4OZLA

Glnk2 from haloferax mediterranei complexed with amp
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
119
structure length
104
Chain Sequence
b'DLPNDGGIKLVMAIIRPDKLADVKTALAEVGAPSLTVTNVSGRGSDLHQKVKVECVVADTPAEDVADAIADAAHTGEKGDGKIFILPVENAIQVRTGKTGRDAV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrogen regulatory protein P-II
publication title The structure of a PII signaling protein from a halophilic archaeon reveals novel traits and high-salt adaptations.
pubmed doi rcsb
source organism Haloferax mediterranei
molecule tags Signaling protein
total genus 22
structure length 104
sequence length 119
ec nomenclature
pdb deposition date 2014-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00543 P-II Nitrogen regulatory protein P-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ozlA00
4YB7A 4C3MA 4ZK7M 2EG1A 1UKUA 2GW8A 3BZQA 1H3DA 5D4OA 1QY7A 3DFEA 2XZWA 2XG8A 4CO3A 3AA9A 4CO0A 4CO1A 3OPKA 1VFJA 1V6HA 2DCLA 4USJC 1PILA 3TA1A 1OSCA 4USIA 4OZNA 1O51A 4WK1A 2J9DE 2ZFHA 5L9NA 2GX8A 4NYPA 4CO4A 1NAQA 3AA8A 1GNKA 1VHFA 2GNKA 3T9ZA 4IYQA 4C3KA 4YB6A 2PIIA 1J2VA 3TA0A 2JJ4D 2J9CA 2O66A 2EG2A 2ZOMA 5D4LA 4RLEA 4USHA 3M05A 2J9DA 2E66A 3AH6A 1XK8A 2VD3A 3X3UA 1UMJA 1O5JA 1UFLA 4E98A 1HWUA 3TA2A 2V5HG 3LF0A 4CO2A 5D4PA 4YB5A 3MHYA 4Y6IA 1NH7A 2J9EA 4NYOA 4OZJA 4Y65A 2NUHA 4CNYA 4RWWA 4WK3A 2XULA 4R25A 4D3GA 1V3SA 2CZ4A 3NCRA 1UL3A 4AFFA 3GSDA 2NUUG 5DRKA 4CNZA 4RWXA 3L7PA 4CO5A 3O5TB 1NH8A 4C3LA 3NCPA 3HLUA 1Q1KA 3NCQA 1V9OA 1V3RA 4RX6A 1P1LA 3N5BA 1KR4A 3O8WA 5DS7A 2NS1B 2RD5C 2XBPA 5D4NA 4OZLA 1NZAA 4D3HA 2O67A 3AHPA 2Z0GA 3CE8A
chains in the Genus database with same CATH superfamily
2VFSA 1RTJB 4KGMA 2UXBF 4F3MA 3CCJS 3KHHA 1IVZA 5ETOA 3KK2B 4PABA 1O51A 3PVXA 4EZ9A 3IXQA 1QAYA 2YKAA 3BGRA 1KQFB 3RBDA 2OUGA 3VVUA 2XMWA 3M30B 4YFUA 3MR7A 3M05A 4JI0J 1Y5LB 2R8HA 2J6TA 1ZA1B 1S7HA 2ZZTA 3TOQA 5EN1A 4ZPDA 3VR1A 2C2RA 3K8WA 4U8YA 4L76A 4DSLA 4CLYA 3SQGB 3KDNA 2W9CB 3BM7A 1WC6A 1RQ0A 5F41A 1V3RA 2L3MA 4JI7F 1XMOJ 2XMMA 3ETMA 1FRLA 4DV6J 3V81B 4FDFA 4QW9A 2UVWA 4RUAA 1XR7A 3I31A 4Y3CA 3NBPA 3O2IA 4I69A 2UVVA 2ZOFA 3OL6A 2A6MA 4DR3J 5AXNA 3AA9A 5K14A 2BEFA 3BQ1A 2XLIA 3MMAA 1EQMA 3OTDA 4ZCLA 2BQUA 1NXIA 1F3VA 2WVFA 3N5FA 1RT6A 1NSPA 1FRKA 5GVQA 1N52B 2GVZA 4Z37A 1VRTB 1T05B 3NGUA 2LECA 4MIAA 4Y6IA 4PYDA 2B4PA 3MUMP 1GT8A 1NZ8A 1R7IA 4QYZJ 2W01A 1D9AA 2CKWA 1LWFB 3MM8A 1RTHA 3OT9A 2IMOA 1V9OA 3UR3C 4RX6A 2QSWA 3H4DA 5DS7A 3ILLA 3JQKA 2YNGB 2ZBIA 1NZAA 4OJ3A 3SCLE 2ZZNA 5JJBA 2JLEA 5E33A 5EUHA 2Z0GA 5C42A 4USWA 1X4EA 4ZK7M 1FF2A 3W63A 1KP6A 4IOBA 4M5KA 1C2PA 1IR0A 2QE5A 1BQNB 5D3GA 4F02A 2KM8B 1HBMB 4EYHB 2QEXS 5CYQB 3MUTP 3CCZA 2DNQA 2QO3A 1TELA 1TK5A 2V63A 1HNXF 2DIVA 2I5JB 3HMJG 1CG2A 1KBRA 1VLOA 3KLFB 4X4SA 5DG7A 1FKPB 3PZPA 2DH8A 4NCAA 1UVIA 3M6WA 2GC8A 2DPIA 2VG7B 4RNFA 1WHWA 3SZ2A 3VHQA 2W25A 3CJ3A 4CLUA 2YNIB 2DNHA 4NYZA 5F9LA 3HVTB 2XBPA 5GADU 5DETA 2L9DA 2K7JA 1C1BA 1CS4A 3PRVA 2P6TA 4OJHA 2K1RA 2RDDA 4PPZA 5K5MA 2BOPA 2RS8A 2ZUAA 5E5NA 3TEHB 2QA2A 2CJKA 2DH9A 2QRRA 2E44A 2QSFA 3H98A 3E01B 3QFWA 2B0GA 3JQMA 4LFAJ 1WORA 3D2WA 3T9ZA 2EBEA 2VJUA 1YRUA 2VPYB 4C7QA 2PIIA 4O4GB 1FT8A 3MCSA 4LRDA 5JMNA 1BD6A 3UWTA 4DQRA 1AZSB 2KYXA 3DYAB 1LW0B 1NKBA 2OTLS 2JSXA 2VZ9A 1GH8A 1H2VZ 1PC5A 3W5YA 2A2DA 4JI4F 4NXMJ 4C8YA 3DDNA 2MKHA 2C2ZB 4PCQA 3CCTA 2IMWP 1IKVB 1SJ3P 5BR8J 1B7FA 4W92B 2YNFB 3IGNA 4X84A 4NLOA 3PDNA 4B9VA 4ZVUB 2MB0B 4M1KA 3UD3P 4FF1A 4O3SA 4DV5F 1IN0A 1Y5NB 1WKLA 4PR6A 1VRUB 5F8LA 4O3RA 3BYPA 4U7UK 4DDFA 1LWXA 2HURA 1S6PB 2OD4A 4BC9A 3KWMA 1DURA 2LMIA 3OHAA 3CCMS 4QPXA 4DF8A 3PYFA 2ZBPA 1MW7A 1N5YA 3GJRB 3HSJA 4BWMA 4PG8A 2ZHOA 3CJTA 1WD6A 3R5AA 4CNYA 2OPQA 2R4FA 2KJVA 1IBMJ 2HHUA 1VQPS 3WQPA 1FK9A 1PAUB 2E1PA 2V34A 2HHHF 5DDPC 1H73A 1P1LA 1FRXA 1YDLA 2XSJB 1HBOB 3SI8A 1RLDA 4V19J 5EX3A 3EGZA 1RAEB 1W2BR 1QSSA 3IAS9 2M8DB 3DLKA 3IG1A 1AB8A 5JVGQ 4WU2A 3PM9A 5C7PA 1FJGF 2HHXA 5KFXA 3I5BA 2G1HA 2CIMA 3DI6B 1VQ8S 4IR9A 3LO3A 3K58A 2FDNA 2JWNA 1NJWA 1FXLA 3DCAA 3S7RA 1IKWA 2JC1A 5DJBA 4NLPA 3HKWA 5IWAJ 1IJFB 2DGXA 3T19A 4I7FA 1SC6A 3PFEA 3Q8VA 5L1KA 2ILYA 2KYZA 3PHTA 1B70B 2Y1LB 2ZZMA 1U6ZA 2UP1A 4UT4A 5KT7A 3LF0A 3AJDA 2CQBA 1PBAA 2XI2A 1ACMB 3GZ7A 2ERRA 1LFPA 2CPYA 3R5GA 3BR9A 2EFPA 2NREA 4LMZA 1ITPA 2NPIA 2GMJA 5CQGA 4CM0A 5KOXA 2MQ8A 2AX1A 5CXTA 4NLGA 3C6TA 4DSKA 2P9EA 2QMWA 4R0EA 3H5SA 4QIEA 1Q53A 4EO8A 4N76A 4DZ6A 1UKUA 2OEMA 5IOLA 1BY9A 2W24A 2DK2A 4DU8A 3TUPA 2U1AA 1RU1A 2P9CA 3OUYA 1RABB 4C6AA 4QWCA 4JYAJ 1PAEX 5KFGA 4LIRA 2MSSA 2VBWA 4J7CA 4FZVA 1N34J 4RW7B 4RW6B 5IM0A 3GV8B 4RLEA 5HMXA 1TR0A 4G1PA 4F4ZA 3UDCA 1SJQA 4U6PA 2XO6A 3HJVA 4FPIA 1CPZA 2VFUA 5EGYA 2FJBB 5DDQC 1J5EJ 3S6EA 2NR0A 2C28A 1D8YA 3KG4A 4GVBB 5HQLA 3GFHA 1HA1A 1Q8IA 3M32B 2E9ZA 4KHPF 4GMKA 4J5OA 3M6UA 3BF4A 1KLNA 3VAJA 1B4SA 3IS9B 2YWEA 2V2VA 3K7RA 4ZLLA 5D0GA 1T9UA 3EICA 3H4BA 4J9RA 1FKOA 3DRRA 2BJ1A 1HARA 1I1GA 4DR1F 3RB0A 2X51A 1VGYA 3LW5C 1EB0A 1RYRA 4LSNA 4M5IA 3K5PA 2VBZA 4DL6A 2P2CB 5RUBA 3ENVA 5ETMA 2IBKA 1OPZA 1JKHA 2WHOA 3GIMA 3UN2A 4B3RF 4WYWA 2KXFA 5KFBA 2DNMA 4UUWA 3UN5A 1WC4A 1H72C 3VTIA 4ELUA 3CJKB 3EZOA 2IDLA 3FUYA 1X5TA 3MR3A 4OZJA 5EHHA 2AGQA 4X4TA 3H8YA 2OPSA 9ATCB 3ZTOA 4ECSA 2CXEA 1RKIA 1LW2A 1MMDA 2C2MB 3L3CA 4NEZA 4OZ2A 2Y0SD 2IAJA 4DV4J 3MGJA 3M8PB 7FD1A 4AL5A 3TJ9A 2R2TA 4TLRA 2NZ4A 2C2NA 3GU0A 3OTOF 5C25B 1VQNS 4ECWA 1NHVA 2RF2A 1JLGA 1UJ4A 2V0NA 4P7TA 2HNYB 4JB8B 4P9SA 3TW0A 1WDDA 3IFEA 4LT6A 4IKAA 4IFYA 1KFDA 4LVNP 2X7IA 1FE4A 2RS2A 2WONB 5E41A 4OV1A 1YBTA 4DPOA 2PT0A 1HNVB 4DCOB 1EP4A 1KONA 1MMLA 4Y00A 2BE2A 2RB7A 2IM1A 2I9SA 4JI1J 1S1TB 3JSMB 3AH6A 4F0MA 4EO6A 4UQGA 2G0CA 4DUYF 2UXDJ 3HT3A 4KGXB 4DR6J 1DQ9A 5HROA 5ETNA 1PJ7A 4RW8A 3QZ7A 1CC7A 5U47A 1U0HA 3GSDA 5K8PA 2BVZA 3M2UA 1JLFA 4HLBA 3K5OA 2KHCA 2C3MA 1HQUB 1TL1A 2ZUGA 2VHGA 2A6OA 1IKYA 4DQQA 1NU4A 1F5CA 1U2CA 1JJ2R 1SVDA 3DMJA 4ZJLA 3B78A 1GMUA 2CZ9A 1X4GA 1OQ6A 3OTCA 2YNHB 4PWDA 1WHXA 3FGVA 3TAMB 1F2HA 3TA1A 2Z2MA 4S0MA 3VAHA 4URSA 3RB3A 2LU2A 2VG5A 3DLEB 2CPDA 2L48A 2VBYA 3MPYA 2VKRA 4BCAA 2VPXB 1NKCA 5KFTA 4I2PA 3NGKA 1SQFA 4JOUA 4OX9J 3D5MA 2J8AA 1S1XB 3Q86A 4QJVA 2RHQB 3SDEA 2W8LA 2LXFA 5IQ6A 4V19X 2HVIA 2CA9A 4NLWA 1VQ4S 1MWZA 1PJ6A 5FLXY 5DGAA 1UETA 1RTIA 4OI0A 3H25A 5KG3A 3R7NB 4ZN1A 2AJFE 4TU8A 4Q8FA 1S0VA 5KG0A 1HPZB 2VG6A 3D1QA 3UD5A 1S9EB 1GK8A 4CCHA 1IJEB 3TAQA 2E5LJ 4IG0B 5LSRA 3PG9A 4X65J 1G1XA 3ETOA 3A1YG 2G2ZA 4J9OA 2VFRA 2QYCA 4CTAB 2WOMB 1S6QB 2RHSB 3PTWA 4ZVTB 1Q7LB 2CJAA 2J7UA 4USIA 4WFAQ 2MY7A 2VA2A 2DKOB 1OY8A 1JNRB 1TV6A 2J6UA 2KFYA 4Q8EA 3GFXA 1M5OC 2HMIB 2EFVA 3H5XA 4OZ0A 2FLOA 2HGNA 3N6LA 4UZCA 1IR2A 4DL7A 1SUQB 4P6QA 2ZJQQ 2C2EA 4GKKF 4Q0BA 4P2SA 2UZAA 4F04B 3BO3A 2AF6A 4QYZK 2GQCA 2Z8QA 4ZPBA 4Q43A 1UAWA 2FJXA 4KO0A 3H40A 4X4RA 4ATNA 2QJ3A 5HVHA 2ZHBA 5CYMA 2CDQA 1T95A 4CM2A 4F8RA 2DHXA 1WI8A 4DPUA 4A8YA 3T5LA 1SJFA 2FGOA 1S10A 5CZXA 1H0HB 4USVA 2ROGA 1RBLA 5EWEA 4WYLA 3SCIE 2ZFHA 4CO4A 5E2QA 1XEZA 4L6V3 4BS2A 4FYXB 4R0JA 2ACMA 1NPKA 1WHYA 2OSQA 2QFIA 8ATCB 1DTTA 2VDHA 3KDOA 1VIXA 3TARA 2UV8G 3HULA 4HR2A 3C15B 4IQXA 4MKAA 4CH7A 2ZH5A 4OYMA 5KFYA 4NA1A 1K1SA 3DHXA 1KFSA 3NWRA 3C2PA 3UCGA 1RISA 3M2VB 2K3IA 1B3TA 2NXNA 1RGVA 4DCJB 1UL3A 3HT0A 3R5BA 5E3RA 3MAAA 3J80Y 2LA6A 5HBMA 4HKQA 3CO0P 4YB1P 1SKRA 2OFGX 3TZZA 1TUGB 1LNQA 4PWWA 3DGPB 3CCRS 1MMNA 3DOMA 1UWBA 4H4MA 3CUNA 4DV7J 2GMLA 3AOBA 3MOJB 4K4ZA 3HFKA 1TK8A 3MDFA 4WJBA 1WKJA 3MR6A 1RT1B 2ZJPQ 1HW8A 3IWLA 3QFHA 2ASDA 3Q89A 3TWZA 2IY5B 3PW5A 2FUG9 1GNKA 5FLXU 1R8BA 1LK7A 2PD1A 5E3AA 2KM8C 5D6GA 1NK7A 4PG4A 4A48A 5D4LA 1JLEB 2HQFA 1Q7YT 3KJFB 1RWKB 2HFUA 3RRKA 1K1QA 1APSA 5HP1B 5J2PB 2C3UA 4K4WA 1C4AA 4G6VB 1G7CB 1DFDA 2F8MA 4RW4B 3BDPA 5D78A 3NGRA 2YX1A 4MK7A 3QRPA 2FJAB 1Q0NA 4DL0C 3LAKA 5JXSA 5EDWA 3D3BJ 2QL7B 4A46A 1U09A 3PO5A 3RG6A 5KFIA 1TKXA 3A13A 2CQPA 5BXIA 3MMBB 3RAMA 4P2MA 3VAFA 3TUIC 4DFJA 1HNWF 4ILRA 1T94A 3MMCA 1VQLS 3K5LA 1J27A 5LMUF 3IRWP 2CPZA 2VU5A 2YWWA 4MK9A 1VBYA 3BQ0A 4NWBA 1TL4A 4CH0S 4IOCQ 1SKUB 5F8NA 1HFEL 1FVQA 3L7OA 4LVOP 2VOPA 5KFUA 3WC0A 2HIYA 1ZAWA 1FCAA 2EVZA 4C0HA 1FESA 3GJQB 2QLBB 1N5VA 3PFOA 4CI0B 1EETA 4KFBB 5KG7A 3V2UC 2B9EA 2MQQA 1HR0F 3NNHA 1N33J 3MM9A 5B08A 4NCBA 3CO9A 3KK3B 1FWKA 2Y3YA 3K8VA 3KJVB 2GVDB 4C98A 2W2MP 2HQDA 2JNJA 4CT8A 1SQEA 4UOFA 2XMKA 2UUCF 4ETZA 2W2NP 2M5YA 2EWHA 1PKUA 5KG1A 5K8NA 1QSYA 3PW4A 2NSBA 2A3JA 3DRPA 2CDRB 1B0PA 1S4EA 1P6TA 1JB0C 1NH8A 2D69A 1M5HA 4LF6J 1D8ZA 3MEDB 1AFIA 2JOQA 3GE9A 4J9SA 1EKSA 4YR0A 3G8TA 5ITHA 5DM7Q 5DG9A 3AD9C 5HJXA 1NEEA 2RIJA 3MR5A 3AFGA 4YB7A 4I68A 1VI7A 1TL3A 2WVEA 3QGGA 2GGPB 4AXJA 3NS6A 2X3DA 1FA0A 5G0RA 4FYYB 3ZZOA 2B9YA 2UUAJ 3KLGB 1HI1A 2AJQA 1VIOA 1DLOA 3KLHA 4NI2B 4N77A 4WFBQ 4CLFA 2WCXA 1SIWB 3GYNA 1U1NA 3CJ0A 4DV0F 3TVKA 1U1KA 1ULRA 2RQCA 3GMGA 2XY6A 2G2OA 4QPTA 5A0YA 1NB7A 3J80U 5K8OA 2LQ5A 3CW2C 2ROEA 4ZKAA 1U1LA 3HZEA 3FSYA 3D54A 3DDKA 5DO2A 4LQ9A 1DY3A 4IR1A 2L9NA 3FRYA 1IR1A 1U02A 4CLZA 1HNXJ 1EARA 2WVDA 4KGVB 1DJ0A 2NXJA 2HKEA 3G8QA 4FBTA 3V6HA 3V6DA 1GX6A 2HFSA 3RR8A 4NLVA 3EDQB 4KE5A 2KXHA 1HWLA 4JI0F 3CB4A 3MR2A 2XS7A 2KT2A 3M4XA 1RA6A 3G9CA 2QMUB 2PN6A 1W26A 1SC4B 2PA8D 1DRZA 1S4FA 2EFQA 3BYRA 5D8HB 3FEXB 1MN9A 1M5VC 4DS4A 4WIIA 3Q0AA 2Y0BB 4HI1A 1T03A 2CPXA 2GA7A 4LF4J 1C4CA 3BO2A 1XMOF 4QU7A 4K0KF 4KPYA 4DFPA 3H7HB 4ECUA 1ZM9A 2FHKA 2H4YB 2FJDB 2XCPA 4IOAQ 1RBOB 3R1HA 3HVAA 3GIJA 3KK1A 4K2JA 1NH7A 2HNDA 2NLWA 1S1VA 5ETTA 2H65B 1RADB 1HWIA 4CWBA 4XPEA 4QOTA 3E8OA 3AB2B 2YH1A 1KVKA 3HLUA 1BMQB 4F2SA 4NX9A 4ZP9A 1MWQA 3HK2A 3D3CJ 2Z56B 5ETRA 4RR5A 1CJUA 4NLRA 1VK3A 1ZTTA 3F41A 2W9BA 4ILMA 3C16B 3HHLC 3ITHB 4ICLA 4W4MA 4AD6A 3MECB 3BDEA 3SSSA 4PKDB 1BHNA 3QT5A 2QA1A 3UE2A 1YWXA 2V50A 3WBZA 2Q79A 4C4WA 4LUBA 4LF2A 2GO8A 1S9FA 3CJQA 1RT7A 5F8MA 3GIIA 2OO4A 3K0JA 4DV5J 4U67Q 5L46A 4OI4A 3BGRB 3RB6A 3TUZC 2R3VA 3HX9A 1BLUA 1QVGR 4O0IA 2XWYA 2RH3A 1IWGA 2LQJA 1FO1A 3CTRA 2JEIA 2CQ1A 4PXDA 4ENOA 2RRNA 5J2NA 1JJHA 3MPUB 2D9OA 3NS5A 2NXEA 5DZ7A 1ZPWX 2YWKA 3RJMB 2OGUA 1WNEA 2W9AA 1BQMA 2FJEB 4C3LA 4OL8A 1JQGA 1VQSA 3MPDA 4LREA 4ID8A 1X0FA 2Q3PA 2JRSA 3NBPB 4UOGA 4L73A 1JNZB 2A1BA 4UZBA 3PRBA 2IJFA 1HBUB 2EFGA 2DR8A 4DL3A 1PJ5A 4USJC 1WC3A 4HH1A 3U7JA 1GMVA 4NMXA 1HNIA 3FZBA 1IQTA 3NS7B 1FJGJ 1RUSA 2QL5B 5HN0A 2I6WA 4TU9A 1SH2A 3TP2A 1VC0A 4DG1B 1E6YA 1RT6B 5A8WA 2LA4A 3IMQJ 2GVZB 2K7KA 4WP8A 4B9SA 4LR8A 3I9ZA 4RW9A 4ZVFA 2IVYA 2YKNA 3NRBA 1G4CA 1WUUA 1H2UX 2PMHA 4R8UB 3FZ2A 1BGXT 3NCRA 4MFBA 4LFAF 3MM8B 3BPDA 3W8PA 4DLGA 4JUZA 8RUCA 4CLSA 3E2EA 1UVLA 1RBAA 4TNOA 3DKDA 4HHUA 3QPIA 5KFQA 2B8PA 1KLMB 5C42B 2YPZA 3QSIA 2FC9A 2XI3A 1VK8A 4JP8A 4NXMF 1JMTA 3OV7A 4DU7A 2DR9A 1U1QA 1P9QC 4QW8A 1XMBA 5DG8A 5BR8F 2W4PA 2FZCB 2CNOB 5B09A 1SI9A 5F8HA 2WZ1A 1ELOA 3VCDA 5EWFA 1NSQA 2W1BA 4K59A 2DYAA 2MGZA 3PEHA 4B9TA 4Y2MA 4PQUA 4MJKA 4CO2A 2NZCA 1GXTA 4ERDA 4HL9A 4FXVA 2PMZD 1DQ8A 1GXLA 3WZ0A 4FP9A 4AL7A 3M1VA 4WF9Q 3V6KA 2P5VA 2RU9A 1C1CB 1MWYA 4XDDA 3M8RA 3MEEA 4X4OA 5KT4A 1HQEA 4C8MA 1WEZA 3HCXA 3HSGA 1N6QB 2BOAA 4K4UA 2HBYB 2BQ3A 1U4BA 3ZXWA 3N0VA 4KHPJ 1RT3A 2C2KB 2OHDA 1NJZA 1OWXA 2D3ZA 3FFIA 3VZIA 1RWMB 3DLJA 1IBLJ 5MAOA 3NG8A 5KOWA 3CJSA 5KT5A 2AKWB 3AQPA 1U25A 2XYGB 3HKZD 2DNKA 5KG4A 3BBBA 1RWVB 4NA2A 4ED0A 1PGZA 1QTNB 1FHTA 1V3ZA 4OHWA 4KQZA 1JLAA 2ZOGA 2CVEA 3QO9A 1RHKB 2DGWA 2W2PP 3G86A 1UVKA 1H2TZ 3G87A 3ENQA 2XMUA 2PFFB 3NAHA 4YR3A 4IH6A 3OR2A 2HRUA 3ZZRA 2XGQA 4P52A 4B3RJ 2HZCA 2DTJA 1WEXA 2NSCA 4WE1A 5CCMA 4DHVA 3EVMA 3UDLA 3RBZA 2GHWA 3NCQA 1XTZA 3UQSA 3OLAA 4N47A 3FQKA 5IWAF 4FPRA 4NXNJ 4NRUA 3T6JA 4I64A 1R0BG 2BDPA 3CDEA 4ZP7A 3UVJA 2MQLA 2MMYA 3N6NA 4DL2A 5LMNF 1GFWB 1L5UA 4JV0A 1FXDA 2CJXB 3N79A 4I2QB 3CT9A 1UEVA 4K5RA 3CCQS 4DR4F 2DGSA 4EMDA 2HWTA 5DGBA 4MKBA 2GJFA 4J91A 5IV4A 3IR5B 3L7UA 4PQAA 4U7UD 1XJWB 2R7SA 5DQIA 5HANA 1NK9A 3DLGB 4CRJA 1ZBTA 1KHVA 1CVJA 4DR2J 2EEYA 4MYUA 1RCOB 2ZE2A 4QCLA 1WOOA 3AXMA 1QE1A 2N4CA 1KKHA 4DR7J 2ZH8A 2BW2A 2BQRA 4ANCA 1VOMA 4X2BA 1XNQF 2RKIB 3ZNUA 3KTQA 4JYAF 2CPHA 4CYUA 4J9MA 4DUYJ 2ZC4A 2L41A 2G13A 1N34F 2YPYA 2Z58B 1YBAA 3K5NA 2J8SA 2YY3A 3H0PA 1NJYA 2IM0A 2ZD1B 3KLEB 5AJ3J 2N82B 2BMBA 2V4JA 2O67A 2O5DA 1HYSA 2MHNA 3MM6B 3MM5A 2VKZG 4E2FB 1SXLA 2ZNYA 3VAGA 1D9DA 4ZHRB 2J6SA 1SV5A 2XC9A 3UW1A 3I0SA 3G2XA 3DLKB 4WTYA 4TY8A 3W9HA 1DAXA 4TVAB 3NKYA 2M2BA 1JLCA 1RTJA 4EBEA 3JTPA 4FS1A 3IGVA 3PV8A 4EWTA 2IYIA 2NXCA 4YB6A 1YQHA 2CG4A 4USKA 2V2QA 3KK2A 1RWPB 4B3TJ 3PHEA 1CJVA 1A0OB 5A8RB 3UR0A 2J76E 2E5IA 2HNZB 1HNZJ 1H38A 2ASYA 2DCUB 1R8PA 3M30A 3D6TB 5IC6B 3T6BA 4ZJQA 2ADBA 3H2UB 2ZWOA 3NGTA 2NYIA 4DQSA 5KG2A 4A8FA 3QSYB 4OX7A 1RAAB 1KQGB 1F9HA 2EKYA 5HSPA 3ELHA 3M8WA 3SQGA 2W9CA 3IP0A 3Q8SB 2Q66A 2HQ3A 3R5DA 3R6GB 2V8HA 2Y1RI 5CCLA 1D1UA 2X1GA 3FK4A 1O0PA 2RAQA 1YKWA 2FPHX 1QTMA 1WI6A 2F65A 2VIHA 4OYBA 4PUOB 2JHEA 4I4BA 3JS9A 3FBFA 3POTB 2YTCA 2H5JB 4U9RA 3GJTB 3QGIA 3RW6A 3AD8C 1QAJA 2IPOB 4FF3A 2OEJA 3KFWX 5KFHA 3OXGA 2LEAA 2WW8A 5GAGU 1Q4RA 1GX5A 3CSKA 2ZC3A 1VRTA 1T05A 3MCOA 2FZGB 1OIAA 2AJ1A 4OIXA 1VQ9S 3SEOA 3I96A 2POKA 4N8NA 3ZFVA 4GKKJ 5I3QA 4JI1F 4J9KA 1LWFA 2I0XA 2G0IA 4IFVA 1SJ1A 4C3MA 2UXDF 3ZO7A 4QU6A 2C42A 1S59A 4OJ1A 2QT7A 3CNQP 4DR6F 4DV3J 1UFWA 1YI2S 2YNGA 4ED1A 1P8GA 3DGVA 1OS5A 3TX0A 1PBUA 4Y2AA 1R3NA 2IYGA 4YOEA 3LUYA 4PG5A 4LSNB 1X4AA 2QLJB 1XNRJ 1PC4A 5CHCB 3QRQA 5H9EJ 1BQNA 3GIRA 4NRTA 4ED4A 1F0XA 3AJ1A 1HBMA 1T3NA 5CH7B 3PYDA 5CYQA 2CQ2A 5KFRA 1D9FA 2GQ2A 1FD8A 2NCKL 4OI3A 1X5SA 3K57A 2PA3A 3F44A 2BKOA 2AJ4A 4ZOSA 3MAHA 4DUTA 2JLGA 5IZHA 2I5JA 5B0BA 2VFTA 2YX7A 2IRYA 1RWWB 3KNAA 4KV8B 4CNZA 3KLFA 1LW2B 2XYPB 3O5TB 1FKPA 4B9LA 3TRGA 1HMVA 3JSBA 2IAJB 2DGTA 2R42A 4X64F 1VC5A 1T11A 2C3YA 1M0SA 2VG7A 2AYBA 2E7VA 1H6KX 4ZVPB 4F26A 3BBCA 3UPFA 1UA0A 3J7YI 3BJYA 4WKRA 1T9VA 4NLTA 3GFZA 1J5OB 2RF2B 1WOSA 4B9MA 2HK2A 3MD1A 4HTIA 1B0VA 3HVTA 3HXMA 2B56A 4CO1A 5H9FK 4IFYB 4DPTA 1NB2A 3CJ5A 2LEBA 4LQ3A 3B8HA 3HZGA 2DNPA 2G1DA 1LWCA 1ZPVA 2DHGA 3E01A 4ECQA 1BXNA 4X65F 4K4SA 2SXLA 4EK2A 3MF5A 4GRSA 4OZ1A 3ISND 4O4GA 2J5AA 2RJZA 5L1JA 4Y2IA 3CD0A 2Y1IA 3Q2TC 2JEJA 2P9GA 4FVCA 1RT5B 3LWLA 2MDAA 1OYDA 4DJBA 4WFYA 2CQDA 1AZSA 3B4MA 1LQ9A 1LW0A 1U0HB 1CJKB 2B9WA 1EAYC 1M1HA 1U7LA 4CP5A 4NZ6A 1UZDA 4HTJA 4KGZB 2WBMA 3WIUA 1IKYB 2HHSA 1IKVA 4TQRA 4P73A 2Z57B 3J7ZT 5T14A 3OR1A 1U26A 4L75A 2YNFA 5KFMA 2OELA 4LF9F 1IM6A 1HNWJ 5LMUJ 3TZYA 2CPJA 1RXOB 2CAJA 3OPKA 4MMOA 4YR2A 1FX4A 5KFDA 2F5GA 3T9NA 2F40A 4F7VA 2VG5B 4HHJA 3FBEA 1VRUA 4MKVA 4ECTA 2FVQA 4EBCA 2K2PA 5J2MA 3IAM9 1UW9A 2X1AA 1S1WA 5DDOC 2DVIA 1HR0J 3AD7C 2MPUA 4J9NA 1AYEA 2ILZA 2R7XA 5L38A 2BYCA 3A8JA 5D77A 3F73A 1RTIB 2KRBA 3MZIA 1B0TA 3ADAC 1X5PA 3PIPQ 1RWUA 1TK0A 3G6XA 3GYXB 1YIJS 4FYWB 3D0HE 2CQCA 3QBCA 4D3HA 1DARA 1S0NA 1FNOA 1A6LA 5F8GA 1B7YB 2OPRB 3FC9A 1M1KT 1YITS 2L9WA 2XSJA 3B54A 1F2GA 1T9WA 1KC8T 4HACA 4KKOA 4DL4A 4WTOB 2FY8A 1UA1A 2G9OA 1TV6B 5F9NA 3GG0A 2J9CA 2HGLA 4DOZA 2QFJA 4TYAA 4NMLA 2AU0A 3DI6A 4F4AA 4MK8A 1FDNA 4DV7F 2BKNA 3P49B 3LALA 3OVAA 1R8HA 1S79A 2NUHA 4HDGA 3I0RB 3FSXA 4JI6F 4ED8A 1YSJA 1NUEA 3FMBA 4ID5A 2Z2LA 3QATA 1EQ0A 3ZZUA 3GQCA 2OAUA 1U47A 2CWXA 2MQPA 2GAHC 1Y4ZB 3H59A 4QWBA 2UVRA 2OTJS 3KXDA 2KO1A 2KFNA 2FLLA 2MZTA 2OFHX 2E1CA 3DFEA 3PW2A 2CZVC 1ZETA 4RUBA 1L3KA 3RBEA 4DFKA 5A6WA 3PCOB 4CO0A 3SYZA 3HHLA 3D1HA 2G4BA 1AUSL 3OL9A 4F4KA 1JWWA 2V8PA 1R31A 1P1TA 2HLTA 3TA0A 3DLLQ 1M5KC 3NMRA 5ETVA 1HWUA 4W98A 2VUGA 4RW7A 3HHKA 4RW6A 1WTBA 3I56S 2AYMA 1TKDA 4DLEA 2ASJA 2BACA 4JI8J 1SCJB 4K0KJ 5A76A 4DZDA 3E51A 2CZ4A 2KH9A 2ZVSA 3EDRB 2CVIA 2FLNA 5HK4A 2XTJP 3MAAB 1NCLA 1YG0A 4ANEA 4P2FA 1K73T 3PKMA 3ZTRA 1ZZNA 2KI2A 2BKPA 4Q2LA 3EX7B 4ED7A 3N5BA 1N33F 2QZ8A 3BR8A 4X4NA 5JVHQ 2E5HA 1RACB 1URRA 1BQXA 4I1TA 3HJFA 5LM7E 3MURP 5HATA 2W4CA 4QIVA 3D4JA 3JAMY 2FB0A 2MJNA 3R7SB 2MXYA 1UVMA 5L9NA 3IS9A 4QIGA 4OHZA 3T5HA 4LF6F 4EZ6A 3J81j 1NHKL 5H1SV 2N7YA 3JQJA 3EWGA 1M1GA 4DV2J 2IRUA 4M5MA 1RCXB 2XLJA 3ILIA 2EI5A 2WRMA 3VAIA 5AT1B 5DZ6A 2IC3B 3VZHA 1DZ5A 2G0JA 2UUAF 4MKYA 4R25A 4JV2A 2F4VJ 3BGOP 2R8IA 1X9SA 1VS3A 1RB0A 4URQU 3LTOA 3NMAA 3NNAA 1MROB 2GJ2A 1CLFA 1NDLA 2F1FA 4E0DA 1TKXB 3OFFA 2AGPA 3D0IE 2PEHA 4V1Ak 3MMCB 2W7PA 4X4PA 2EG1A 1WJ9A 3O3LA 3OBIA 2DXEA 4FXDA 2HQCA 1UCNA 4CO3A 3BO4A 3RAQA 2EW9A 5C25A 3G96A 1WSVA 3FNNA 3QAEA 3T1HJ 2J7KA 3PW0A 2E5JA 2HNYA 4Q44A 3VQSA 3MPVA 3KHRA 2VONA 3MM9B 3MM7A 1TL7A 1PCAA 4K7QA 2WONA 1Z1ZA 3C6UB 1UFLA 4HEA9 4X4VA 2DHSA 4ANDA 3PJ9A 1U6BA 2ZH3A 2QX0A 3R2CJ 2E1RA 4J9PA 1ZTWA 1RAHB 1S1TA 4O3QA 1VYAA 2XS2A 4K4VA 2KB2A 1T9XA 2BR0A 3D6MB 4DUZF 1RT4B 4LF4F 4TY9A 1X9MA 1SL0A 1LWEB 3DU5A 4IQMA 4LBIA 3TEGA 4CH1A 1IXKA 1IM4A 4KAIA 3D1OA 3CMAS 1TVRB 1TL3B 2XZTB 3CD5A 1HQUA 4DN9A 1NDKA 3QT7A 3WHIA 1VC6A 2AWZA 2QMXA 4OX6A 4IRCA 3GCXP 2RQMA 3M9MB 2MJUA 3G82B 2FIUA 2VC1A 2QA4G 1T9YA 4ZDNA 1FTRA 1FWPA 2YNHA 1SKSA 3M2RB 5ETLA 1XMQF 2MZJA 2D9PA 4Z7CA 3C66A 2VDIA 3HHNB 2WAQD 3G71S 1MSWD 3AB4B 1RU2A 1X4BA 3MTKA 2B6AB 2U2FA 1S1XA 2RSQA 3B4DA 3JAMU 2OIHA 2D3O1 3HSZA 2NS1B 4KBIA 3BGLA 5HLFA 4EBDA 5I3UB 2MZRA 2ACYA 1BWEA 4C8ZA 4AUKA 3MD3A 2ZM6J 4KJIA 4DL5A 4XPCA 1HPZA 3U02A 5HVGA 3Q24A 1S9EA 2HFZA 1NSAA 4IG0A 2FVRA 1OPIA 3K59A 3Q8YA 1S1UA 2J9DE 3TVYA 4CTAA 1U2FA 1S12A 4NPOA 5ETQA 1R27B 4OI2A 4O44B 2AYGA 3I6PA 3PKYA 3QGHA 5D4PA 5KFKA 3I82A 1BC6A 3KLIB 3KK1B 2ALYB 2D7SA 2BANB 1X0PA 2HMIA 4CQ1A 2HNDB 2V69A 4MH8A 3LGHA 1S1VB 6FD1A 3IM9A 5K9FA 4AFFA 2DD8S 4IH7A 4KYZA 4X62F 2DNOA 4KPCA 1SUQA 2QC3A 1Q1KA 2X1FA 2IJRA 4P7VA 1XC9A 2B8QA 2EPIA 2N4DA 1CBKA 5K8MA 1C0TA 2MYFA 2N3LA 5D0EA 5ETKA 2VODA 2K3KA 3WX8A 2B4OA 1TP7A 1HHQA 2X3GA 1XR5A 4K4XA 2ZH4A 2XCAA 1HD1A 3IR6B 3PW7A 5CABA 1W2IA 2H4WB 3IO1A 2OKQA 1RDRA 4NCGA 1PILA 1TL5A 1YJRA 2XLKA 1BUXA 5LMNJ 3L09A 1SC3B 4B02A 2VQEF 1CC8A 1I6JA 4OYWA 4XK8C 1IQZA 2KKHA 3W2VA 4DR4J 4TYBA 4ALZA 4DV1J 4AT1B 4IDKB 3QRRA 3CXCR 5H9EK 1FDDA 2MKIA 2CPEA 1QVFR 2J7WA 3QGPA 1Q8LA 1SBRA 1HWKA 3J81Y 2HWHA 3ENAA 1REVB 1QJHA 1WF2A 2RVJA 4ELVA 1ZAXA 2PMWA 4BHQA 1VMBA 3OFHA 4ZJOA 1BQMB 5D0RA 1D3WA 2Q43A 3M2VA 3DRSB 1XNQJ 4FYDA 1VR6A 1RAIB 4DF4A 2YQ1A 3QT8A 3CF5Q 1FNXH 1H3DA 4OHYA 4NA3A 1R0CB 2OH2A 1SKWA 3SFGA 1DTQA 3DGPA 4R5PB 1OSDA 3HHDA 4L72B 3B82A 2R9LA 1T02A 2YKOA 3DHWC 2FVSA 2XMTA 2JVRA 3ZZTA 1VQMS 2JH3A 4ED2A 4B3SF 3QT6A 1HNIB 3QIDA 5C2GA 2C3OA 2ABYA 1RA7A 1WOPA 1KDNA 2H54B 2BRKA 4UY8T 3CIZA 1F6TA 2YKMA 1S48A 5C5JA 1PYOB 4NLXA 5GMEA 4WU3A 3K17A 4LJMA 4QZVB 4KHMA 1PO6A 2DB1A 4RW9B 7FDRA 1Q16B 1RAOA 4P10A 1IBLF 2DNNA 2WB4A 2C2OB 1Y9OA 4PAAA 3M7VA 5HP1A 5DRKA 3WC2A 4OHVA 3J7A1 4RW4A 3P5TL 4C2MA 1ZYQA 1KR4A 3CD6S 4LSZB 2FHMA 2RDIA 1XBWA 2VJVA 2YX4A 4QR2A 4KTQA 2Y9HA 2IVFB 6FDRA 3L4BC 3MMBA 2XG8A 2HVEA 2N3OA 1BWVA 4JI2J 4B3OB 2LLZA 3NGSA 1OSCA 1KWMA 2PGCA 1FDBA 2MEWA 2QL9B 4PWUA 3R2DJ 4ZVRB 4LFCF 1XQIA 5BYQA 2MKSA 4F3OA 3BGFA 3DM2A 4NXNF 2RMLA 2VD3A 4USUA 1WF0A 1O5JA 2MKYA 2A18A 1EZZB 5C24A 5CD4H 4A8MP 3OJSA 2E5GA 4OLPA 3IRXA 1T9TA 5DLFA 1VBKA 3MCNA 2H5EA 5EX0A 2Q1LA 3BKUA 2JX2A 2PEBA 4BWJA 1N56A 2DRAA 5J1EA 3FQLA 4FKXA 3T3FA 3UFCX 1SPBP 1HQEB 4ITSA 4DR2F 2VQFJ 4JI3J 1RHJB 4N7TA 2BABA 1WKKA 1A9NB 3ONQA 3BBFA 4DR7F 2HHQA 4M5GA 1ZA2B 4L74A 4H4OB 4FN5A 5HI7A 2CNNB 4IG3B 2DGOA 2MZSA 4RU2A 2R7TA 2CJBA 4QIWD 5FD1A 1YJNS 1NAQA 2AP6A 2GGPA 4AL6A 3UD4P 1FDAA 4B17A 4WBFA 2MZ1A 4KT0C 2DJWA 3J81U 5AJ3F 1URNA 3KLGA 3JTOA 1Q5VA 4O3PA 2DY1A 3DOKA 4RNMA 1QM9A 2VBXA 2CQ0A 3QO9B 1TKTB 4GC6A 2ZJRQ 3EVOA 2VL1A 4C0OC 2DXDA 3PX0A 1V5IB 1R6YA 2J9EA 1RT2B 3OR2B 2V94A 4OYOA 2P6SA 4O4RA 4NL5A 3W5ZA 2OMOA 4ZCIA 1K8AT 3MTJA 2ZEJA 3LP2B 4WE1B 4DFMA 4C8KA 4EFAC 5IQQA 2OPPB 4LF7J 4ECZA 4UTGA 1NPRA 3GR0A 4OHXA 2PC6A 3C3LA 2M52A 3BGUA 5B0AA 3VGTA 1NDPA 4B3TF 4FNHA 2V9WA 2YQ3A 4C48A 3ET6B 1GEHA 4Y0FA 3UVJB 1T7PA 1HNZF 3BSNA 4EGLA 4O3OA 4X64J 1X8DA 1SC1B 1UWAA 1I5OB 4OI1A 1LV5A 2BE7D 4RBTA 2HZVA 2DR7A 5KT6A 3MMJA 3QQCD 1JJCB 2BJ3A 2DY9A 3AQOA 3OJUA 4ELTA 2FVCA 1JLBA 3S1TA 2V5HG 4WIQA 3I32A 1ZH5A 4M5HA 1YGYA 3MUVP 1PSDA 1N32F 4HYKA 4NLQA 4F2RA 1RI7A 2M3DA 2CADA 2JVOA 3D9BA 4WPAA 2IM3A 4ES3A 3VF0B 2BJ8A 3FRZA 1Q82T 3OL8A 3IBCB 4OMFG 1GMWA 3MWBA 3ICLA 5DQHA 1R8AA 4ECVA 1CJTB 2UV8A 1FXRA 4G1QB 4OFZA 3OL7A 3N6MA 1SV5B 1PIEA 4F50A 3UNYA 2RILA 1N4LA 2XHWA 3OVBA 4TY8B 4LR9A 3GV5B 2F9JA 1A7GE 5E3CA 3FSIA 2GAGC 3C16A 3ITHA 3R5CA 2XEXA 2YKPA 2MZQA 3PR4A 1N0VC 3MECA 2BX6A 3HDSA 3VAKA 2B5JB 4LF9J 5IT4A 5KFFA 2IFXA 2LDIA 3QJLA 2UU9J 1FJEB 2JZ5A 1HI8A 5I3PA 3HD2A 1CJVB 2XMVA 3EZUA 1G6BA 2BV3A 2QIFA 4DV3F 3R27A 4O0NA 2LCWA 5IS2A 1NJIT 2QV6A 3WIVA 3RR7A 1R6VA 4RWXA 4LR7A 4CO5A 5BJRA 1LK5A 3RUBL 3BS9A 1REGX 2KT3A 3O8WA 1XNRF 2OMLA 2HEKA 3CE8A 3CCES 2CPIA 3RAXA 4ZLJA 1UP1A 1RLCL 4I6YA 3M8QA 2MTLA 3UI3A 2HS4A 1W7WA 1FWLA 3MEGB 4ZS6A 3TUJC 4ZMMA 5GMKa 1V6HA 3DRYA 4OQJA 1RAJA 1S9GB 3IBWA 4K8RA 1L3SA 4L3KA 1HBUA 1KN6A 3RRGA 2FQQB 2R2SA 1UTAA 1RTDA 2IHR1 4M5DB 4LBHA 2EFOA 3HF5A 4G1IA 1SH0A 2ZH9A 5K20B 1FE0A 1HHTP 3V5RA 1RK8A 4OI6A 4EYIB 4RPFA 4RJVA 4DG1A 3QIPA 4D3GA 4ZA1A 1KVIA 1RAGB 4ZPWR 3DOLB 1B99A 3UNGC 1VCTA 4P71A 4NOHA 2W2OP 3W65A 4R8UA 2DO4A 5KFEA 4JI6J 4HHHA 4DPWA 4ETXA 5L39A 1D09B 4IFVB 1I94F 3J7YU 3OSPA 3CJ2A 2CPFA 1KLMA 2R7QA 1S97A 2KG0A 3CULA 4IYQA 5J2QB 4I6AA 1WTFA 5B0FA 3A3NB 3EE3A 1RWXB 1XK8A 3OQ2A 2FJWA 2XB2D 2Y8WA 2EFNA 4E98A 2FVPA 3LWMA 2JLFA 3V4IA 1RKJA 4AYBD 2GJIA 5HO4A 3FBBA 2E7WA 2H1YA 1FTCA 4RWWA 2L08A 2WK4A 4Z2XA 5IT0A 2VB6A 3GYGA 4IUFA 4OJGA 1AW0A 1HMVB 4PEOA 4U7CA 5HQMA 3RZAA 1M90T 1QUPA 1SQGA 1GXUA 1C1CA 1K0VA 1MU2B 2MLZA 4UOCA 1RTZA 2LDYA 4C8LA 2RU3A 5FDLA 2E29A 2DGVA 4NASA 3OW2R 1N6QA 1YJTA 4IO1A 1OY6A 3CDWA 4KRWA 3M8YA 4LFBJ 2GNKA 5KFSA 2GIFA 1VJQA 5CYJA 4P75A 2HYIB 1LWCB 3EXCX 3TJ8A 2DISA 2EXUA 3MXHP 5E3PA 4M94A 2DNLA 5E3QA 4XO0A 1U45A 3W2WB 3HO1A 4RL1A 5IFMA 2ZKUA 2ZWPA 2CFXA 1WDTA 2V9KA 4WK3A 1JXEA 2F9DA 3ZC4A 3AXKA 3H20A 2HHPA 4DMZA 5E7OB 3M8ZA 3PEJA 2NPFA 4NE9C 3OTEA 2E9RX 4ZP6A 3SFUA 3KMSA 5D0HA 4FKYA 1R43A 3DNCA 4ZPVR 4G3IA 4CZCA 4G65A 3ZTSA 2QLFB 2EKNA 3A8KA 2D1CA 3OR1B 5EWGA 1E6VA 3QLHB 5IXUA 4DR5J 2WVCA 3OXLA 4NLDA 3VGVA 4M63A 1U8SA 3M9OB 3HI9A 5JUMA 2AW0A 3CC4S 1G3OA 1RE1B 5T7LB 2AJ0A 4I2QA 2Q6CA 3SV4A 4GO5X 1C0UA 3BSOA 1X7VA 2A10A 1VISA 5D15A 4M95A 5J1PA 2J9DA 2OEKA 2PI4A 1T0TV 4DX5A 1FFWB 5J2MB 3GCWP 1CULB 4OYXA 5LSLA 4C11B 3SBMA 3DLGA 2RDJA 3LPYA 5HMZA 1X4DA 4WFXA 1WG5A 1S1WB 2M9KA 2DIUA 3MAQA 1SB6A 1SH3A 4YHHF 2BJ9A 4HDHA 4KC5A 1NLKL 2DRDA 3L95X 3THPA 2QN6B 1Y5IB 2LEPA 1X4FA 1N5SA 1U24A 2Z30B 2RKIA 2CJ9A 4DN0A 4KH1B 3C8YA 2NYHA 4X66F 4HVZA 3GP9A 3ENWA 4YUDA 1Y11A 4DUZJ 5HL7Q 2F4FA 2KL8A 1TKZB 2ZD1A 4C8OA 4ZVQB 3KLEA 4JI8F 4KHRA 4I6WA 1OY9A 2J0SD 3MM6A 4HACB 4KKOB 3WDOA 5M2UA 2BJ7A 2XGPA 4ZHRA 1R0AB 1RWNB 3EPIA 1GTHA 4FBUA 2HZAA 4Q5VA 3M6VA 4LBPA 2BM0A 3MEKA 3QMQA 1PYSB 2R7RA 3QWPA 3C14B 2B4VA 2GIRA 5E0OA 2LXIA 3K2YA 1UPMB 2FHJD 2LQ9A 4J9LA 4C0BA 1ZOTA 2MQMA 3UCUP 3FCHA 1KTVA 4Y65A 1XMQJ 2I1RA 5A8RA 4NLUA 2HNZA 4ID5B 3RGIA 3KHGA 1VQ6S 2R2RA 3TX8A 3KUGA 3F0NA 3T1YF 4FF2A 3OXFA 1P27B 4DV2F 4OLOA 2HK3A 2ZVIA 1WC0A 1U48A 4DQPA 2KZZA 4XAKA 3FDSA 3O1LA 4LF5J 4RNOA 3IN5A 4X4QA 1F5AA 2DNGA 1NK5A 2BM1A 3GB0A 2F4VF 3QWUA 1QLNA 3HHLB 5LJ3Y 2HVHA 3CEDA 4B9NA 2KN4A 4X4UA 2HBQB 4TU7A 2MSTA 3Q2SC 3R7BB 4JI5J 2XYHB 3LOUA 4QIFA 1X4HA 5L1IA 3S01A 2V4RA 2XY5A 5DDRC 3G4SS 3ZZYA 4PUOA 1FJCA 5L8RC 3UN3A 3POTA 2C1EB 2W7AA 2CUYA 1F9FA 2AYEA 3CC7S 1V3SA 3N01A 3T1HF 6AT1B 2RD5C 4OYIA 1HKAA 5LOQA 4DS5A 5K14B 3X1LB 2KHDA 3MMAB 4X62J 3W9JA 4JV5J 3NWGA 2FGCA 4PG7A 1Q79A 2KTQA 5D4OA 3B6BA 1U1RA 1TZ0A 1JJ4A 3BREA 2PI5A 4IO9Q 1I3OB 1F60B 3W7BA 2OP5A 1ZZFA 4GO7X 4WK1A 1Q5YA 2DT9A 3LP1A 3CJRA 2ZDPA 3CC2S 2EG2A 3SCKE 1S77D 4W90B 1TTHB 2FYXA 4ZIVA 5GAEI 3TO8A 2VV5A 3TYTA 3ZTPA 5T41A 1RTHB 2VQEJ 2CG8A 4Z7YA 4ED5A 4DX7A 1KVJA 5A8KA 2M70A 2Y1JA 1HHSA 2IBOA 2CQ4A 4WXOA 3CCSS 3KYLA 1YJUA 1S57A 3K5MA 3N4WA 5GAGI 4A8OA 1ZAVA 2HWIA 1EJ7L 4KV8A 4WFZA 3IWNC 1TMMA 4RBVA 2F8EX 5M2PA 2W2QP 5D3GB 1I51B 1F9EB 4B3MJ 2LFVA 4ED6A 5GMDA 3CJ8A 3DLBA 3HHLD 1WACA 2MLXA 3JB9k 4KIAA 3JTNA 2HHVA 3A8IA 1VRQC 3AA8A 3A3OB 2ZNZA 4Y34A 4RUHA 1J5OA 4I0WA 3GPAA 3AODA 1NMEB 1VJWA 4RNNA 4ZLPA 4YS2A 1HD0A 1LXNA 3AOCA 2XNQA 3MM7B 4K2XA 1TL7B 1NDCA 3N28A 1B64A 3RU0A 2Z4PA 3VALA 4PZVA 1WHVA 2ZM6F 4B3SJ 3KMQA 4AQYJ 1L3UA 3A12A 1IUJA 2V8DA 5SZTA 2UXCJ 4UOHA 1C1BB 5BYSA 3C19A 1CS4B 2KJWA 4RZRA 2O3DA 2K1RB 5I42A 1R89A 3OD2A 3M6XA 1RT5A 1S72S 3SXLA 4CLPA 2ZITA 1HBNA 1CJKA 1Q8KA 5L9XA 3EVWA 2YWGA 5THWA 2QTWA 2QA4S 4AXIA 2KVIA 5KG5A 2UUWA 3BQ2A 2G2YA 1T3OA 2GHVC 4PRFA 1KSPA 2J0QD 1FFGB 3LH2S 2LP4A 4MAKA 2HS0A 3BKFA 4A47A 4ZLNA 4PXCA 2O01C 2O66A 3ISZA 4NEYA 4PPDA 1TFWA 2E66A 2XQCA 1UMJA 2PDAA 1OYEA 4LRCA 3TQ1A 3TQEA 3RRHA 4LSLA 4A4JA 2LU1A 1N36J 1N5QA 3W66A 4LFCJ 3MHYA 3CCUS 2K8GA 3FEZA 1EKRA 4LIWA 3KG0A 2R2UA 3LP0A 5AE1A 1NK0A 2IJNA 2ASLA 4M8LA 1UJ6A 1Q78A 4XTTA 5A2QY 1K0TA 3DXSX 5M2RA 2LQBA 2AZ1A 5GAHI 4QR1A 4DSFA 4FF4A 5HMYA 1RZMA 5KFWA 5A6PA 2WTFA 2W8KA 2E9TA 1DQAA 2W7OA 5HLFB 1IBKF 4DV1F 1CQNA 2KRRA 3NOCA 3R1LA 3GWCA 1O8BA 4DX6A 9RUBA 2D41A 4XIUA 3N9UC 1JLQA 2KT5A 2ZBRA 4A8SA 3CJ4A 3G6YA 3Q8PB 1VFJA 1Y7PA 3FEYB 2C2DA 3WX4A 4OYAA 4MT1A 3JYTA 2OPRA 1S1UB 3NY0A 1NNDA 1YTYA 4C3KA 2H51B 4GC7A 3LPEA 1WC5A 1N5YB 3P4UB 3KOAA 4JV1A 3BB5A 2HGMA 4Q45A 3U1LA 1LEOA 2RUSA 4H4KC 5B0EA 3ULHA 1S99A 2OPQB 2F3JA 4M5LA 3IWXA 1HL6A 1IKXA 2B43A 4C97A 4LRFA 1FK9B 1PYTA 2IVMA 3ILOA 3NL0A 1WWHA 4DSEA 1JIHA 2HPUA 3NOGA 1M5PC 3AOAA 1YLXA 2BZ2A 2YQ0A 5KFCA 3EJMA 3IG1B 2ZBQA 2R7OA 3I0RA 2R7VA 1LKZA 5L1LA 3FJ2A 2CQHA 3AHPA 5LXRA 5AE3A 1C0TB 1KQKA 3H5UA 1IKWB 2WSEC 2HAFA 2ZH1A 4ZVGA 7AT1B 4I7FB 2LKZA 2E7XA 2AX0A 1U1OA 4NCGB 4WZMA 4ZCMA 3T41A 2EK6A 2KZMA 2R7WA 3U1MA 3W2VB 1VQ5S 3GIKA 3BV8A 3R9LA 1OMSA 1VBXA 3TANA 4GKJJ 5KFVA 3W1YC 2LQ8A 3C6TB 4ZITA 4JI2F 4U95A 2V8GA 2RQ4A 1IBCB 2NUUG 4BDPA 2AV5A 5G4DA 1LOUA 1RHUB 1N32J 2MQOA 1NJXA 5MLCV 3V81A 4ES1A 1YVFA 2DXFA 1JK9B 2UVUA 3OUYB 2X1BA 2AMCB 4XDCA 4J9UE 2AIRB 3D0GE 3U27A 1NRKA 2HLUA 5FIIA 2UUBJ 1TAUA 2XZWA 5IM0B 1TQLA 4FNIA 4TLQA 5LJ5Y 4YY3F 1DTQB 4OZNA 4U8VA 2FC8A 5IC4B 2BBEA 4A8KA 5HAOA 2F63A 2MHEA 2Q6BA 2I8EA 3DC2A 4O3NA 2VQFF 4JI3F 2W4DA 5A2QU 5HQ8A 2NXUA 2V4QA 3CDBA 3CMES 3LQVA 2XMAA 2UXBJ 2GFFA 2YKMB 4ZVOB 1WSRA 2PO4A 2GCFA 4CDIA 3KNGA 1Y10A 3V4MA 4AE5A 3J7AN 2VC0A 4Q2MA 2GHPA 1QAXA 3PX4A 3CDUA 4OV6A 1VQOS 3DDIA 2FZKB 2VPWB 4K4TA 2DR5A 3I5CA 3I4HX 2KG1A 3GSIA 4OYZA 2IC3A 4DI6A 1FKOB 3DRRB 4CIOA 1DHMA 2B7CB 3NEKA 1CQMA 1RHMB 1U1MA 1MROA 3OHBA 4HI2A 2HIQA 4UW2A 1VDHA 2DR6A 3THTA 4F3QA 1FJ7A 2KXNB 4HT5A 3H2VE 5HMWA 4QYRA 1JKHB 3MPWA 3PR5B 1FX2A 2KDOA 3US5A 4IRDA 2LYVA 5F8IA 1RYSA 2JJ4D 4JI7J 4F67A 4ZCKA 4LF7F 4RNHA 3DM2B 2OPSB 2HFOA 3GTYX 5KT2A 2M88A 1YJWS 3GILA 2ZKTA 3NLCA 5C24B 3QZ8A 1FFSB 2DEIA 3T5JA 2VPZB 3IA0A 3P8BB 4U96A 1SJ4P 2MY8A 2C3PA 3IRXB 3A4TA 4KH0B 3C6UA 2YBVA 1RP5A 3OTBA 1OQ3A 2YNIA 5AE2A 2J0WA 1HI0P 1JLGB 1ZM4A 2GMHA 5J1EB 4ZVEA 3KLVA 1WEYA 4ECXA 4LF8F 3GJSB 3UDVA 2V2ZA 3PNIA 2XHCA 4K5SA 1RT4A 2HRTA 4DWIA 2OJ3A 1UVJA 4CLLA 3JSYA 5AXLA 1RAFB 1LWEA 2B7BB 1FRIA 1EP4B 2HQIA 2IRXA 4DBQA 2BE2B 1QDUB 2V6AA 3SQOP 3PXGa 1TVRA 3ZZPA 1K9MT 4OZ3A 3CCLS 3PYEA 4P72A 1I94J 2GQQA 4LF1A 3W64A 3NP5A 2ZOMA 2VOOA 3K89A 2RQKA 1FKAF 3VGUA 3I4PA 1GAOA 2WVBA 5HROB 3EYZA 2D74B 3G82A 5DLGA 3JSRA 4RW8B 4QWAA 3DYAA 3DOKB 3TA2A 3M2UB 1JLFB 1FERA 4DX8H 3D6HB 3M2RA 1TL1B 4DPXA 1YHQS 4MIWA 1NK8A 3W8GA 3L7PA 2JFKA 3DMJB 3U1NA 1TMJA 4YDDB 4BC7A 5GADI 4E8UA 3HVRA 2N7CA 2MKKA 2UU9F 1D0EA 3FBCA 3NGDA 4PWDB 4C9DA 2B6AA 3QJPA 4DSJA 3HD1A 1FNMA 1VHIA 2COLA 3HFVA 2AZ3A 4YQWA 5LL6d 3LAMA 2ZDOA 1R8CA 1Q95G 3OVSA 5DM6Q 1UZHA 1VLYA 1U8WA 4QQBA 1U6FA 3UDEA 5I3UA 5CZVA 3MFIA 2IA0A 1AFJA 4J9VA 2DCLA 5DQGA 1UVNA 2PE8A 4I2PB 8AT1B 4NYPA 1L3TA 1S6PA 4EI2A 1VQYA 4J9QA 4K50A 4QWDA 3SDEB 1KRPA 2D3OR 1AUDA 3PACA 5IV3A 1QD1A 5H9FJ 4BLGA 3BH6B 3HHEA 3SV3A 5IT9Y 3NXZA 4DEZA 5I4MA 1JLBB 2RRAA 2R8KA 1WG1A 2R8JA 3FVYA 3TJAA 3DXBA 2VG6B 3SCJE 2WW4A 3MCMA 4DV6F 3BN7A 3HSDA 4O44A 2CNKB 3CCVS 4UUXA 2KVQE 2DEJA 3D68A 3P6YC 1WG4A 3KLIA 2BANA 1HBOA 3CGIA 4DR3F 1QAIA 3PRDA 1N8RT 3BKTA 5B0CA 3AAWB 2APOA 4I56A 2JEFA 4CLWA 3R97A 3DN9A 4FS2A 3ZTQA 3BZQA 3Q8QB 1ZM3A 2YH0A 3QYYA 3BN4A 1NK6A 3IC1A 3G6ES 4JI4J 4LRBA 3OFGA 4ES2A 4Y2KA 1JX4A 2KU7A 3PJXA 3GFYA 5ETSA 3IBFB 3J7Z5 2DNYA 3HPOA 2YXLA 1AA1B 4YN3B 3CCWA 2HFNA 4DQIA 2IM2A 3PX6A 2BUNA 1KEKA 4IRKA 4WKYA 4USHA 2MQNA 3IR7B 4CT9A 2V67A 3FMWA 2IA6A 4Q0BB 2CNLB 2XWXA 5F0UA 4F4XA 2JEGA 3A8EA 4OZ5A 1RWOB 4KO0B 2F7VA 3E3XA 3HVWA 3MI7X 5CYMB 4IDKA 3D7SB 1YK9A 2JC0A 2CWKA 2VFVA 1NSKL 2RUGA 1FD2A 1LXJA 1MLAA 1RSCA 2HQGA 4DXLA 4WP9A 3RW7A 3THVA 2HVZA 2DRBA 1REVA 4YHHJ 3TR5A 3SSRA 3DRSA 3SMZA 1DTTB 2ZHAA 3M8QB 2BRLA 4X66J 1Z4UA 1Y3KA 3RB4A 3FKBA 3D66A 2C22A 1T8EA 2HHHJ 1YBUA 4R5PA 1RTDB 1JXVA 1U2RA 2V8VA 4WWSA 2BXJA 1P9YA 3Q8UA 3BSAA 5HBMB 4JBCA 2Z2YB 3O44A 2B4UA 4C8NA 1M5SA 3SSQA 4KB7A 4GVBA 3QIPB 1S6UA 2DGUA 1NK4A 1N54B 2DGQA 1O6XA 3M32A 3DOMB 4LFBF 1UWBB 4H4MB 1GMWD 2AEJA 5CAAA 3PJWA 3Q83A 2JFDA 1NO8A 1FEEA 1SL1A 3VV2B 1IWAA 2AT1B 2GW8A 3UO0A 4EU0A 3HM9A 4UQTA 2XMJA 5IT9U 3EMTA 3T1YJ 3EXYA 1AXQA 2FHOB 2JL9A 2XSFA 5LT5A 3BH7B 3EGNA 2HBRB 4ZVHA 4YP3A 1RHRB 4FXWA 5AXMA 3M9NB 4B3OA 3H2LA 3R6LB 1GQEA 3X3UA 3EGVA 2FTRA 3CJKA 2HVDA 2AHOB 2VICA 3GLJA 2GZOA 1YJVA 4DR5F 2HRYA 2R7UA 3V4IB 1K47A 4ECRA 2QLWA 2DITA 2ZBCA 1KQSR 3TZWA 1YRXA 4H54A 2QYGA 1FRMA 4NLSA 3LA0A 3M8PA 4O23A 2WBRA 1G2EA 2DPJA 1KNZA 3ZNJ1 2YKQA 5B0DA 1X4CA 2CQ3A 2DBBA 4PG6A 1N88A 2VF3A 5KFPA 1EETB 5J1NA 1AROP 3G8SA 5FDLB 1EIYB 3GR1A 1MNEA 1Z2LA 2CQIA 2ROPA 3O6QA 1L3VA 4ED3A 1HWJA 1F3FA 1HNVA 5HJYA 2H5IB 4YMEA 1GTEA 1YRTA 4H4OA 2MKCA 3NAIA 4IG3A 3JSMA 2CQGA 1Y3JA 2CJYB 2HFVA 2P8IA 2QG9B 2BW7A 4DCPB 1IBMF 1TAQA 1XWLA 3DRPB 4B9UA 4YB5A 4LRAA 3FCWA 1UJ5A 2HAIA 4M5JA 1S6OA 5KFOA 4DR1J 1TKTA 3Q8RB 1ZS6A 4OX8A 3I5AA 3GV7B 2D3UA 4RKUC 1RT2A 2FLPA 1QUVA 5G0RB 1H98A 4ECYA 2R8GA 4URGA 2H48B 3LP2A 1DLOB 3KLHB 2I2YA 1QY7A 2OPPA 1HIYA 4QBUA 1E6VB 5CA5A 3TAMA 2OI2A 5A0YB 3P3DA 3ET6A 3DLEA 1UW4A 4F0HA 2FY1A 2ADCA 2ZH2A 2HW3A 5KAKA 2M7SA 3TVZA 3H5YA 1C0UB 3C46A 1TUWA 4WXWA 3I55S 3OTOJ 2IIHA 2CJQA 5FJ4A 2M0GB 2ATLA 4LF5F 1NBEB 3V6DB 3CD7A 2VA3A 3PO4A 2NQPA 2XY7A 3MFHA 3L9ZA 1FVSA 4FYVB 3QJJA 2EK1A 3BPSP 4YEAA 4GVLA 2AEMA 3RYLA 2JDJA 4JI5F 3TNVA 1S0MA 4F4WA 3M8SA 3UCZP 1T03B 2WOMA 3S8SA 3R3TA 3KJQB 1S6QA 4TN2A 2HSEB 1TU0B 2DHHA 1CEZA 2OD6A 1HW9A 3EZ5A 2MKJA 1UEUA 3D67A 4PYAA 1CJTA 4G1QA 4I67A 3Q22A 1J2VA 4Q7AA 5ADZA 4WCEQ 1XIQA 4OYPA 1VQ7S 3I87A 2CYYA 4RUCA 3SIPB 1J5EF 2K06A 1X60A 4KY3A 3VAMA 5B7WA 4KGKA 5KFJA 4JV5F 1Q81T 3Q23A 2B5JA 2YWHA 4A8XA 1YZ7A 4H4KA 3EGWB 1U1PA 1KTQA 2BA9A 3EUNA 1CJUB 2UUTA 3KG1A 4QWEA 2RE1A 2V2KA 4F4YA 2W9BB 2VH7A 2XS5A 2AEFA 2AGOA 1ZM2A 2LXUA 4ICLB 2BJEA 5B0GA 5F3ZA 4F0KA 1MN7A 2ALZA 3G6VA 3P96A 3DLHA 3KKFA 5C2CA 1XN9A 4NZ7A 1RT7B 1NM2A 4K4YA 3ZZ0A 3CWJA 3HFZB 1N0UA 5BYRA 1Y00A 1H7WA 3LGMA 4WP3A 2PSZA 2DH7A 1IBKJ 3CIMA 1H7XA 3PYGA 4J90A 4EEYA 2BE9B 3V6JA 4TXSA 1VHFA 3AY0A 2ATCB 1KD1T 4QR0A 2E1MC 4MYTA 4ZN3A 5J2NB 1HQ2A 3KJNB 4WZQA 3MEGA 3QAUA 3KUEA 4USTA 4USMA 3C15A 3ISNC 3P5BP 1S9GA 3CDAA 5GAEU 2Z2ZA 4B3MF 1K44A 1NPPA 4DV4F 4ZVSB 3OFEA 1EHWA 3W9IA 4ZPTR 3ILJA 4M5DA 3EPGA 5F0WA 1RJJA 5KFAA 4Y28C 2KFZA 1KOHA 2DHAA 5KFZA 3W3SA 1DBDA 1W25A 3DOLA 1SL2A 1UEKA 1XERA 4P74A 1FEHA 2DO0A 2B51A 3PIOQ 4AQYF 3P45B 1RT1A 1RHQB 3JXOA 1S5ZA 1H74A 4RU9A 2AQ4A 3HP6A 2UXCF 4ZPCA 2GS8A 3DRXA 1E6YB 5A8WB 3LP1B 4ZP8A 1OJ4A 2DNZA 5ETPA 1JLEA 2AJ2A 3PY8A 2YKNB 2WB1D 5CD4A 1WF1A 1X9WA 1N5TA 5J2PA 3A3PB 3AT1B 2HG4A 4MFBB 3BSCA 5J2QA 2ZH6A 2HS3A 1S7IA 2I38A 2XO7A 3RBXA 5KTQA 2H3EB 1NHUA 5A8KB 1Q86T 5HVFA 4ZPAA 3IM8A 2YVSA 1SIZA 3D28A 4PXEA 2B9XA 1TFYA 3W61A 2QLXA 2O1PA 1CSJA 4CLTA 5LSOA 4ZIWA 2MLYA 2HHWA 1X31C 4CLKA 3VWSA 2EC2A 2OSRA 1F1BB 1N36F 1KHWA 1FRJA 3GONA 3T1AA 1S76D 3BEGB 3CVKA 4P2XA 2RT3A 3DU6A 3CMQA 1MU2A 3W5XA 2QGFB 2GX8A 4OX9F 3TAPA 2VASA 4KFBA 2MGZB 2OLWA 1WELA 2GO9A 4PQUB 1YJ7A 4F36A 3LGNA 4KSEB 1VQKS 3KK3A 4TQSA 3KJVA 5KFLA 3H90A 2GVDA 4N8OA 4RBUA 4YY3J 3M1VB 1YJ9S 4HT7A 1FI4A 3MEEB 3MOZA 4FVMA 1FRHA 1S49A 2WSFC 2E5LF 1OO0B 3ZZZA 2XULA 2Y8YA 2CRLA 5AXKA 2V68A 4IH5A 3TZXA 4UY85 2FHJA 3MEDA 5F3TA 2FD2A 1F5BA 4RO0A 2RRBA 3NCPA 1Y0HA 3W2WA 2BJDA 1RT3B 1PG5B 5I42B 3FFIB 5GAHU 5D4NA 2PFDA 1UPPA 4A8QA 1HBNB 2J0XA 4NLYA 5KFNA 4MTPA 1QSLA 4DPYA 3VGSA 5LXYA 3EM1A 4N5SA 4DSIA 4ER8A 1JLAB 3W62A 1ICEB 4NI2A 2AD9A 3QLHA 2M8HA 2XM3A 3NNCA 5F8JA 4L3NA 3W60A 4Y2CA 2FJVA 3R5JB 1N48A 5T7LA 2LVWA 3FCVA 1TUVA 3QNWB 1YZ6A 4LSLB 3R8YA 1XR6A 2H9ZA 1Z2ZA 2B3TB 4NYOA 2EBGA 4A8WA 2XNRA 3LP0B 1CULA 4HH0A 4C11A 4UF4A 1JXLA 3AJ2A 4PXBA 2F8HA 2XZDB 2HHTA 4WFNQ 4N41A 1AT1B 3F56A 2E1AA 2RNEA 4YDXA 1EX8A 2GIQA 2HBZB 3D6FB 3LANA 4GKJF 1JLQB 4MIBA 2UUCJ 1SJRA 2IDEA 2A2CA 4LF8J 3KHLA 1BE4A 3OLBA 2ZE2B 3VQTA 1V5VA 4F25A 1YX2A 2M4MA 5SUHA 1QE1B 1MG7A 1KS2A 3JYTB 3CPWR 3VVTA 1TKZA 1S0OA 1NKEA 4N56A 4M5NA 4BBYA 1X5OA 2A0FB 4ILLA 4B08A 4CYUB 1R0AA 1ROFA 5KT3A 1VBZA 1U0SA 2EC0A 2ZH7A 1IKXB 1UFKA 1LFWA 2UUBF 3C14A 4J37A 4NZ0A 2WSCC 3GG1A 2V4JB 4KR0B 3RTVA 1HYSB 3MM5B 3T5KA 1WC1A 3KUHA 2GV1A 2YWFA 1KOOA 3I9V9 4DV0J 3H42A 3I0SB 3OSNA 4TKTA 4EUVA 2DNRA 5KG6A 4OZLA 1HLWA 1U49A 1Q8BA 3TI0A 1JLCB
chains in the Genus database with same CATH topology
5AE3A 3F41A 2W9BA 2VFSA 1RTJB 2B4OA 1TP7A 2X3GA 1XR5A 4ILMA 4K4XA 3HHLC 3ITHB 4ICLA 2ZH4A 1KQKA 2XCAA 4KGMA 2UXBF 1HD1A 3IR6B 4F3MA 3MECB 3H5UA 3BDEA 3PW7A 3CCJS 1W2IA 3SSSA 4PKDB 1IKWB 2QA1A 3IO1A 3KHHA 3UE2A 2WSEC 1YWXA 2OKQA 2ZH1A 4ZVGA 1RDRA 3WBZA 2Q79A 4I7FB 4C4WA 2LKZA 4NCGA 1PILA 2E7XA 4LUBA 1TL5A 3KK2B 2AX0A 2GO8A 1O51A 1S9FA 4NCGB 3PVXA 1U1OA 4WZMA 1RT7A 4EZ9A 5F8MA 1YJRA 4ZCMA 2XLKA 3GIIA 2OO4A 3K0JA 3IXQA 3L09A 2EK6A 4U67Q 1QAYA 2YKAA 3BGRA 1KQFB 4B02A 2VQEF 1CC8A 3RBDA 2R7WA 1I6JA 2KZMA 3U1MA 4OI4A 3BGRB 3RB6A 2XMWA 3TUZC 4XK8C 1IQZA 2KKHA 3M30B 3W2VA 3HX9A 1BLUA 4YFUA 3W2VB 4TYBA 3M05A 4O0IA 1QVGR 1Y5LB 4ALZA 3GIKA 1VQ5S 2XWYA 2R8HA 2RH3A 2J6TA 4IDKB 1S7HA 2LQJA 3TOQA 1FO1A 3CTRA 2JEIA 5EN1A 3CXCR 4ZPDA 2CQ1A 1FDDA 4PXDA 3VR1A 2MKIA 2RRNA 5J2NA 2CPEA 1QVFR 1VBXA 3TANA 2C2RA 2J7WA 5KFVA 1JJHA 2D9OA 3K8WA 3C6TB 3QGPA 1Q8LA 4JI2F 4DSLA 1SBRA 1HWKA 3NS5A 2V8GA 2RQ4A 3J81Y 2HWHA 3SQGB 2W9CB 1ZPWX 1REVB 2NUUG 1QJHA 1WF2A 2YWKA 2RVJA 4ELVA 1ZAXA 4BHQA 3BM7A 1VMBA 1WNEA 2W9AA 1BQMA 2FJEB 3OFHA 4C3LA 4BDPA 4OL8A 1RQ0A 2AV5A 1BQMB 5G4DA 1LOUA 5F41A 1VQSA 1D3WA 1V3RA 2MQOA 1NJXA 5MLCV 3V81A 2L3MA 2Q43A 3M2VA 4JI7F 4ES1A 2XMMA 4ID8A 1YVFA 1FRLA 3DRSB 3V81B 1X0FA 1JK9B 4QW9A 4FYDA 2Q3PA 2UVWA 2UVUA 4RUAA 1XR7A 3OUYB 3I31A 4Y3CA 3NBPA 2X1BA 3O2IA 2JRSA 4I69A 2UVVA 3NBPB 4DF4A 4XDCA 2ZOFA 3CF5Q 3OL6A 1JNZB 2A1BA 3D0GE 1FNXH 1H3DA 4OHYA 3PRBA 2IJFA 1HBUB 3U27A 1NRKA 2HLUA 5FIIA 1TAUA 2XZWA 4NA3A 2EFGA 5AXNA 5IM0B 1TQLA 3AA9A 2OH2A 1SKWA 3SFGA 5K14A 1DTQA 3DGPA 4FNIA 4TLQA 5LJ5Y 4DL3A 4R5PB 3BQ1A 2DR8A 2XLIA 1OSDA 4YY3F 3HHDA 1DTQB 4L72B 3MMAA 4USJC 3B82A 2R9LA 4OZNA 4HH1A 3OTDA 1T02A 3U7JA 4ZCLA 2YKOA 3DHWC 2FC8A 2FVSA 2BBEA 2XMTA 2JVRA 4A8KA 2BQUA 3ZZTA 1HNIA 1VQMS 2JH3A 4ED2A 3FZBA 1IQTA 4B3SF 2MHEA 2Q6BA 1HNIB 2I8EA 3QIDA 2C3OA 3DC2A 2ABYA 3N5FA 1RA7A 5HN0A 4O3NA 2VQFF 4JI3F 2W4DA 4TU9A 1SH2A 3TP2A 2NXUA 5HQ8A 1VC0A 1RT6A 4DG1B 1FRKA 5GVQA 2BRKA 2V4QA 1N52B 4UY8T 1E6YA 1RT6B 3CDBA 3CIZA 4Z37A 1VRTB 2LA4A 5A8WA 1T05B 3CMES 2K7KA 3LQVA 2YKMA 2LECA 1S48A 5C5JA 4B9SA 4MIAA 2GFFA 4NLXA 4WU3A 2YKMB 3I9ZA 4LJMA 4RW9A 4QZVB 4ZVFA 2IVYA 2YKNA 4Y6IA 4KHMA 1PO6A 3NRBA 2DB1A 4RW9B 7FDRA 1Q16B 2PO4A 2B4PA 2DNNA 1H2UX 2PMHA 2GCFA 2WB4A 4R8UB 3MUMP 1IBLF 1GT8A 1Y9OA 3FZ2A 1R7IA 3KNGA 3V4MA 4QYZJ 4AE5A 2VC0A 1BGXT 4Q2MA 2GHPA 1D9AA 3NCRA 1QAXA 5HP1A 3PX4A 2CKWA 1LWFB 5DRKA 3CDUA 3WC2A 4MFBA 3MM8A 4LFAF 4OHVA 1VQOS 1RTHA 3J7A1 4RW4A 2VPWB 3MM8B 4K4TA 2DR5A 4DLGA 3I5CA 4JUZA 3I4HX 2KG1A 2IMOA 1V9OA 3P5TL 4RX6A 2QSWA 3UR3C 3H4DA 1UVLA 4C2MA 1ZYQA 5DS7A 1KR4A 3CD6S 2IC3A 4TNOA 2YNGB 1FKOB 3DRRB 2ZBIA 4CIOA 1NZAA 3QPIA 4OJ3A 3SCLE 5KFQA 2ZZNA 5JJBA 1DHMA 2B7CB 2JLEA 1KLMB 2FHMA 2RDIA 5E33A 1XBWA 2Z0GA 5EUHA 1CQMA 1X4EA 5C42A 1U1MA 2YX4A 4ZK7M 5C42B 4QR2A 1MROA 4KTQA 1FF2A 3OHBA 4HI2A 2HIQA 4UW2A 2IVFB 6FDRA 2FC9A 3MMBA 2XI3A 3THTA 1VK8A 2XG8A 4F3QA 4IOBA 4NXMF 2N3OA 1JMTA 1FJ7A 3OV7A 4B3OB 1C2PA 1IR0A 2KXNB 2DR9A 4HT5A 2LLZA 2QE5A 3H2VE 5HMWA 1OSCA 4QYRA 1U1QA 1P9QC 4QW8A 1BQNB 1JKHB 5D3GA 2PGCA 1FDBA 4F02A 2KM8B 1XMBA 3MPWA 1HBMB 4EYHB 3PR5B 2KDOA 3US5A 4PWUA 5DG8A 5BR8F 5CYQB 3MUTP 2QEXS 4IRDA 2W4PA 3CCZA 2LYVA 5F8IA 1RYSA 2DNQA 4LFCF 2JJ4D 5B09A 1SI9A 5BYQA 2MKSA 4ZCKA 4F67A 5F8HA 4LF7F 4RNHA 1ELOA 2QO3A 3VCDA 4F3OA 3BGFA 3DM2A 4NXNF 1TK5A 1HNXF 2RMLA 2DIVA 2I5JB 3DM2B 2OPSB 3HMJG 2VD3A 2HFOA 5EWFA 1WF0A 1O5JA 1CG2A 5KT2A 2M88A 4K59A 1YJWS 2A18A 3GILA 2MGZA 5C24A 3PEHA 3KLFB 5CD4H 4X4SA 5DG7A 4Y2MA 4B9TA 2ZKTA 3NLCA 4A8MP 4PQUA 4MJKA 5C24B 4CO2A 3QZ8A 1GXTA 1FKPB 3T5JA 2VPZB 3PZPA 3IA0A 2DH8A 4ERDA 4HL9A 4NCAA 4FXVA 2PMZD 1SJ4P 3OJSA 1DQ8A 2E5GA 1UVIA 3M6WA 2GC8A 3IRXA 4OLPA 2MY8A 1GXLA 3WZ0A 2C3PA 4FP9A 4AL7A 3M1VA 2DPIA 4WF9Q 3V6KA 2P5VA 5DLFA 3IRXB 2VG7B 2RU9A 4RNFA 3C6UA 1C1CB 1MWYA 2H5EA 1WHWA 5EX0A 4XDDA 3M8RA 3MEEA 4X4OA 2Q1LA 3SZ2A 1RP5A 2JX2A 4BWJA 2W25A 3OTBA 1N56A 1OQ3A 2YNIA 5AE2A 2J0WA 5KT4A 2DRAA 3CJ3A 5J1EA 1FXLA 3FQLA 1HI0P 1JLGB 1HQEA 4C8MA 3T3FA 1ZM4A 2YNIB 3UFCX 2DNHA 2GMHA 5J1EB 4NYZA 4ZVEA 1HQEB 3KLVA 1WEZA 5F9LA 3HVTB 4ITSA 4DR2F 2XBPA 1WEYA 4ECXA 1N6QB 5GADU 5DETA 4LF8F 2L9DA 4K4UA 2DVIA 2K7JA 2BQ3A 1C1BA 3PNIA 1U4BA 2BABA 2P6TA 4OJHA 4K5SA 2K1RA 3N0VA 1A9NB 1RT4A 4PPZA 3ONQA 4DWIA 2OJ3A 1UVJA 4DR7F 3JSYA 5K5MA 1RT3A 2HHQA 5AXLA 1NJZA 2BOPA 2RS8A 1OWXA 1LWEA 2B7BB 1FRIA 5E5NA 1EP4B 2D3ZA 4H4OB 3FFIA 3VZIA 2HQIA 3DLJA 2QA2A 4FN5A 5HI7A 5MAOA 2CJKA 2DH9A 3NG8A 2IRXA 4IG3B 2DGOA 4DBQA 2BE2B 5KOWA 2QRRA 2E44A 2QSFA 3H98A 3E01B 2MZSA 4RU2A 2R7TA 2CJBA 4QIWD 3PXGa 5FD1A 1TVRA 1YJNS 2B0GA 1NAQA 2AP6A 5KT5A 3ZZPA 3D2WA 3AQPA 2EBEA 2GGPA 3T9ZA 4AL6A 1U25A 3HKZD 1K9MT 3UD4P 1YRUA 1FDAA 2VPYB 4B17A 3CCLS 2DNKA 5KG4A 4C7QA 2PIIA 4O4GB 2MZ1A 2GQQA 2DJWA 4KT0C 1FT8A 4NA2A 4ED0A 2VOOA 3NP5A 2ZOMA 1PGZA 2RQKA 3MCSA 1FKAF 1FHTA 1V3ZA 5AJ3F 4OHWA 3I4PA 4KQZA 3KLGA 1URNA 1JLAA 1GAOA 2ZOGA 2CVEA 5HROB 3EYZA 3JTOA 2D74B 3QO9A 4O3PA 1BD6A 2DGWA 3DOKA 3JSRA 4RW8B 3UWTA 1QM9A 3DYAA 5DLGA 4RNMA 2VBXA 4QWAA 2KYXA 2CQ0A 3QO9B 3DOKB 3TA2A 1TKTB 3DYAB 3G86A 3M2UB 1LW0B 1UVKA 1JLFB 1H2TZ 2ZJRQ 4GC6A 1FERA 3ENQA 1NKBA 2VL1A 2JSXA 2VZ9A 4C0OC 2XMUA 2OTLS 2PFFB 4DX8H 1GH8A 3NAHA 1H2VZ 3PX0A 4YR3A 1R6YA 2J9EA 4IH6A 1PC5A 3OR2A 2A2DA 3M2RA 4JI4F 2HRUA 3ZZRA 4C8YA 1RT2B 2XGQA 1TL1B 3DDNA 3OR2B 2MKHA 2V94A 4PCQA 2P6SA 4O4RA 3CCTA 4NL5A 2OMOA 4ZCIA 1K8AT 3MTJA 2HZCA 2DTJA 1YHQS 4MIWA 1NK8A 2IMWP 1WEXA 1IKVB 3L7PA 2NSCA 4WE1A 5CCMA 2JFKA 3DMJB 3U1NA 4DHVA 4YDDB 3LP2B 3UDLA 1SJ3P 4WE1B 4DFMA 4C8KA 4EFAC 5IQQA 4BC7A 1B7FA 5GADI 2GHWA 4W92B 2YNFB 3IGNA 3NCQA 1XTZA 4X84A 3UQSA 3OLAA 4N47A 4NLOA 3FQKA 2OPPB 4E8UA 5IWAF 3HVRA 4ECZA 2N7CA 3PDNA 4FPRA 2MKKA 2UU9F 4B9VA 3GR0A 4OHXA 1D0EA 4NRUA 3NGDA 2PC6A 4PWDB 4C9DA 2B6AA 3C3LA 2M52A 3T6JA 4I64A 3QJPA 3BGUA 5B0AA 4DSJA 2MB0B 2BDPA 4B3TF 3CDEA 4FNHA 4M1KA 1FNMA 4ZP7A 2V9WA 2COLA 2MQLA 2YQ3A 3UD3P 4O3SA 2MMYA 3N6NA 4DL2A 4FF1A 5LMNF 4YQWA 5LL6d 4Y0FA 4DV5F 1IN0A 4JV0A 1L5UA 1FXDA 1HNZF 3LAMA 1T7PA 2ZDOA 3N79A 1R8CA 3BSNA 3OVSA 1Y5NB 4EGLA 5DM6Q 4I2QB 4O3OA 1VLYA 4QQBA 1X8DA 1U6FA 4PR6A 1VRUB 5F8LA 3CT9A 1UEVA 4K5RA 3CCQS 4O3RA 5I3UA 5CZVA 4DR4F 3MFIA 2IA0A 1AFJA 2DGSA 4U7UK 2DCLA 2HWTA 5DGBA 5DQGA 1UVNA 4MKBA 2PE8A 4I2PB 4DDFA 4OI1A 3IR5B 4PQAA 4NYPA 1LV5A 1L3TA 1S6PA 1VQYA 4RBTA 4J9QA 4K50A 4QWDA 1S6PB 3SDEB 2R7SA 5DQIA 1KRPA 2D3OR 1AUDA 2OD4A 4BC9A 2DR7A 3PACA 1NK9A 3DLGB 3KWMA 1DURA 1ZBTA 5H9FJ 5KT6A 3MMJA 1KHVA 2LMIA 3OHAA 1CVJA 3AQOA 4MYUA 3HHEA 3OJUA 4ELTA 3CCMS 2FVCA 3SV3A 5IT9Y 2ZE2A 1JLBA 4QPXA 4DEZA 4DF8A 4QCLA 3S1TA 1QE1A 1JLBB 2V5HG 5I4MA 3I32A 1ZH5A 2N4CA 2RRAA 1YGYA 1MW7A 3MUVP 2R8KA 1WG1A 1N5YA 2R8JA 2ZH8A 4BWMA 2BW2A 1PSDA 3FVYA 1N32F 4HYKA 4NLQA 4PG8A 1RI7A 2ZHOA 3DXBA 2VG6B 1WD6A 3SCJE 2M3DA 2BQRA 4F2RA 1VOMA 3R5AA 4CNYA 2JVOA 4X2BA 4DV6F 3BN7A 1XNQF 2RKIB 4O44A 2OPQA 3KTQA 2R4FA 2IM3A 4ES3A 2KJVA 2CPHA 4JYAF 3VF0B 3CCVS 4UUXA 4J9MA 2HHUA 1VQPS 2ZC4A 3FRZA 1Q82T 3OL8A 1FK9A 2L41A 2G13A 1N34F 3P6YC 1WG4A 1YBAA 3K5NA 3KLIA 4OMFG 2YY3A 2BANA 5DDPC 2HHHF 1HBOA 3CGIA 1P1LA 1FRXA 4DR3F 1QAIA 1NJYA 3MWBA 2IM0A 2ZD1B 3PRDA 2XSJB 1HBOB 3KLEB 1N8RT 3SI8A 3ICLA 5DQHA 2N82B 2V4JA 2O67A 1R8AA 2O5DA 1HYSA 4ECVA 5B0CA 2MHNA 3MM6B 3AAWB 3MM5A 4V19J 2APOA 2VKZG 4I56A 2JEFA 1SXLA 2ZNYA 3VAGA 5EX3A 3DN9A 4FS2A 1D9DA 3EGZA 4ZHRB 2J6SA 3BZQA 1SV5A 3Q8QB 1W2BR 2UV8A 1ZM3A 1FXRA 2YH0A 3IAS9 3QYYA 3BN4A 4G1QB 4OFZA 3OL7A 2XC9A 3DLKA 3IG1A 3N6MA 5JVGQ 1SV5B 1NK6A 3UW1A 3I0SA 3IC1A 3G6ES 4F50A 4WU2A 2RILA 3DLKB 1N4LA 4WTYA 4TY8A 2XHWA 3PM9A 3OVBA 1FJGF 2HHXA 1DAXA 3OFGA 4TY8B 4ES2A 4Y2KA 3NKYA 3GV5B 2F9JA 5KFXA 3I5BA 2M2BA 1JLCA 1JX4A 1A7GE 5E3CA 2KU7A 1RTJA 3PJXA 3FSIA 3GFYA 2CIMA 3DI6B 1VQ8S 4IR9A 3LO3A 3ITHA 3K58A 3R5CA 2XEXA 3JTPA 2YKPA 2DNYA 2MZQA 3J7Z5 3PR4A 2FDNA 1N0VC 2JWNA 3IGVA 3MECA 3HPOA 4FS1A 1NJWA 3PV8A 3DCAA 3HDSA 2IYIA 4EWTA 3S7RA 3VAKA 1IKWA 2B5JB