 2PMZD 2B8QA 3UQSA 1FD2A 1TKXB 1WWHA 3CCJS 1Y3KA 4OQJA 4A48A 5C2GA 3PW5A 5BYRA 1PAEX 1I94J 5HMXA 5CZXA 3EX7B 2EFVA 1F2HA 3TVZA 4P2SA 4L72B 2ASJA 1UCNA 4PYAA 4HT7A 2WW4A 1Q5YA 2QA2A 1N33J 3FBEA 3NBPB 2XMUA 1I51B 4RW9A 4H4MB 3H0PA 4DR4F 4KKOA 1QTMA 2GQQA 4RU9A 4P72A 1KHWA 2Q6BA 4QR1A 4CO0A 2R7SA 4WFNQ 3US5A 2WONA 1LFWA 2BACA 2HS4A 2PFFB 2ZBCA 3R7SB 1M5KC 3I6PA 4JV1A 3NGKA 3G6YA 1MSWD 2UXDJ 5J2QA 2QV6A 2RQCA 4G1QA 3QT7A 3BQ2A 4OLPA 1SUQB 2KU7A 2RT3A 2KHDA 1WC3A 3QT8A 4JYAF 3MPUB 1ZM9A 1RB0A 1BUXA 3MM5B 3G6VA 4PG7A 1UJ4A 2WB4A 3LPEA 4DPXA 3KXDA 4HDHA 2IJRA 4J5OA 1FWPA 4C3KA 1L3TA 2MZ1A 5FDLA 3VTIA 1MN7A 1JXLA 3KDOA 2OTJS 4EZ6A 1QLNA 1HD1A 1YI2S 1T95A 2XLJA 1YQHA 4PYDA 4USMA 1WI6A 3W5XA 1N5YB 1HR0F 3NKYA 3DNCA 2VPWB 3CJ3A 2ZUAA 4I56A 2VICA 2YKNB 2VFTA 2R7OA 1NK9A 1XMQF 2GW8A 2ALZA 4ZS6A 1B64A 3TQ1A 5JVHQ 3LH2S 3DLGB 2YBVA 4WFXA 5IQ6A 1JLGB 5HP1B 2UUAF 4RU2A 3UO0A 4DSFA 4ZPCA 3FQKA 4ZIWA 2HNDB 4ZVPB 3O6QA 1TTHB 3PFOA 4XTTA 3KOAA 5C24A 1N0VC 1WF1A 1FFWB 4ED4A 3RU0A 3HKZD 2I0XA 2YNFB 3I55S 5F8MA 4ALZA 2GVZA 1L3KA 3GJRB 1N34F 2RS8A 1QAYA 3PVXA 2G2OA 3H5UA 2DPJA 2Z56B 4DR4J 2C2DA 3TJ8A 3K2YA 3HVAA 4Q2LA 1RT4A 3CCLS 4KH1B 4RW6B 2GAHC 2YQ0A 5CD4H 2RHQB 3M2UA 4I69A 2VFUA 2O3DA 3OTBA 4O4GA 4E8UA 1Y11A 2ZBPA 1HHSA 1REVB 2D74B 1KEKA 2C28A 4C8KA 4PABA 1WEZA 2W2MP 5KG6A 1FT8A 1BXNA 4L74A 4BC7A 3D0IE 4JYAJ 3CJ5A 4F36A 2MKSA 2HBRB 3MEEB 3T9ZA 2FIUA 3IFEA 5F8JA 2QIFA 3IBFB 1U7LA 1E6YB 3VALA 2PEHA 3LQVA 3O1LA 3Q2TC 3D1QA 3J7A1 1O5JA 3B4DA 3OR2A 2P9GA 1HR0J 4C48A 3QLHA 3DOMB 2FD2A 1BWVA 4TLRA 2QLJB 2PFDA 2F65A 2V8HA 3PJXA 4ANEA 1VRTB 1Q0NA 4QU6A 2UVRA 3QRQA 1CPZA 4A8MP 1DTTB 2E29A 3K5OA 2UUAJ 4MAKA 4USVA 3TX8A 1TK8A 2E44A 3BB5A 1TFWA 4NA3A 2IC3A 5KFPA 1X4CA 4GO5X 3GTYX 5EUHA 2ZBQA 1NK7A 3NL0A 1NM2A 2RF2B 2Y3YA 4ZVRB 4O3RA 4HT5A 5KFMA 1D0EA 4FF2A 2VBXA 4RW7B 3I9ZA 4NCAA 8RUCA 3D7SB 1RT6B 1FVSA 2QJ3A 1N34J 1HL6A 3KK3A 5J2PA 4ECYA 1JJ4A 2Y1RI 2R7WA 4IH5A 2EKNA 3NWGA 3D6FB 3TEGA 2K1RA 1UL3A 2E5IA 2QLFB 4BDPA 2FZKB 4ER8A 4V19J 3ONQA 5KFUA 2AJ0A 3IO1A 1IXKA 2F3JA 3D2WA 2YH1A 4HDGA 3HSGA 4IFYB 2YPYA 2VZ9A 4P52A 4P6QA 2BMBA 3W66A 2P6TA 4NLOA 3A12A 3FSYA 2XWYA 4MTPA 3P3DA 3OFEA 3H7HB 2VQFF 2VBZA 4DS5A 4CYUA 2RU3A 2ZFHA 2ATLA 3DCAA 1UFWA 4LF8F 2J5AA 1CS4A 1B7FA 5KT2A 5CYQA 3MR5A 3H90A 2CQ3A 1Q1KA 2ZHBA 3M1VA 3JSRA 2HFVA 3OXFA 1D8ZA 4NCGB 4K4XA 2L08A 2W4PA 1DTQA 2QL7B 1VR6A 3QBCA 3EMTA 2DXEA 2COLA 4GVBB 4FBUA 3UD4P 1UTAA 2HWHA 2IAJB 3PYDA 4C8OA 2H9ZA 2CJ9A 1YJ7A 4KV8A 4K4VA 4NA1A 4DF4A 4WJBA 3R2CJ 2QLWA 4JV0A 2XMAA 1B7YB 5MAOA 2DO0A 4K7QA 1MU2B 3OW2R 1KSPA 3AOCA 2JDJA 3IMQJ 3EXYA 1SKSA 3KMSA 3W1YC 1CC8A 2HQCA 3J81j 2IPOB 3LAMA 2HBQB 2J9DE 2VA3A 4FNIA 2OPSB 2CWXA 2B6AB 2IMWP 4UUWA 3CJSA 1M5PC 4LBPA 4GVLA 4LRFA 1FJGJ 4J9NA 4PG6A 4UOGA 4UZBA 5E41A 2AX1A 3MMAA 2CQDA 4W90B 2VQFJ 4CLWA 2GJ2A 2MZSA 4TQSA 4G6VB 4AE5A 2ZBRA 1R0AB 2HWIA 5KFTA 1ACMB 4LVNP 4B9UA 3CDWA 4FP9A 4QYRA 2BBEA 4DLGA 1SJQA 5DLGA 1K73T 2B43A 2OMOA 1RA7A 4IOBA 2K8GA 2D3O1 2XYGB 1SQGA 1TU0B 4QR0A 3U27A 1IKXA 3K17A 1VIOA 1FFSB 1GFWB 4I4BA 4EUVA 4Y2AA 3G96A 1UAWA 1JJCB 4NYZA 2QEXS 4B9LA 3TUZC 2DXDA 1X31C 5B0FA 1KLMA 2ASDA 2QTWA 2ACYA 2KDOA 4DJBA 2XZTB 1RTIB 4P2FA 2HLTA 1HYSB 3CMQA 3TUPA 4AL6A 4PWDB 3T1HF 3C46A 3ZFVA 3RRKA 3ZO7A 2E9ZA 3IWXA 1HWIA 3I56S 4E98A 1YJUA 2XQCA 4EBDA 5GADU 1JLBB 4ZCKA 3OSNA 4WKRA 4ELUA 4OX9F 2D1CA 1RXOB 1TFYA 1K1SA 3BQ0A 3QNWB 4LBIA 3CC4S 2E5HA 4MJKA 4CH0S 4RNHA 1O51A 4JI4F 3IS9B 3J7ZT 2J0SD 2HFSA 2XSFA 2O5DA 4HACB 2OTLS 3I32A 2Z2MA 4NLQA 1ZM3A 1NJYA 3T5LA 2YNHA 2ZH4A 5B08A 2HVDA 3D6TB 1KHVA 2MKIA 1TAUA 2PD1A 3HHLA 4RBUA 2Q79A 4DL2A 1YG0A 4UF4A 1QVGR 3CPWR 1S4FA 3F73A 1SV5B 4EK2A 3KUHA 1PILA 2V6AA 2W2QP 2DGWA 1FA0A 3VGSA 1SKWA 2GQ2A 1FX4A 4DZ6A 2J6UA 3MD1A 1C4AA 2ACMA 1NUEA 3X3UA 2IM0A 1WC5A 4TYAA 1AFIA 3TA2A 2QRRA 5E3RA 3KLEA 2V5HG 4AFFA 1FVQA 3POTA 3QSYB 2DNGA 3RB6A 1J5OB 4QYZJ 3WX8A 4ZLJA 4K2XA 4TYBA 1EETB 1PYOB 3PEHA 4WF9Q 2W9BA 3T1HJ 4YFUA 3FZ2A 3OV7A 3N9UC 2HBYB 3QGGA 3LTOA 1I3OB 2OFGX 3ICLA 4K4ZA 5CAAA 2CNOB 1S0MA 3IA0A 5AJ3J 4KPYA 2CAJA 3V5RA 3LP1A 4OX9J 5E0OA 4B3RF 2MSTA 3CC2S 4ERDA 3KMQA 1JK9B 4DFKA 4JI4J 5LT5A 4DX5A 4MKVA 1PGZA 4AQYF 2Z30B 2FJBB 1A0OB 1BQNA 2DB1A 2ZOMA 4KC5A 3CDAA 2ZEJA 2B4OA 3QWPA 1LEOA 1QSYA 4A8FA 2G4BA 4V19X 2NXEA 2YWWA 3CO0P 3MPDA 4DUYF 4B3MJ 1CULB 5KG3A 3B8HA 4RW8B 3NGTA 3FBBA 2LLZA 2P9CA 5D0HA 3ZZPA 3PIPQ 4XK8C 3HHNB 5LXRA 4H4KC 1MWZA 4KSEB 2HGLA 4P75A 1WG4A 3HVTA 2CZ4A 1SJFA 3LPYA 5HANA 2FLLA 4C8LA 2KT5A 3QO9B 4PQUB 2R7TA 2OEMA 4DSLA 4R8UA 3P5TL 1JLCB 2GO8A 3TUIC 3MM9A 1SIZA 1SXLA 1YTYA 3CJKB 4UT4A 2EEYA 1VQSA 1LW0A 3ET6B 3C6TA 3TR5A 2ZNYA 2IA6A 4PXDA 4F4AA 1S0OA 2CPZA 1FO1A 1VQ5S 1YRTA 3BREA 1AT1B 3T5JA 2H4YB 3VQTA 1XWLA 1DFDA 3I0RB 4LF1A 1LXJA 3V4IA 4C9DA 4ZP7A 2HZVA 4B3RJ 2IY5B 4QIEA 3TP2A 1RAFB 4K4TA 3OLAA 4OYWA 1PSDA 2EW9A 4USWA 1V3RA 5A8RA 2CG8A 3KJQB 4LFAF 3OL9A 3B54A 1DY3A 4AQYJ 2EK1A 2Q1LA 4DQQA 2ZJQQ 1W26A 1OS5A 1NB2A 3FZBA 1RWXB 3ADAC 2A2DA 4OYIA 4O3PA 4N5SA 1TKXA 3S8SA 4ECWA 2JEJA 1S6UA 3AJDA 3HD1A 3BN7A 2CJBA 3N4WA 3NGRA 1JLAB 3HHLD 4YB5A 4RWWA 1YITS 5F9NA 4LIRA 1TL7B 2J7UA 2LEPA 4DUYJ 3UVJB 2N7CA 4Y28C 3WQPA 3NBPA 1QTNB 4H4MA 3E8OA 4URQU 4ZVQB 3W63A 2MXYA 2QL5B 2PIIA 3AT1B 2BM0A 5L1IA 2MKJA 3PY8A 4USIA 3OTCA 3K5MA 4USHA 3NXZA 1HBMB 3VVUA 3NCRA 1IJFB 3BR8A 1QD1A 3MAAB 2NXNA 2ZC4A 4ZPAA 1RLCL 2DXFA 5KFSA 4EMDA 3KG0A 5J1EB 1SUQA 2ZITA 2LQ5A 3BM7A 4OZ5A 1UVLA 2XMMA 5CD4A 3VCDA 2R3VA 3MM5A 2W2PP 1S79A 2ERRA 2C2OB 1U09A 4RL1A 1OYDA 1ZOTA 4NEYA 1K1QA 1RYSA 1RHQB 3VGVA 3QT5A 5ETTA 4ZLNA 5HBMB 1ZA2B 1N5YA 4LVOP 4NA2A 5DQHA 2BW7A 4D3HA 1H72C 2OO4A 4MIBA 2UU9F 3R5BA 2YKNA 1S77D 2Z8QA 4ZVEA 4XIUA 2UVVA 1L3UA 3BEGB 4TY9A 2XULA 1CJKB 6AT1B 3DLGA 3IGNA 3TJ9A 1JLGA 1UVKA 1YLXA 3ZTOA 5HP1A 4CH1A 2DEIA 2MZQA 1I5OB 2G1HA 3JSBA 5F41A 1QAXA 4NLPA 5LJ5Y 3MM7B 3R1LA 2HNDA 1NJXA 1RTDB 2RU9A 3Q0AA 4UUXA 2A2CA 1NZ8A 4DFMA 2JHEA 4CO1A 1NH8A 3RBZA 2CDRB 3KDNA 2AEJA 1PJ7A 1FF2A 4L73A 3PV8A 2Z58B 2YNFA 9RUBA 3MPWA 4PXBA 2FHOB 1VS3A 3JQKA 3OVAA 1CSJA 2IDEA 1AUDA 3D0GE 2XZDB 2NZ4A 1VMBA 3PTWA 4FKYA 2DHGA 2QSFA 2PI5A 2DKOB 1WACA 1NHUA 3PYFA 4LRDA 2EFNA 4RW6A 5AE2A 3ILOA 3DRSB 3HSDA 3NMAA 2BJ1A 4CTAB 3LGMA 1RT5B 3D67A 1OPIA 4OJGA 2C2MB 5FIIA 3HMJG 1ZBTA 1FRXA 2CA9A 1XQIA 1U02A 1REVA 2KO1A 4F7VA 4AYBD 2VC1A 4ZCMA 1Q82T 2J7KA 1RWVB 2LQBA 1U49A 4O23A 2HMIB 2XSJB 5J2NB 2JFKA 1JB0C 2FC8A 2RB7A 1RWUA 5BR8J 3SIPB 3MEEA 4C3LA 1S99A 4Q43A 1E6YA 4M5HA 1APSA 3TX0A 3G71S 5DGBA 2UP1A 2FHJA 2HZCA 4OX6A 3FEXB 2BA9A 1TKZB 5IC4B 2E1CA 3DOMA 2KZZA 5DM6Q 1RAEB 2XHCA 5K9FA 4ZDNA 2UU9J 5FLXY 1RLDA 2BANB 1NPRA 3W65A 3OHBA 3G6ES 1VBKA 1VRTA 3Q8UA 1N6QB 2J6TA 9ATCB 4N7TA 1DTTA 2JX2A 3FRZA 1VQOS 4DSKA 3HSJA 1OJ4A 5A6WA 2PDAA 3R5GA 2B9EA 1RU1A 1VIXA 3T3FA 4O3QA 3JTNA 5K20B 4ECQA 3C66A 4X4RA 3CCZA 2E5GA 2RF2A 5D0RA 1IKYB 2ZOGA 3EVWA 3OR1B 1U6ZA 4RW7A 2N82B 4CRJA 1Y5NB 1FEEA 2C3YA 2MLXA 4EFAC 3Q24A 1YJVA 2GNKA 2HRUA 3OBIA 1RT6A 2VASA 4QWDA 5K8NA 2NREA 3V6HA 3JAMU 2DT9A 1FNOA 4IRCA 1RHUB 2ADBA 3DN9A 1MNEA 1EKRA 3TA1A 5HQLA 1WKLA 2BQRA 2C2NA 3VHQA 3EICA 3LF0A 3D6MB 2JL9A 1P1TA 2CWKA 2E7XA 4F3OA 3WC2A 2Z57B 4IR1A 2KT3A 1SL1A 1NPKA 3TWZA 1WOSA 1P6TA 1F9HA 3MI7X 1U0SA 2FYXA 3R5AA 4DF8A 2ZH1A 4HLBA 4IFYA 3PKYA 1NDPA 3HSZA 3LGNA 1DLOB 4L3NA 4YY3F 4EU0A 4ED6A 4CLUA 2JLGA 1C0UB 5F0WA 3RZAA 4ZPWR 3W64A 4ZA1A 1KD1T 4M5JA 3CCRS 4WIQA 5HLFB 4PG5A 4I67A 2LCWA 4HHUA 3N79A 4Y2CA 3JYTB 5ETMA 2HQDA 4ES1A 1NDKA 4Y6IA 3C16B 4MT1A 3A3PB 3GG1A 3HFKA 3TZYA 1T94A 2KXHA 3HKWA 4JB8B 2ZD1B 3BH6B 4TKTA 3FJ2A 2MTLA 3K89A 2V4QA 1EP4B 2V34A 2YY3A 2UZAA 5B0CA 4NPOA 5HQMA 2B9WA 4NCGA 4M94A 5F3ZA 1U1PA 2EG1A 4DFJA 3ITHB 4DI6A 1X4EA 1F9FA 4IRKA 4LQ3A 4TU9A 1RAHB 1S9EB 4GVBA 1VI7A 2IAJA 2LEAA 2EPIA 5HJYA 2Y1IA 1UVMA 2QE5A 2BE9B 3MEDB 4M5LA 2RVJA 5GVQA 4OMFG 4EGLA 2MJNA 2DR8A 2KN4A 2RKIB 1CEZA 1Q7LB 1MU2A 1GEHA 3UR3C 4DR3F 2RILA 2Q6CA 2X1GA 1NK4A 2MQMA 2HURA 5CA5A 1HWUA 2UUCF 3DM2B 2XNRA 2APOA 1UWBB 3PFEA 1VQ9S 1V5VA 2HGMA 4ID5B 2XMJA 5DQGA 1GMUA 3GFXA 2OPSA 4ES3A 1ZZNA 3QZ8A 2B6AA 2RDIA 5H9FK 1NKEA 3CIMA 3ZXWA 3D4JA 3OTDA 3AXMA 2C2ZB 1JLFB 2CPDA 4P73A 4YHHF 3SQGB 3OPKA 4YY3J 1XC9A 1KLNA 2HAIA 1CJTB 3MPVA 4DPOA 3AODA 2BW2A 2FVSA 1P8GA 2I5JB 3M7VA 3H98A 2XCPA 2VG6B 3JS9A 4IOCQ 3NMRA 2VH7A 3HCXA 2FHJD 2KFNA 2Y0BB 5T7LB 2YWHA 1R0AA 1VQPS 3IG1B 3OHAA 1SJ3P 3TVYA 4TVAB 3HM9A 3KHLA 3ZZYA 3KLFB 4UY85 1UKUA 1NK0A 4CLLA 1HD0A 4WFZA 2DRAA 2XYPB 8AT1B 2N3OA 3Q83A 1SIWB 1SB6A 2CQ1A 3CMES 2RUGA 1J5EF 2NYHA 2ATCB 5ETKA 3F0NA 1WSVA 1AROP 2DNZA 1RAIB 3BGRB 3QJLA 2E7VA 1RAOA 4JV2A 2R7UA 1NZAA 1ZYQA 2UV8A 1RTIA 3CCSS 1HYSA 4PWDA 3UNGC 1OY6A 2DTJA 5ETRA 4WFBQ 4ZJQA 4DR3J 1JLBA 2XG8A 3SZ2A 2D7SA 4R0EA 4C7QA 2UUCJ 4P9SA 3JTOA 2RDJA 1T02A 5DDRC 2CQBA 3VR1A 3H5SA 3TRGA 2MZJA 3L09A 3M8QB 4KIAA 4U9RA 4L75A 2H5IB 4M1KA 2I6WA 2K2PA 1O0PA 4OZ1A 1T9UA 3IS9A 2HHVA 3QFWA 4L76A 2ADCA 2MMYA 4WTYA 2R2UA 2BJ9A 2EVZA 2ASYA 2KTQA 2WVCA 2VPXB 4JOUA 1C4CA 1HNIB 4HACA 3MECB 5HO4A 1RDRA 3U1NA 1REGX 2W7AA 2G1DA 2F63A 3ISND 2FUG9 1YJTA 1XNRF 5LOQA 5EWGA 3PIOQ 1U1RA 2KFYA 4ED1A 4DCOB 4IOAQ 3QMQA 3CVKA 1SV5A 4OYZA 1K0VA 3CD6S 3CD5A 1OSCA 3MFIA 1QUVA 2MKYA 4DN9A 2G0JA 4KHMA 2NSBA 3EJMA 3ZC4A 4B9MA 1X4FA 5K8OA 1Q81T 2Z0GA 3U7JA 4KR0B 1Z4UA 1GXUA 2WCXA 3GCXP 1JKHB 1J5EJ 3I5BA 4KFBB 2DGSA 1GAOA 4O3OA 1ZAWA 5AXNA 1J5OA 2J7WA 2RJZA 4WTOB 1TV6B 4QWBA 2HHWA 1FDNA 2JVOA 2P8IA 4F0HA 4ECRA 2UXBF 3FEZA 1EETA 1NJZA 1YJRA 1GMWD 1LWEB 3EVOA 2BQUA 1IVZA 1YX2A 5J2PB 2F9DA 4QOTA 5E33A 3GSIA 2C3UA 1WG1A 1T7PA 2M7SA 4YOEA 2W25A 4IYQA 1NJWA 1N54B 4IH7A 3PDNA 1YBUA 4NRTA 1XN9A 1BWEA 3CB4A 2GHPA 3BPDA 2KB2A 2MYFA 3RRHA 4JV5F 2D3ZA 5KAKA 1ROFA 2EK6A 4CWBA 4DL4A 5KFCA 2HHTA 1Q8IA 2YX7A 5L38A 3KNGA 4DPYA 3R5CA 2WK4A 1T3OA 5E3QA 1FJCA 4UOFA 5HSPA 3H2LA 2BDPA 3N28A 4KY3A 1AB8A 2B4UA 1XNRJ 3TOQA 3LOUA 5CH7B 4ZHRB 3CE8A 1L3VA 4W4MA 5IT0A 3RBXA 2PN6A 3U1MA 1RADB 2XMVA 2HVIA 1C0TB 4WKYA 4DR6F 3AQPA 1CULA 1NSQA 3FNNA 4RW8A 2HGNA 2DO4A 3WIVA 1KVIA 3W9IA 1S12A 1YJWS 2OEKA 3QAEA 5DO2A 3VGUA 5KFYA 3H25A 4Q45A 2ABYA 1VJQA 4LF5F 3LGHA 3QO9A 2AYMA 1VQ6S 4PQUA 2KVIA 3UDVA 1JLCA 1VJWA 2PMHA 5E3AA 3ENAA 3DC2A 3CJKA 2ZDOA 3MZIA 3PCOB 5KFRA 1XK8A 4HHHA 2OUGA 3ET6A 1VISA 3BDEA 1RHMB 5DG7A 4YB7A 3TZXA 3PX0A 2EXUA 1YZ6A 2RDDA 3SCJE 3TZWA 2MPUA 2HZAA 1DJ0A 4Y3CA 3PACA 1URRA 1D9AA 3EGVA 2CPYA 3I0RA 2RIJA 4NEZA 2J9EA 1ZA1B 2F9JA 1HBOB 5D78A 1X4GA 5L1KA 1JLQB 5RUBA 1R3NA 3DYAB 1F5CA 2I1RA 1XTZA 3V6DB 3MM8B 5EN1A 2JZ5A 2FJDB 5KOWA 3HX9A 5EGYA 3MF5A 4N47A 1XMBA 2OMLA 4RUCA 4DV2J 2HQFA 4J9UE 2HRTA 4QIGA 2EFOA 1R89A 2U2FA 2RH3A 5B0BA 4U7UD 1JLAA 3W2VB 1VCTA 3VAMA 1TL7A 3BGUA 4U8YA 4DS4A 3UVJA 5IS2A 1NJIT 2IM3A 4F0KA 3H5XA 2LU1A 4KRWA 4ZOSA 2AMCB 2ZH2A 3CGIA 4LF5J 1HBMA 4ZVGA 3MAAA 2FJVA 2HNZB 3TUJC 3MFHA 4MK7A 5KFHA 2WB1D 3EZOA 2WSFC 2XS2A 3FSIA 2O67A 1FKAF 1WHVA 4OL8A 5J1EA 3ELHA 3DLLQ 2G13A 1R43A 2CZ9A 4X4QA 3RTVA 2NSCA 2I38A 4X4VA 1WTBA 3R8YA 2NLWA 2BUNA 1DZ5A 2AJFE 4NCBA 4ZLPA 1TL1B 5GMDA 3M8PB 1I6JA 3KG1A 2QT7A 1FHTA 1U1OA 1UFLA 4ICLB 4FF4A 5HBMA 4IKAA 1N5TA 1FXLA 2ZVSA 2X51A 1T9WA 1VC0A 3HULA 4MK9A 4J90A 3H20A 3NEKA 3TVKA 3QAUA 5KG4A 5JMNA 2VONA 1CJKA 1S0VA 1U47A 3LO3A 4X4UA 4JI0J 2ZWOA 2EFPA 1R31A 2R2SA 3KHGA 3N6LA 4FYDA 1HBUB 1HWLA 1RT3B 3O5TB 3MM7A 1IBCB 4B9VA 3LANA 2YH0A 1RTDA 2XHWA 1T8EA 4OZ3A 3OXGA 2RUSA 4QW9A 1SH3A 1Q79A 2K06A 1YSJA 2L9NA 2AEMA 4B9NA 1WC4A 3LWMA 2IA0A 4HI1A 1K0TA 2WHOA 3CEDA 1S1WB 3GLJA 1YRUA 3T6BA 4EO6A 5C25B 5LSOA 3AD8C 3L9ZA 1F9EB 4CT8A 1LK7A 3GJQB 4QCLA 2EBEA 3DRSA 3CCQS 4DCJB 2FHMA 1CC7A 4CTAA 3WC0A 3DI6B 1RT5A 1OQ6A 3JB9k 1PYTA 4K2JA 2F5GA 3IR5B 3QWUA 4K8RA 3NS7B 1PO6A 4OI3A 2HMIA 2XSJA 5J2NA 1HWJA 4OI1A 1SL0A 3KK2B 3G4SS 3ENQA 3DRYA 3SSSA 5F3TA 1KBRA 2I2YA 4EYHB 1XMOJ 3S1TA 2KYXA 2WSCC 3GIKA 4CZCA 4H4OB 4C4WA 4C8NA 2CFXA 1DHMA 2AJ4A 1RKJA 2N7YA 5L1LA 4CIOA 4W92B 2F4VF 3UPFA 3IM8A 2KHCA 3DLBA 1IM4A 5IFMA 1TKZA 1EARA 3M2RB 2XO6A 1NK5A 1FRMA 1G2EA 2Q66A 2M0GB 2BANA 4PXCA 4V1Ak 5K8PA 4GMKA 3H4BA 1N6QA 4FPRA 1P1LA 3SCLE 1EIYB 1KOHA 1TUWA 3BBBA 2IHR1 2BABA 3FVYA 3Q8PB 3QRPA 1B0PA 4DX6A 2IVFB 4DQIA 3T5KA 3MOJB 4LF4F 2QA4S 2IDLA 5H9EK 2ZH5A 1TL5A 3W62A 1IKYA 1VBYA 2J0QD 4P71A 3T9NA 3OR1A 1TL4A 2RRNA 3K8WA 3GR1A 1HQEB 4ZP6A 3CJ0A 2ZNZA 2EI5A 2Y1JA 2IFXA 3E2EA 4FBTA 4RUBA 2D69A 3PYGA 4MKAA 5KT5A 2A18A 4MIWA 3DLEB 4WPAA 5L1JA 2BZ2A 5KFJA 4ECXA 1U24A 1HIYA 3MUMP 2P9EA 1S57A 5ADZA 2ALYB 2YWEA 5E2QA 2F8EX 3WDOA 4OYAA 2O01C 5T41A 1NU4A 5BYQA 2FQQB 3Q8RB 4DL0C 2E1MC 1SH0A 3G8TA 4C3MA 2AX0A 2V2KA 2JJ4D 4NI2B 2XS7A 2HQGA 1FEHA 2CQ4A 1DLOA 3BYPA 1N5QA 5AE3A 4OHZA 1JQGA 2LQ8A 2IM1A 5HN0A 1RQ0A 1C0UA 3BR9A 2FY1A 4WK3A 1KC8T 3GQCA 2F4VJ 3C8YA 5HLFA 5AXLA 1D9FA 1X4AA 1H7WA 4O4RA 3JYTA 4PR6A 2DNYA 2QMXA 2HBZB 1U0HB 4UQGA 3C16A 3PRVA 3HDSA 2YKAA 4FVCA 4CI0B 3H8YA 1SPBP 1AW0A 2CPXA 2ZD1A 5EHHA 3MCSA 1EP4A 4ZIVA 2DNHA 2V9KA 1IUJA 2YTCA 3AD9C 2CZVC 4ZPBA 3ILJA 2OH2A 1NDLA 3PRBA 1U8WA 4LF4J 5D77A 3ITHA 3SXLA 1KQKA 2YWKA 4NXNF 2N3LA 1S9EA 2J0XA 4TQRA 4CO2A 1LWCB 4Z7CA 3LAKA 1LW2B 3D1HA 1TKTB 3MEDA 2G2YA 2RSQA 2BOPA 2VBWA 4DMZA 3OVSA 2NYIA 1LXNA 1WOOA 4BBYA 2RRBA 5GADI 2RKIA 4JI5F 4RUAA 4J9PA 4ZVOB 2IRXA 5E7OB 1G7CB 4P74A 4RUHA 2VG5B 1WSRA 3FMBA 4Q7AA 3DM2A 3PEJA 4J9LA 1KQFB 5KOXA 2CJQA 2QN6B 2X1BA 5D6GA 1UWBA 4KE5A 4M5MA 3QGIA 4ID5A 3R6LB 3OFFA 5GMKa 1MW7A 2ZE2B 2GGPB 1U2FA 1ICEB 1VQLS 4PEOA 5I3UB 1RU2A 4USKA 4F67A 2PO4A 2GMJA 3DDNA 1VC6A 3MTKA 3R1HA 1NRKA 1S4EA 3SDEB 1NK6A 3DLHA 3TARA 1JLFA 4FPIA 1HLWA 4OI4A 3SQGA 2W2OP 4ANCA 1CJTA 4B3TJ 1OPZA 4ECUA 2IBOA 4YP3A 4NLGA 1Y9OA 2K3IA 4EBCA 1T05B 4NLDA 2I5JA 1S97A 4PKDB 2OLWA 2VG6A 4QIVA 3UDLA 2PE8A 3KUGA 2DGUA 4C0OC 2BKNA 4LRCA 2QYGA 3SCIE 5T7LA 4O3SA 3V2UC 1OIAA 1FK9B 3IG1A 4EI2A 1EZZB 3CF5Q 4LSZB 3J7Z5 2V0NA 4LF9F 1SCJB 4LF7F 3D5MA 3KLFA 4MIAA
chains in the Genus database with same CATH topology
4D3HA 1FNXH 1ZPWX 2OO4A 1M5SA 2YKOA 2MGZA 4FF1A 4HYKA 4MIBA 1BC6A 2UU9F 3R5BA 1SKRA 1JXEA 2YKNA 5I4MA 1S77D 3DFEA 2Z8QA 4ZVEA 1FNMA 2KT2A 2B0GA 2ROEA 2RD5C 3CUNA 1KNZA 3SI8A 3G8QA 4XIUA 3AB4B 4AUKA 2ZKUA 2UVVA 1L3UA 1V3SA 1KONA 2HFOA 3BEGB 3DRPB 4TY9A 3O2IA 2XULA 1S1UB 2F7VA 2ZOFA 5AJ3F 3M2VB 2R2TA 1ZTWA 1UP1A 2BRKA 5CYJA 3DLGA 4OHVA 1I1GA 3IGNA 1HBNA 4X65F 1JNZB 1SJ1A 1Y3JA 1JLGA 1E6VB 1UVKA 1C2PA 3VZIA 3OSPA 2ZH3A 4RKUC 5HP1A 4CH1A 4F8RA 4WYWA 2MZQA 2ZDPA 3JSBA 5G4DA 2CQGA 4B08A 5F41A 2DNQA 2HPUA 1QAXA 4NLPA 5LJ5Y 1J2VA 2FLPA 3MM7B 1ZTTA 3BGRA 4QIFA 3R1LA 2HNDA 2F8HA 4DL5A 2U1AA 4UY8T 1N32F 1HPZA 1NJXA 3DHXA 4HH0A 4C8MA 4X4NA 1RTDB 2RU9A 4B3OA 3IGVA 5MLCV 1VQYA 3Q0AA 3CDBA 3DRXA 4UUXA 1JMTA 2E1RA 1RI7A 2A2CA 3HP6A 3RAXA 5D4OA 2K7KA 4DFMA 2JHEA 2JLFA 3UFCX 4K5SA 4CO1A 2DGXA 5IM0A 1JJ2R 1XERA 2GMLA 1NH8A 4M95A 5BJRA 1FF2A 1VRUB 2YNHB 5DG8A 4ZPVR 2JEGA 3THTA 5IXUA 3MPYA 3PV8A 1U1KA 2YNFA 3MPWA 4DV6F 4PXBA 2FHOB 3HHLB 1QSSA 1VS3A 4H4KA 3AJ2A 2GCFA 3OVAA 4I2QA 1ULRA 2GO9A 1CSJA 2P5VA 1AUDA 3HO1A 4ED7A 2VG7A 3D0GE 3OTEA 3HVRA 2NZ4A 5CHCB 2JVRA 4ZP8A 4G3IA 1VMBA 1JLEA 2R4FA 1GH8A 2DHGA 2QSFA 4ZP9A 2XB2D 2PI5A 4OHXA 3ZZZA 5K14B 1WACA 1NHUA 3ZZOA 2MHNA 1JWWA 2EFNA 3E01B 3FMWA 4RW6A 1WHYA 5AE2A 5C42A 2X3GA 5KFDA 1IBLF 4ED5A 2KG1A 4URGA 2W8LA 3RR7A 3VAJA 3M8QA 1NNDA 2R8GA 3DRSB 3NMAA 4MYTA 5KG5A 3X1LB 4CTAB 1F5AA 1GX5A 1VQ7S 3LGMA 3OTOF 1RT5B 1RTJB 3UCGA 1OPIA 3RRGA 3JSYA 3QGHA 3RYLA 3BN4A 2YQ3A 4OJGA 4DL6A 1Q86T 5FIIA 3HMJG 2KXNB 3N0VA 2FDNA 3CJ4A 1ZBTA 4LUBA 1FRXA 1QE1A 1ZAXA 4B3MF 1QVFR 2DHAA 1REVA 2KO1A 4OI6A 4PQAA 3S6EA 2FJWA 4AYBD 2V4RA 2AYEA 2VC1A 3CDUA 4ZCMA 2J7KA 1Q82T 2LQBA 4NLRA 3OLBA 1N48A 4WFAQ 1U49A 4O23A 1HNIA 3MECA 2R8KA 1TVRB 2HMIB 3KLEB 4MKYA 2Y0SD 2XSJB 5J2NB 2JFKA 1JB0C 2J6SA 4O3NA 2FC8A 3IN5A 5KFXA 3VF0B 3POTB 2RB7A 4LT6A 1GX6A 2CPEA 3RW7A 4RNMA 1RWUA 4MH8A 3MEEA 5DGAA 1RK8A 5IWAF 1Y5IB 2KM8C 4C3LA 4EEYA 1HMVB 4NLUA 1FKOB 2ILYA 1N0UA 5KFIA 1S99A 4DSJA 2YNIB 3DXBA 1VK3A 4CO4A 4B3SF 1FDDA 2W7PA 2OPQB 1LWFA 2W9BB 4HI2A 2RQMA 4Q43A 2XY6A 1F60B 2UXCF 1E6YA 1APSA 4TY8A 1G1XA 3KWMA 5KFKA 1XR7A 3CMAS 3HHDA 4KO0B 4LSLB 2AGOA 3M30B 3KLGB 7FD1A 3G71S 5DGBA 4DV4F 2UP1A 2FHJA 5F8GA 5A8KA 5GAGI 3PW4A 2BR0A 4C2MA 4Y0FA 4DG1B 2HZCA 4OX6A 2IYGA 1R8AA 3FEXB 2BA9A 2QYCA 4LFBF 5EX0A 2AJQA 2MSSA 3HVWA 1TKZB 4M5DA 1U1NA 2CPFA 3HHKA 2E1CA 3DOMA 2KZZA 1WHWA 5DM6Q 2FTRA 1YJNS 2JLEA 3K7RA 5K9FA 4ZDNA 1NEEA 3LP1B 5JXSA 4HL9A 4MK8A 4CO5A 3K57A 3HJFA 2IJNA 2IYIA 2OSRA 3H2UB 5FLXY 2BANB 4QWAA 4RX6A 3OHBA 1H6KX 3G6ES 3QIDA 2B7BB 3SFGA 1ZPVA 2W8KA 2LQJA 1VRTA 2V4JA 3I87A 1N6QB 3MR2A 3RB3A 2J6TA 1UETA 3DOLB 1GXLA 3MEKA 2EFGA 4NLWA 4Q8EA 2HQIA 2VV5A 4ED2A 1DTTA 1JKHA 2JH3A 1HNVA 2JX2A 2HNYB 3SSRA 3FRZA 2VQEF 4ELTA 3P49B 2Q3PA 3ZZTA 1KQGB 1RT2A 3H59A 1HI8A 4KFBA 4LSNA 1VQOS 4IG0A 4DSKA 4F4YA 1IBKF 5LXYA 5A6WA 3WZ0A 2PDAA 2MY8A 5B0EA 3SSQA 1VIXA 3T3FA 2FVCA 3JTNA 4O3QA 1H0HB 1U45A 4LQ9A 1S1VB 1TV6A 2JEFA 5EWFA 4ECQA 3C66A 3WX4A 3CCZA 2HNYA 4X4RA 2E5GA 1IKVB 3J81Y 2RF2A 1WHXA 5CCLA 4K4YA 1IKYB 2J9CA 4Z37A 2DD8S 2ZOGA 4CO3A 2KRRA 3OR1B 1LWEA 3V6JA 1U6ZA 3O3LA 4RW7A 4NZ7A 2N82B 1Y5NB 2RNEA 1FEEA 3IR6B 4QZVB 2C3YA 1YHQS 4DQPA 1BQNB 3AA9A 2E1AA 2DNMA 2LVWA 3TO8A 3I4HX 4EFAC 1YJVA 3Q24A 1D9DA 1X7VA 3IRXA 2GNKA 3SFUA 1ZM2A 4AL7A 2VPZB 4F4WA 2HRUA 3OBIA 4DHVA 3OFHA 1RT6A 4ED8A 3CCUS 4DV5F 1GTEA 3T1YF 2VASA 3N5BA 4NYOA 4Y65A 4QWDA 4AXJA 4ETZA 1N56A 5K8NA 2XY5A 4YB1P 2NREA 3V6HA 4YUDA 1I94F 4DOZA 3RAMA 2DT9A 4DLEA 1WELA 2NUHA 3M05A 1TR0A 4OHYA 2L9WA 1FNOA 2CQ2A 4BC9A 4IRCA 4CNZA 3SEOA 3KYLA 4A8YA 4L6V3 2GHWA 2ADBA 3GB0A 4I7FA 2R2RA 3ETOA 1TL3B 1TZ0A 3DN9A 4WXOA 1MNEA 3TA1A 5KTQA 1SC6A 3KLVA 2BQRA 3HXMA 4DBQA 3EXCX 1SJRA 2DGOA 5F8LA 4DSEA 4IO9Q 1N33F 3F56A 3LF0A 2W9AA 2LMIA 3Q23A 2C42A 2JL9A 5HROB 1P1TA 3D28A 4H54A 5H9EJ 2L9DA 1ZM4A 2DK2A 2E7XA 2VB6A 2DIVA 1JNRB 2YKPA 4Q5VA 3WC2A 4F3OA 2YWGA 4IR1A 5E5NA 2KT3A 1UMJA 3KG4A 3HVTB 3U02A 3OL6A 2YNGB 1SL1A 2AYGA 4MMOA 3RBDA 2F1FA 3M9NB 1P6TA 3N5FA 3I0SB 3MI7X 2FHKA 4M63A 1ZAVA 3M8RA 2VOOA 3R5AA 3EGZA 1MROA 4DF8A 2OSQA 2VUGA 2ZH1A 3MDFA 3EYZA 4WU2A 1Y0HA 4MFBB 4PWUA 4HLBA 1HFEL 4R8UB 4DQSA 1KRPA 4NLTA 1FCAA 1IKWA 2KYZA 2MQLA 1S9FA 3LUYA 4IFYA 5D4LA 1VQ4S 3V81B 2JOQA 3MM9B 3PO4A 1ZH5A 2VA2A 4BHQA 3I31A 3PKYA 1S9GB 5B0DA 4F26A 2X1FA 3MURP 5HQ8A 3LGNA 1YJ9S 1DLOB 2PC6A 2DHSA 4L3NA 2MQPA 2UXDF 1KTQA 1OWXA 4YY3F 4EU0A 3MR6A 1LW0B 3SYZA 2IBKA 2BVZA 4USJC 4C8YA 3TAPA 5D3GA 1N5VA 3FGVA 3AJ1A 4Y2IA 4C0BA 4A4JA 3K59A 4ILLA 2E7WA 4DN0A 4ED6A 3VAHA 1NAQA 3C6TB 4J9MA 4RNOA 1UJ6A 4ZHRA 5F9LA 2DGTA 2AP6A 1S1TB 4EO8A 2JLGA 1GNKA 4TLQA 1C0UB 2XMKA 5F0WA 3MEGB 3RZAA 5KFGA 4ZPTR 4M8LA 5FJ4A 3HZEA 4OLOA 4RBTA 2M5YA 5L8RC 4F3QA 2MQNA 1FKPB 2OKQA 4ZPWR 4A8SA 4B3TF 4ZA1A 4NLXA 2MDAA 5J2MA 1KD1T 3CCRS 1WTFA 1JJHA 3OUYA 5HLFB 2I8EA 4PG5A 1C0TA 4I67A 4WZMA 2LCWA 4DL7A 1W25A 3N79A 1RGVA 4TNOA 4Y2CA 3JYTB 2V9WA 1SH2A 2WSEC 5KFOA 1T03B 1Y00A 4ES1A 4RNNA 3B78A 2AWZA 4IDKB 4A46A 2CQPA 5KT4A 4Y6IA 3V4IB 3QJPA 2C2RA 4QQBA 2GX8A 3JSMA 2JSXA 1Q8LA 2E5JA 3KNAA 1WD6A 4TN2A 3GG1A 3AAWB 2BE2B 3HFKA 1T94A 2KXHA 3KFWX 3HKWA 4TXSA 3VWSA 2VFVA 3BGFA 2ZD1B 3DMJA 4ATNA 4TKTA 3FJ2A 5D4PA 3FRYA 5EX3A 3WBZA 4O44B 3TI0A 3N6MA 4IFVA 5DJBA 2V4QA 4Q8FA 3G9CA 1EP4B 2XGPA 2HS0A 2AW0A 1S1XA 4PCQA 3KK1B 2NS1B 2DRBA 2YY3A 2R7VA 2UZAA 5B0CA 2C22A 4NPOA 4OX7A 3UD3P 2B9WA 3AA8A 2CQCA 3KLIB 3LP0B 5KG2A 4NCGA 4C11B 3I9V9 4M94A 1WEYA 5F3ZA 3M4XA 5A8RB 4LFCF 2ZHOA 3RB0A 4J9QA 4I2PA 1U1PA 3OL8A 3UCUP 2DNNA 3O8WA 2EG1A 2B4PA 4DFJA 5KFFA 3ITHB 2XGQA 4NYPA 3TW0A 1X5SA 1X4EA 3FDSA 1F9FA 5SUHA 4IRKA 2XEXA 1L5UA 3TANA 4LQ3A 2JRSA 4D3GA 4TU9A 3AH6A 3M32B 4OX8A 1S9EB 2JEIA 2QLXA 3ISZA 1VI7A 4WXWA 2PMZD 3UQSA 2IAJA 3GV5B 3GG0A 2FGOA 2LEAA 3IAM9 4X4TA 1FD2A 2EPIA 2MB0B 1TKXB 1WWHA 3GWCA 3CCJS 4PPZA 2Y1IA 1UVMA 4GKJF 2QE5A 1Y3KA 4OQJA 3MMJA 2PI4A 3MEDB 4A48A 1S6QB 3KLFA 3J7YI 2JC0A 3PW5A 2RVJA 5GVQA 2VC0A 4OMFG 5BYRA 2DR5A 4EGLA 3GYNA 5F8NA 2MJNA 5HMXA 5CZXA 1HBOA 2DR8A 4PUOA 3EX7B 5KT7A 2EFVA 3SMZA 2KN4A 3TVZA 2M3DA 2AJ1A 4P2SA 2RKIB 1CEZA 4QPTA 1Q7LB 1MU2A 4L72B 1HNZF 4XPCA 2ASJA 1LK5A 1JLQA 4HT7A 2K7JA 3H2VE 2OPPB 3DYAA 1S7HA 3UR3C 2RILA 4DR3F 2QA2A 4WCEQ 3IAS9 3N6NA 2R8JA 3NBPB 2Q6CA 2X1GA 4GC6A 2MQMA 1NK4A 5CA5A 1HWUA 2XMUA 2UUCF 3V6DA 4RW9A 3DM2B 4H4MB 2XNRA 3MM8A 5LMUF 5A8WA 4DR4F 4KKOA 1QTMA 5LSRA 1R7IA 2CJAA 3OXLA 2APOA 2GQQA 4RU9A 1UWBB 3PFEA 4DV0F 1KHWA 5ITHA 2ZH7A 2HGMA 2Q6BA 1VQ9S 4ID5B 4QR1A 4P7TA 3J80Y 1U8SA 2XMJA 5DQGA 1VHFA 2UUWA 2Z4PA 4CO0A 5I3QA 3GFXA 2OPSA 4ES3A 4WFNQ 4EBEA 1LKZA 3EZUA 4KT0C 2R7SA 1ZZNA 3QZ8A 3US5A 2WONA 1LFWA 2B6AA 1H7XA 1N88A 3IWLA 2BACA 4OZJA 2RDIA 2HS4A 3MHYA 2ZBCA 3MGJA 3DLKB 4ID8A 4DV1F 2PFFB 1NKEA 1M5KC 2WBRA 2EC0A 2ILZA 2ROGA 3CIMA 3PRDA 3I6PA 4NZ0A 4B02A 3OTDA 5D4NA 3CTRA 3CCTA 4JV1A 1JLFB 3NGKA 2CPDA 4YHHF 2WRMA 4LF6F 3SQGB 3G6YA 1MSWD 5J2QA 2QV6A 3OPKA 2RQCA 1XC9A 1KLNA 2HAIA 3T5HA 3MPVA 4DPOA 4K4UA 2BW2A 4G1QA 2FVSA 1DAXA 2D9PA 4IRDA 4NLVA 3BQ2A 4OLPA 4LJMA 1P8GA 1SUQB 2I5JB 2LA4A 3CO9A 4ZK7M 2KFZA 2DPIA 3EPGA 2KU7A 2ZH6A 2RT3A 3JTPA 4FS2A 2KHDA 3H98A 2XCPA 3W2VA 2VG6B 5B09A 5C5JA 4JYAF 4ELVA 4Q0BB 5GAHU 1W2IA 1ZM9A 3MM5B 4IOCQ 4I64A 3G6VA 1RT7B 4PG7A 1UJ4A 2WB4A 3NMRA 2VH7A 4RBVA 4HDHA 4ED3A 2WBMA 2FHJD 4J5OA 2C3MA 2KFNA 5L39A 1N36F 1LQ9A 4C3KA 1L3TA 2MZ1A 5FDLA 5T7LB 2NPFA 2YWHA 4EWTA 3DLJA 2PA3A 3VTIA 1GQEA 1KS2A 5BR8F 3M8SA 1KR4A 1R0AA 4BWJA 3UE2A 4IG3B 1VQPS 1JXLA 3IG1B 3OHAA 2OTJS 5HMZA 1SJ3P 4EZ6A 1QLNA 1X9WA 4OJ1A 4RLEA 1HD1A 1YI2S 3W2WA 3TVYA 1T95A 4P7VA 2XLJA 2BJDA 2HWTA 1YQHA 4X66F 3L95X 1H2VZ 3UDCA 2MJUA 4OZNA 1WI6A 5B0AA 1N5YB 1HR0F 1C1BA 2BXJA 3HM9A 1HQUA 3MM6B 3KHLA 4DWIA 3NKYA 3MAHA 3ZZYA 3KLFB 1ZZFA 3DNCA 1LV5A 1FJEB 4ZVHA 4UY85 1UKUA 1VQKS 2VPWB 3CJ3A 2MGZB 2XMTA 4F4ZA 4ILMA 4FNHA 4K50A 4I56A 1NK0A 3GFYA 2YKNB 2VFTA 4YEAA 4ZCLA 2ZH8A 4XPEA 1HD0A 4WFZA 3NAIA 4J9RA