4OZLA

Glnk2 from haloferax mediterranei complexed with amp
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
119
structure length
104
Chain Sequence
DLPNDGGIKLVMAIIRPDKLADVKTALAEVGAPSLTVTNVSGRGSDLHQKVKVECVVADTPAEDVADAIADAAHTGEKGDGKIFILPVENAIQVRTGKTGRDAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of a PII signaling protein from a halophilic archaeon reveals novel traits and high-salt adaptations.
pubmed doi rcsb
source organism Haloferax mediterranei
molecule tags Signaling protein
molecule keywords Nitrogen regulatory protein P-II
total genus 22
structure length 104
sequence length 119
ec nomenclature
pdb deposition date 2014-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00543 P-II Nitrogen regulatory protein P-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ozlA00
4CNZA 1UKUA 2XULA 3OPKA 4YB5A 4USHA 2ZFHA 2J9EA 4R25A 3GSDA 4AFFA 1H3DA 4USIA 5D4PA 3AA8A 1Q1KA 2GW8A 1O5JA 1QY7A 2O66A 1UMJA 4YB7A 3N5BA 3AHPA 1PILA 4D3GA 1VFJA 2RD5C 2DCLA 4USJC 2JJ4D 4CO4A 2Z0GA 2O67A 4C3LA 2GNKA 2XBPA 2J9DA 3DFEA 4CO1A 2PIIA 5DS7A 3T9ZA 4D3HA 3X3UA 4CO5A 1P1LA 3AA9A 3O8WA 3NCRA 4RLEA 3HLUA 4RWXA 2NS1B 4C3KA 1UFLA 3TA1A 3CE8A 4OZNA 5D4OA 1V9OA 1VHFA 4NYPA 1OSCA 4E98A 3M05A 2ZOMA 1UL3A 2E66A 3L7PA 4RX6A 5DRKA 1NZAA 4Y65A 1NH8A 2NUUG 1GNKA 2EG2A 1O51A 1V6HA 1NAQA 4RWWA 3NCPA 3TA2A 3NCQA 2XG8A 4Y6IA 4CO2A 2VD3A 1KR4A 2NUHA 1NH7A 2CZ4A 2EG1A 3TA0A 1V3RA 1J2VA 5D4LA 3BZQA 4NYOA 2XZWA 4C3MA 4IYQA 4CO0A 4OZJA 4ZK7M 5D4NA 4YB6A 3MHYA 4WK3A 1HWUA 3LF0A 3O5TB 2V5HG 2GX8A 1XK8A 4WK1A 1V3SA 4CNYA 3AH6A 2J9DE 2J9CA 5L9NA 4CO3A 4OZLA
chains in the Genus database with same CATH superfamily
5LT5A 1KSPA 4RNFA 4ED6A 1F9EB 2X1BA 6FDRA 2C2MB 1YJWS 3BSNA 5HP1B 4FS1A 1OPZA 2H65B 3C66A 2RJZA 4OYPA 1E6YB 1WTBA 1UVIA 2UVRA 1TFWA 2JVOA 4K2JA 2DB1A 3MXHP 1FTRA 2D74B 2F63A 5K9FA 2D9PA 5LXYA 4X66F 5CYMA 1JLFB 1KBRA 3DDIA 2HHHF 3EGNA 3K0JA 4TYAA 1S0MA 4HKQA 1RWUA 1Q53A 2IY5B 2JHEA 2QA2A 1RWVB 4Q45A 3PYFA 5ETTA 3PKYA 3EPGA 4A8MP 2Y9HA 5KG1A 1FE0A 5KFZA 2DHSA 3MF5A 3GPAA 3NOCA 1S0OA 4YHHJ 2LXFA 3VAKA 2WOMA 3VGVA 2V9WA 2KG0A 4H4MB 2AP6A 4A8OA 4TVAB 3CJ8A 4M5MA 3IG1B 1HNZJ 1WKJA 1XR7A 1Q8BA 3EMTA 2RHQB 4OJGA 4R5PB 1N32F 4KYZA 2RUGA 4WE1A 5BJRA 3DU5A 3OTOJ 3Q89A 4WFBQ 2CQCA 3ET6A 3MAHA 2OD4A 3G8TA 1PGZA 2Y8YA 4ED4A 4KBIA 2OPPB 3DRPA 4LSNB 2ZC4A 3MMBB 5K5MA 3W64A 4ZVUB 1H2UX 2YWFA 3M30B 4IQMA 3I0RB 3NCRA 2OEMA 4EWTA 2GO8A 2M4MA 1WEYA 4NLQA 2IVFB 2P6SA 1VS3A 5HQMA 1RAAB 1X0FA 1N32J 2Z2MA 2VPYB 3V6JA 1HBUA 1XNRF 1YLXA 4PXCA 4U96A 3ZC4A 1HFEL 3ZTSA 3HZEA 5D6GA 3J81Y 1YRTA 2DEIA 4R8UA 5KFBA 3DRXA 3HT0A 3K57A 3V6DB 2AYBA 2DYAA 4PUOB 3QT5A 1BQXA 2XSJB 4PRFA 2BE7D 2CQ2A 4B3MJ 2ZVSA 2CPEA 2VFVA 3BDEA 2NSCA 4WP3A 3VAMA 3R2DJ 1F5CA 3W62A 3VQSA 4ANEA 3MM6B 4F4WA 3D68A 1NMEB 1RWPB 3BGRB 4I1TA 4ECYA 3CMES 2KXFA 4TNOA 4WIQA 1XTZA 4ZCIA 5DRKA 1HNXF 2MB0B 1WUUA 3BSAA 3CCMS 4DS5A 5KFOA 1M5OC 1NH8A 3C6UA 3SFGA 4DF8A 4LF9J 5KT3A 3TARA 1N52B 2LCWA 3D0GE 4GKJF 1KQFB 2R7XA 4FKYA 2DGUA 2IDEA 4NLYA 4DDFA 2VA3A 3MEKA 4OYMA 2YX1A 3VZHA 3HZGA 3TR5A 2NR0A 3T3FA 3DLGA 3SDEB 1Q5YA 3M8QA 1OMSA 2RMLA 3N01A 3A8KA 3H5UA 3M32B 4K7QA 4BHQA 2XMAA 5L1LA 2RKIB 4Q8EA 3MM8A 4ID5B 2NREA 2JL9A 3V81A 2D7SA 3DLGB 2O3DA 4TY8A 4O44A 3SDEA 4WFNQ 4KB7A 2L48A 1X4AA 2ZC3A 4YQWA 2JX2A 2LQ9A 4M5IA 2L08A 1IBCB 2DGTA 3LP1B 4PEOA 5E0OA 5LSRA 2A10A 2HGLA 1S5ZA 1YI2S 4P74A 1T95A 1PAEX 1K0VA 4CTAA 3Q8RB 3IR7B 3Q8SB 1DAXA 3GIMA 2EPIA 3MM5B 4ERDA 3HHEA 2RUSA 2W7PA 3IN5A 1NK7A 2WSEC 2FVSA 2EFOA 1HR0F 4PWDB 4IO1A 3N5FA 3KKFA 1C1CA 1XK8A 3QNWB 3O44A 2GFFA 4RNHA 4WFXA 3R7NB 1RBLA 1FI4A 3H2LA 1FRKA 2KO1A 1OS5A 3KHLA 2N3LA 5F3ZA 3HP6A 1JLCA 1RWNB 3J7AN 2BANB 1J5OB 4LF4J 2XULA 1NB7A 4JI0J 2ZE2B 2KU7A 3PX0A 1OWXA 2Y8WA 5BYQA 1TV6B 2OPSA 4FVMA 1R8HA 5HVHA 3ZFVA 4CP5A 3UW1A 1G4CA 1KFSA 5IZHA 1TK5A 3IWXA 2BM0A 4KKOB 3P8BB 4ZPTR 2W9BB 5HROB 2HHHJ 3UD4P 5IOLA 1QAXA 1OPIA 4PR6A 1MSWD 1RHKB 1RU1A 1I94J 3CNQP 2AV5A 3R6GB 1UCNA 1QTMA 1AA1B 3GP9A 2O01C 3G6YA 2B8QA 1JLBB 4X4PA 2QX0A 2IJNA 3NMAA 2CNOB 2R8KA 2IC3A 1FFWB 3J7ZT 1YJ7A 1U8WA 1FJ7A 2VG5A 1YBTA 3BO3A 2WBRA 4OIXA 2XS2A 4M5DB 3QAUA 5DDQC 1FRHA 2JEFA 3L4BC 4ZVEA 4ETXA 1R7IA 3BBCA 4PQAA 3I56S 2QEXS 2FJEB 3LP2B 5GAEI 3H40A 4GKKJ 4DV5J 4NE9C 2QSFA 2DNLA 1XC9A 1T3OA 2ATCB 1U7LA 1N36F 4CIOA 4C8NA 3H8YA 1J5EJ 2XS7A 2HNZA 3AB2B 2Y1JA 3PCOB 2EWHA 4KPCA 4OI3A 1WD6A 2MY7A 2K06A 4FF3A 4NZ7A 4I67A 1C0TB 3AB4B 4ECTA 1VRTB 4OI0A 4UQTA 1E6VA 4OHYA 2W2NP 4L74A 1HNVA 2XYGB 3FNNA 3UE2A 3PW0A 2NS1B 5CCLA 4IQXA 1AROP 1HBOA 2ASJA 2YKNA 4YUDA 3GFZA 3NL0A 4JOUA 3HD2A 3TA1A 2YVSA 3D0HE 1RWOB 2V8HA 4DLEA 3C6TA 2MKCA 3VGUA 4QPXA 1RT5B 2MPUA 1HNVB 4ZP9A 3RW7A 3IBWA 4IDKA 5I3UA 1FVSA 2MZJA 4QJVA 5EWFA 2H1YA 4B3OA 3P49B 1Q82T 2HHUA 2XI2A 1T9VA 2NXJA 2V2KA 4FN5A 4G6VB 2KT5A 4KHRA 3MM9B 1RHUB 2GAHC 4USWA 3MCNA 2CQDA 2MTLA 3GJSB 1HQUB 3LOUA 4P2XA 2RS8A 4QIVA 4RX6A 4W90B 5GADI 1GNKA 2IRYA 3HMJG 4Q43A 2YQ1A 1D8ZA 1JMTA 1RHQB 3IBFB 1U2CA 1C4AA 2RIJA 2YQ0A 3P5TL 2DNYA 2Z8QA 3MDFA 3H7HB 3TJAA 2KZZA 2BV3A 7FDRA 4RW8A 2C2OB 3ZNUA 5KFFA 3NAIA 4C0BA 4CLWA 2BMBA 1U1OA 1Z4UA 5B0GA 3IGVA 2K7KA 3LUYA 4DPWA 3FZ2A 2ATLA 1N4LA 3GZ7A 2MQLA 4L73A 2KVQE 4I2QA 4RR5A 1LFPA 3CIMA 1PBUA 4LSLA 5GMKa 1U47A 1URNA 2DRBA 4QCLA 1HARA 5KFPA 4XK8C 1K8AT 1Q86T 1TQLA 5E33A 3FCVA 4O44B 3M2VB 2HZAA 1UTAA 2HPUA 4OQJA 3UN2A 1FDDA 1TMJA 2VFSA 3FEYB 2E1AA 2MYFA 1G6BA 5HVGA 4RKUC 1KVKA 1F5BA 2OKQA 1YJTA 3OUYB 3TZWA 4CLZA 2AYGA 2H9ZA 1K1QA 1NXIA 2G13A 1FKPB 3FC9A 2FZKB 3BB5A 1MW7A 3PYEA 2NZ4A 2FJVA 3GU0A 2F1FA 4DV0F 2GX8A 2IRUA 2LU1A 4BC7A 2H54B 4CNYA 4F25A 1JJ4A 2UU9J 3D6TB 3DLEB 1U45A 2U2FA 5L9NA 3ETMA 1W2IA 1C1CB 4CO3A 2Z2LA 4NCAA 1L3SA 1UEKA 3NGTA 3BV8A 2J7KA 3OPKA 1WSRA 2FJBB 2GA7A 1R6VA 3C14A 4Q2LA 5EUHA 2OAUA 3CPWR 4GVBB 4IR9A 1M5KC 3MUVP 3GFXA 2QO3A 2UZAA 4FS2A 3BN7A 4ZPDA 4U9RA 2UXDJ 1RSCA 4L75A 4N8NA 3K17A 1DQ9A 1X5PA 3ICLA 3CJ2A 3TRGA 4CQ1A 5DZ7A 1NBEB 1R8PA 1IKVB 2CVEA 3SXLA 1N33F 1RTZA 4CLSA 1VYAA 3EDQB 1T94A 3Q8VA 1TKZA 2Q3PA 1F3VA 1LQ9A 3ILLA 2BE2B 5M2PA 4JI4J 2KFZA 1S0NA 3BGRA 3CDUA 3JQMA 2HBZB 3ITHA 1F2GA 1FRLA 1VBYA 4ZP6A 3T5LA 5KFAA 2OIHA 1B4SA 1WHVA 2HHWA 2ZVIA 4OYXA 4JI5F 1SKWA 1RT4B 2EW9A 2KVIA 1JKHA 2ZBPA 3MUTP 2QV6A 4WP8A 1EQMA 3I96A 4DV3J 4CLLA 2QYGA 5CYJA 2IC3B 2LXUA 5MAOA 1WC0A 1ULRA 3FCWA 3KJVB 1ZTWA 4DFJA 4B3TF 1KLNA 1T11A 2F5GA 1UAWA 2XBPA 4JI1J 3MFHA 2EBGA 1SKSA 3PRVA 2PIIA 2QYCA 2D1CA 3MD3A 2OMOA 3OTEA 1S9EB 4H4OB 5KG0A 3KLFA 1IWAA 1MN7A 2RF2B 3AFGA 1NKBA 4J9VA 3DGPB 2MQQA 1SV5B 4NLPA 1X4HA 2D3OR 3CMQA 1W26A 1NKCA 2W4PA 2DITA 2ZHAA 2R8JA 5BXIA 1AXQA 2IAJA 3BGOP 4F8RA 4Q44A 5ITHA 4IFYB 3CE8A 3G71S 5I3PA 4ZCMA 1HWIA 4KV8B 1OQ6A 4J37A 1TKTB 3KFWX 5A8WB 4ZLNA 4RUAA 1JLGB 4I7FB 4M5JA 4P75A 3OHBA 3KHRA 3BN4A 1ZAVA 2W9AA 2Q43A 3JSYA 3EVMA 3OXLA 1VQLS 2HGNA 3WQPA 5ETRA 2UVWA 2BJ3A 4XO0A 2J0XA 4OFZA 2W9CB 2B5JA 2DIVA 4Z2XA 2FC8A 3VF0B 1BQMA 1JLGA 4IKAA 2VL1A 3LGMA 3UN5A 2C3YA 2Y0SD 3FZBA 4X62F 1XMOF 3NLCA 3KMSA 1VC5A 4LIRA 4J9MA 1EP4B 2ZOGA 2ZH1A 1NAQA 2EI5A 4O3OA 1NDKA 5IFMA 1RHJB 4P72A 2DGVA 4LBHA 5D0EA 4X4SA 1FWLA 4B3SF 2WHOA 1OSDA 5T7LB 1S1UA 1S49A 3M7VA 1BWEA 3F73A 3TVZA 4Y6IA 4I64A 1UPPA 3T6JA 5HROA 2PI4A 4IR1A 1ELOA 2ZHBA 1FD2A 1NH7A 3LWLA 1UFKA 1TL3B 4ER8A 3KXDA 1Y9OA 5DZ6A 3FKBA 3VZIA 1VRUB 1ACMB 3PG9A 3VGSA 3HHLB 4K59A 4NLWA 2ILZA 4ZOSA 3BO2A 2HVHA 1AB8A 3LANA 1NK5A 1HD1A 3V4IA 3HSZA 4ED8A 1IKWA 5IV4A 1K47A 1XMBA 2QA4S 1TL3A 2VDHA 2BW2A 4HTJA 5C42A 4WTOB 5E41A 2PO4A 4N56A 5E3CA 3HHLA 5D8HB 4ES2A 3CDAA 2MJUA 4CZCA 5ETKA 2V2QA 3UFCX 5GAHI 2VKZG 2NQPA 1XERA 2CG4A 3I0RA 1NK6A 3UNYA 3Q8UA 3PNIA 4ZHRB 5DDOC 4DR1J 1B7FA 1HQ2A 4A8SA 2HHVA 2MXYA 1Q0NA 1A0OB 4X4OA 3PW4A 3VAGA 5G0RA 4KGXB 4F2SA 3C3LA 5GADU 1NJZA 1UZHA 3JTNA 1OJ4A 1N0UA 2WRMA 4LT6A 1VQ4S 3QJLA 4GC7A 4ED7A 1BMQB 3I5BA 2MSSA 5D4PA 5AJ3J 4YDDB 2AF6A 2MKYA 2GHVC 4OJ3A 2EFPA 5E3AA 4WWSA 2VICA 2AJ1A 1U6FA 3BM7A 1OO0B 3BPSP 3FRZA 3K8VA 3QFHA 4TLRA 1O5JA 3I32A 4LF1A 1UWAA 4USMA 1RDRA 2LLZA 1ICEB 2ALZA 2IFXA 5IS2A 4DPOA 3D6HB 4WFAQ 4P73A 1N5TA 3W2WB 3MM9A 3HSGA 1DTTB 3M1VB 2DD8S 3LH2S 3MEDB 2R7RA 2BQRA 4WZMA 5DO2A 4D3GA 2OSQA 1DARA 5B0DA 3OSPA 2K1RB 2V8GA 4OLPA 4F4AA 4IO9Q 1X9MA 4JV2A 5DETA 4IOCQ 1S77D 1GAOA 2E9RX 3IAS9 4KAIA 4KY3A 5DM6Q 4JBCA 3H4DA 1XWLA 4GO5X 1IKXA 1JKHB 4XPEA 3W8PA 2B6AA 1UVLA 2HAIA 2KL8A 1FK9A 4X2BA 1KHVA 3M8PA 4O3PA 3SQOP 3DFEA 1X0PA 2BRKA 2HNDB 2BE9B 1VK8A 1XR5A 3R3TA 2QMWA 3THPA 2ASYA 2GV1A 3MURP 2JWNA 2PFDA 1HQEB 1L3VA 1GTEA 1N88A 2BJDA 2RT3A 2G0JA 3PW7A 4U7UD 4Y2AA 2V4JA 3HFVA 2HRTA 2NXNA 5FJ4A 4NMLA 2H51B 4DPUA 2XC9A 2AX1A 3GTYX 4Q8FA 2AQ4A 4DV7J 1RXOB 5BR8J 1IKVA 1H2TZ 1RADB 3UNGC 1NNDA 3VR1A 1OSCA 4A47A 4E98A 4DV4F 1S79A 3DLEA 4NMXA 4ZIWA 2DNHA 4UOHA 3QIDA 4IRCA 2UUTA 3L7PA 3NKYA 1W2BR 3DHXA 3JAMY 7AT1B 2OO4A 4W98A 4O0IA 4KTQA 1I6JA 3C14B 1U2FA 4X4NA 3HVTA 1RGVA 3EDRB 2PI5A 2Y1RI 5AE3A 1D9AA 1ZM3A 4LQ9A 1IR1A 3DRYA 4F50A 1VOMA 1KRPA 2C3OA 3VAIA 2RQCA 3KUEA 4IG0B 1SH2A 2ACYA 3FCHA 1RKJA 5IC6B 5HLFB 2EC2A 1RAHB 4LF6F 4PUOA 1L3UA 2NXEA 5LMNJ 4FF1A 3HHDA 5A6PA 1V5VA 1KDNA 2XNQA 2EG1A 4EI2A 2Y1LB 2DJWA 2MJNA 3PIOQ 3J80Y 2QC3A 2LDYA 4LIWA 5CABA 4ANDA 3BZQA 3M9OB 1FKOB 5LSOA 4DG1A 4TU8A 2FTRA 1ZTTA 2FVQA 2JLFA 1DY3A 2WONA 1FA0A 1GFWB 1QSYA 5AXLA 3BPDA 3PO5A 5LSLA 2F4FA 1UW4A 4ZPCA 2E1PA 1MMNA 4WK3A 1YDLA 4C8KA 4UY85 2B8PA 2BJ8A 3LF0A 2VG6A 2XLJA 1D0EA 2YNGB 1AZSB 3L7OA 4KQZA 2FHJD 1EETA 3PR4A 1RTDA 1RU2A 3MEEB 1WACA 4DJBA 4HI2A 5J2MA 2B7CB 1IR2A 4PQUB 4Q5VA 2F8MA 5DDRC 3H25A 2B5JB 4MYTA 4N5SA 4OYOA 4WFZA 1S7HA 1CJUA 2VH7A 1YVFA 3DXBA 4NA2A 5CAAA 3PFEA 2UVVA 2KXNB 1KTQA 3JSMB 2RDJA 4ED1A 3UR3C 4L76A 3D3BJ 4UZCA 2MZSA 2JDJA 1FDNA 5CYQA 4ZMMA 4USIA 3A8JA 4DL7A 4PQUA 5J2NB 1FHTA 2HQGA 3CVKA 3ZXWA 1UWBA 5ETOA 2DR7A 1TELA 3LP0A 3D5MA 4KRWA 4GKJJ 3FEZA 4EO6A 2F8HA 5IQ6A 1AFIA 2HNYA 3IS9B 4TY9A 4CLPA 3OTBA 2M7SA 1YRXA 3CCTA 4U8VA 3E51A 3KDOA 2O1PA 3L09A 1HI8A 2UV8G 3UN3A 1HBNA 1VLYA 1GTHA 1RWWB 1YGYA 1YWXA 3CGIA 3EUNA 2DR6A 3HX9A 1GMWD 1SKUB 1UJ4A 3VQTA 2HW3A 1NPKA 2K1RA 4ICLA 4CLTA 4PYAA 4IUFA 5HJXA 2FY1A 4RW6B 4AXIA 2CRLA 1IKYA 1N8RT 3U1NA 2RDDA 3JTPA 1HI0P 3DMJA 3R5GA 4I68A 4DI6A 2B51A 1N54B 4GRSA 3IM8A 2QMXA 3FQLA 1VIOA 2E1RA 1Z2LA 2HAFA 3Q86A 4LUBA 5LL6d 3ZZOA 4FYVB 4URGA 2BJEA 3AXMA 5D3GB 2KTQA 2PFFB 1P1LA 3IGNA 5DLFA 1LWEA 2E5GA 5IWAJ 3LP2A 3G82B 1U0SA 1HR0J 2VA2A 3CJKB 1X4CA 1JLBA 2HFVA 1TVRB 2QLXA 3MTKA 1ZA1B 3UDCA 1MU2A 3C15A 2VF3A 3RB6A 4G65A 2IM1A 4WXWA 2V2ZA 3T1AA 1QE1B 2PA8D 2XMKA 3K2YA 2N82B 3OFFA 1VRTA 4ZJQA 3CWJA 2HS3A 1VHFA 3ZZUA 2YKPA 2OFHX 3SV4A 1N0VC 1Q78A 5ETMA 3ZZTA 3TUPA 4ZVPB 3MGJA 4LVOP 3AODA 3SV3A 3OXFA 2FLNA 1N5QA 3FQKA 3S7RA 2DR9A 2UUAF 1CJVA 1RT7B 1E6VB 1QAJA 4RBUA 1KQGB 3U1LA 2KT3A 3K59A 2UP1A 2A0FB 2WK4A 4MIWA 5HMZA 4K50A 1SQFA 1NJWA 4KJIA 1JNRB 1SVDA 4B08A 1MMDA 3AJ2A 2HQIA 1YJ9S 1I1GA 4DFPA 2XY7A 2HSEB 4MIAA 3NCQA 2ZH9A 2XG8A 3CDWA 3ILJA 2BA9A 3NNAA 5K20B 4DR6F 3IMQJ 3POTA 1SXLA 3P3DA 4P52A 1VQ8S 2DY1A 5KFWA 3A12A 4M5KA 1YBUA 2BJ9A 4ED3A 3TAPA 4A46A 1JLEB 4B9LA 4Y00A 3LPEA 2GJFA 1U1NA 4WTYA 4ALZA 1YBAA 2LQ5A 5KFUA 1RAOA 3FBFA 5KAKA 1R0BG 3G2XA 2Z57B 1MLAA 1S6PB 3FDSA 3LP1A 3NGUA 1U1KA 1RAGB 2ZWOA 2HHXA 2KH9A 1U48A 1JLEA 1VQ6S 4M63A 4LF7J 1A7GE 4DFKA 1NO8A 2W4CA 3TX8A 2ZZNA 3W60A 1N34F 1ZAXA 2MKIA 4N47A 2V5HG 1HNIA 2CPFA 4DEZA 2F9DA 2P2CB 1SQGA 2JLEA 2KN4A 2MMYA 4MTPA 8ATCB 2V8DA 4ILMA 1R89A 1B99A 2HBYB 5T14A 3L3CA 2V4QA 4XAKA 2H3EB 2WVFA 3C8YA 1KQKA 2ASLA 2AZ1A 3MOZA 1WG1A 2RU9A 4KH1B 4K0KF 2LQBA 3QIPB 4FNIA 4B3MF 1GK8A 3W5ZA 2CJYB 3QMQA 1FFSB 2J0WA 2NPIA 3R5AA 4R25A 3ZZRA 8AT1B 3T5JA 2GHWA 2ZOFA 4F4YA 3GIKA 4FXDA 2DRAA 4JP8A 3SCKE 5HO4A 1FO1A 3MI7X 4J9UE 3CO9A 2ZNZA 2KHCA 5A76A 4XIUA 1RTHA 3RJMB 3GYXB 4YR2A 3HULA 1VRQC 1WC5A 2DT9A 2LYVA 2QFJA 3R5DA 4X4RA 4UQGA 1S48A 5LM7E 1NDPA 2X51A 5LMNF 2CNKB 1WF1A 1NZ8A 4U6PA 1YKWA 3MMAA 3G8QA 4U7CA 2HFSA 3T5KA 2J6TA 3K5LA 4RW7B 2VJVA 3DM2A 4EGLA 3J81U 2HRUA 1WF0A 3EXCX 3OTDA 3QSYB 3UD3P 3RAQA 5A8KB 3MM6A 3T5HA 3PEJA 1PJ5A 2IJRA 3CD0A 4OZ0A 3TAMB 4USKA 3IO1A 3EVOA 2A2CA 2VG5B 2KKHA 1SH0A 5KFSA 4DV6F 2OTLS 3E01A 4K4XA 4JV5J 3IRXA 2ZHOA 1SKRA 5A8KA 1MWZA 2YWWA 3NRBA 4B17A 4DL0C 5J2MB 1FXDA 1W25A 1YSJA 3RRHA 4FF4A 3AA9A 4L3KA 3W9IA 1IKWB 3LWMA 2IYGA 1NDLA 1YJUA 2MGZA 4K4TA 5KFJA 3ZTRA 3B54A 1X4BA 3E01B 3TWZA 4EBEA 2DNRA 3AD9C 2X1FA 2WSFC 2YKOA 3ENVA 1EQ0A 1VJWA 3KK1A 1KP6A 4GMKA 4K4YA 1IN0A 2Z2YB 1JXLA 1PJ7A 2LFVA 3RZAA 1RAJA 2HVDA 1MG7A 2R7OA 1NSAA 2ZBCA 3FMBA 3SEOA 5HMWA 1S97A 4B9VA 2J0SD 2PEHA 3LP0B 4WU2A 1SH3A 2Q79A 3G6XA 4B9UA 4AL7A 4O3NA 1FRJA 4ZVFA 2BABA 4X64J 2ZOMA 4TLQA 2RSQA 4NYZA 1LWCA 4CTAB 4X65J 1XMQF 1BWVA 1KLMA 1HD0A 5SUHA 5JUMA 3OL6A 1Y3KA 3GJTB 3GR0A 3TP2A 4QWEA 4EYIB 4F4ZA 1H72C 5HN0A 2QN6B 2FJXA 1T02A 2QLBB 4NCBA 2EG2A 2FB0A 3OR2A 1HNXJ 4OHZA 1N5VA 2R42A 5J1EB 1ZA2B 4R0JA 1Q95G 1XBWA 1NPRA 4IH5A 3KK3A 1VBZA 1VCTA 5E5NA 5IT4A 3G9CA 2C42A 1GX5A 3CC4S 1X4FA 3D1HA 3GWCA 1TKDA 1CJTB 1XJWB 1N5YA 2M70A 1RP5A 2KHDA 3ZTOA 4JUZA 1B0TA 1JLFA 2CZ4A 2DTJA 2GIQA 3IG1A 1P9YA 1CULA 3M2UA 2IRXA 2MDAA 5B0FA 3BH7B 1DTQA 2F8EX 4EMDA 1U1PA 4RU9A 3EWGA 3KDNA 4ZPAA 1QSSA 4DR3F 4FBTA 3P6YC 1N56A 3JAMU 1DFDA 1EAYC 2P8IA 3H20A 3M2VA 4ZK7M 5HANA 2KYXA 1L3KA 2MQPA 2D9OA 2KFYA 1K73T 3TX0A 2AW0A 3O6QA 4HR2A 1ZH5A 3Q2SC 3BBFA 1JK9B 4W4MA 3SSQA 1AUSL 1U6ZA 4B3RJ 2DHGA 1U4BA 4EBCA 2Z58B 4OL8A 3GYGA 3TQ1A 2BW7A 4GVLA 5GVQA 1U6BA 3DXSX 3T1YF 3GG0A 4RNOA 4ES1A 2FLOA 3CJ5A 4OZLA 2PE8A 2R9LA 1VC6A 1G3OA 2ZKUA 1VJQA 3GFHA 5C25A 3N4WA 4TQSA 4LF9F 1X5OA 2ZFHA 3CTRA 5A8RB 1SL2A 4M95A 5L1KA 4DR4J 2RILA 1IVZA 3KWMA 1XMQJ 3QIPA 2UV8A 5IC4B 3THVA 2E9TA 2WVBA 3T1YJ 4RW4B 2DBBA 2F4VF 2HHSA 1QJHA 2CDRB 4P10A 3M8RA 1P9QC 2H48B 3N5BA 3Q83A 5DG9A 3AJ1A 3IBCB 2ASDA 2DIUA 3HJFA 3A13A 3BQ0A 3GJQB 5KT5A 1RT5A 1OY6A 3M30A 3ISND 4P6QA 1S6QA 1UEVA 3ZTQA 2JJ4D 4LR7A 1HI1A 3AOBA 3DRSB 4K2XA 4RW7A 4B9MA 3BGUA 3BYPA 4MJKA 4PABA 3KLHA 2AYEA 2Z0GA 4OHXA 2GZOA 2B4OA 4QZVB 3UWTA 1CPZA 2R3VA 4LF6J 2WVDA 4OX8A 4RJVA 2MHEA 2EVZA 3EZUA 1UJ6A 1SJ4P 3M2RA 2JC0A 2V8VA 5IT9Y 5DS7A 2DNQA 3POTB 5KOWA 3W2WA 3CCUS 2HZCA 5IQQA 4CO5A 2WBMA 3KJNB 3M6WA 1TAUA 3D0IE 4OX9F 5DDPC 3KG4A 5KG5A 1U0HA 3BR8A 2L9NA 2PT0A 2JNJA 3ISZA 3DLJA 2MLXA 1BQNB 4DX6A 2VQEF 1T9TA 1FXLA 5D0HA 3QGGA 1GXTA 1CVJA 2R7VA 2WW4A 4ZA1A 1EETB 2NSBA 1HQEA 4QQBA 3SQGA 3PYGA 1OYDA 5CH7B 1RHRB 2MKHA 4AQYF 1RT3A 3A8EA 4CRJA 4FYWB 1HLWA 4C9DA 1URRA 4KC5A 2KJVA 2ZNYA 2M0GB 1JJCB 3D7SB 2E66A 3FEXB 4LSNA 4YR0A 5EX3A 1HW9A 3JSMA 3OJUA 2XWXA 3O3LA 4DR2F 4KR0B 3PFOA 4CWBA 2AGPA 3DM2B 5A2QY 2C2KB 3D4JA 4KT0C 1O51A 1JLCB 1U1QA 2LEAA 4LREA 4DQIA 6FD1A 1AFJA 4KHPF 1V3ZA 4FPRA 4RWWA 3WX8A 4M5NA 3PV8A 3NCPA 2W9BA 3HVRA 3PX6A 3DLBA 3EGZA 2H5EA 3QWPA 2ACMA 3M6VA 2I9SA 1RTHB 2CQGA 4RL1A 3Q22A 1VQOS 1UVKA 2FGOA 2A3JA 4DSJA 4DPTA 2C2EA 1WNEA 4ZJOA 4P7TA 1S1UB 1NHUA 4DV3F 2KB2A 4CT9A 2QA1A 2QLWA 4UZBA 2CJAA 2OI2A 4KFBA 1FFGB 5F8IA 4BCAA 2HEKA 2VBWA 3N6LA 1RQ0A 5AXMA 5KT7A 1C0UB 2VZ9A 3QWUA 4C11B 5LJ3Y 1HMVB 1LW2B 1WORA 2K8GA 3EX7B 3A3PB 3MOJB 3A3NB 1KEKA 1T8EA 3SCIE 5I42A 1QM9A 3CD6S 4QU6A 4F2RA 3K5PA 2XCAA 3H5YA 3OFGA 1HHQA 2I5JB 1UZDA 3V6KA 1FVQA 3MR2A 4A8QA 2UUBJ 2DEJA 3MR6A 1LWEB 1EKRA 1U49A 2E1MC 4BDPA 2MKJA 4JI3F 2IM3A 2GJIA 3A1YG 3DI6A 3V4MA 2KDOA 2QRRA 5GMEA 4MYUA 2I0XA 2J9CA 5I42B 3QRQA 2I5JA 4YEAA 2Z2ZA 4MFBA 1GXLA 3CCWA 2GVDB 2MZRA 3BF4A 4O3QA 3R7SB 4A4JA 4NLUA 3RBZA 4DN9A 3IR5B 3NGDA 2NYIA 3OLBA 2I2YA 2BM1A 3CJTA 1EZZB 4LRCA 5KT4A 4LRFA 1M1KT 2CPIA 1RACB 3CULA 3PX4A 1YG0A 3S1TA 5LJ5Y 5A8RA 2RF2A 3TJ9A 5C5JA 2QL7B 2XLKA 1XEZA 2CVIA 3I87A 1QY7A 3HKWA 4N76A 1FX4A 4DV1J 2OPQB 2WCXA 2HQFA 1SJQA 3GYNA 2ZH2A 2YWEA 3M4XA 1Y5IB 3OJSA 2W2QP 1RJJA 4WCEQ 4JYAJ 3DLHA 3Q8YA 2BQUA 2Z56B 1TUWA 2DISA 4CI0B 3RB3A 4PG7A 1KOOA 1VBKA 2W25A 5KFRA 4B3OB 3DGVA 4IH6A 1PJ6A 3ENAA 4USJC 3UVJA 1JXVA 3MPUB 4M8LA 1FE4A 2VG7A 1JNZB 3H90A 4MK8A 3G4SS 3T1HF 3O2IA 3B4DA 4MK9A 3VAJA 1WG5A 1LOUA 3KLIB 2HFZA 1HBOB 3OHAA 3KHGA 1HWKA 3B8HA 4MKVA 4U7UK 5ADZA 2AEMA 3TW0A 2XS5A 2YNHA 1B0VA 1VQ9S 3QSIA 4ZVOB 2E29A 4HACB 2HNYB 3IS9A 1EP4A 2B9EA 3RU0A 3LQVA 3ONQA 2W8LA 3D67A 4RUBA 2VBZA 2OSRA 1KN6A 1U02A 2ZJRQ 1RLDA 4XDCA 1NJYA 4RLEA 1XNRJ 2BOPA 2I8EA 4RO0A 2RS2A 1XNQJ 1HBNB 4DSFA 3ZTPA 4R5PA 2GGPA 2E5IA 2IMWP 4N8OA 3SMZA 4DR1F 4WF9Q 1GEHA 2FUG9 4MKBA 2VHGA 3TJ8A 4DUYF 1HNIB 1ZZNA 3QT6A 1WG4A 3G82A 2VQEJ 1S1VB 3N79A 4RU2A 3OR1A 4Y2IA 2HKEA 3PHTA 1PSDA 2OMLA 3CJSA 1FEEA 2G2OA 2PN6A 3PJXA 4CO2A 3KLGB 1JX4A 2IA6A 5L46A 4F3OA 1QE1A 4HHJA 4JI4F 4KGKA 1R0AB 2PSZA 2AEFA 7FD1A 1VQSA 2VU5A 4RUHA 1SL1A 4K4VA 4JV0A 2AGOA 4LFBF 1YTYA 4V19X 4DL3A 4JI6J 5D0RA 2AJQA 1VDHA 1FTCA 2YX4A 2RQMA 2V8PA 1CBKA 3B82A 4PPZA 2YKNB 5HMYA 3LAKA 1RABB 3MEGB 2HG4A 1S72S 5D15A 4C8YA 2EXUA 1U25A 3V2UC 3ITHB 2D3O1 4IH7A 2AD9A 4F67A 2OFGX 2ZZTA 2OGUA 2AIRB 1FKPA 3WDOA 4WZQA 1WKLA 4ZP8A 2YWGA 3CXCR 4ED2A 3HD1A 1CLFA 2XQCA 4OYBA 5IT0A 4DR7J 3OTOF 1U1MA 3E3XA 4E8UA 2XHWA 3BH6B 4ZJLA 3M8ZA 2VUGA 1RCXB 2G1DA 4MH8A 3RB0A 2ZBQA 5HQLA 1VHIA 4HYKA 2OLWA 1FKOA 5DG7A 2C22A 9RUBA 5KTQA 1U26A 1RTIB 4FKXA 2RU3A 3R1LA 2W1BA 3UD5A 1CEZA 4NLXA 3OL9A 4F4XA 3M6XA 2LKZA 2BVZA 4CH1A 1F3FA 5LMUJ 1GMVA 5SZTA 3CT9A 2YPZA 3HI9A 4CLFA 2DGWA 2MHNA 2FVRA 2HMIB 3T19A 5F8JA 2ALYB 2Y0BB 4K5SA 2BQ3A 5DQHA 4WFYA 1UA1A 3DLLQ 2VPWB 3MMJA 1U0HB 5EX0A 5HBMB 4YB5A 4WKRA 5A0YA 3PXGa 1HL6A 3QGIA 4G1PA 3QJPA 3EJMA 4C4WA 1SIZA 2A1BA 3M6UA 2GJ2A 4PG4A 2PEBA 5A8WA 4J9QA 3UCZP 4G3IA 3CJQA 1T03A 3BDPA 1OYEA 4MT1A 1CQMA 3GLJA 3KMQA 4P7VA 3H2VE 5L8RC 3MAAB 1FNXH 2PMHA 4J5OA 1FDBA 4Y3CA 5KG7A 1QUVA 4RBVA 1BQMB 1GXUA 1VQMS 1JLQB 4XTTA 1I94F 8RUCA 5FIIA 3MCOA 3N6NA 4GO7X 1FKAF 4C97A 2XB2D 2B7BB 4CLKA 1KKHA 2FYXA 5KFXA 2YKMB 3NBPB 1M0SA 1ZBTA 2CJ9A 5FLXU 4DUZJ 1BD6A 3HCXA 3SCJE 4O4GA 1JJHA 5C7PA 4Q7AA 1LV5A 4LMZA 2FHOB 4G1QA 1KONA 5JVGQ 2CZ9A 3NWGA 4DV6J 2O67A 4MIBA 5D0GA 3K5MA 4ICLB 2ZH6A 4C3LA 4KGMA 3DC2A 4CDIA 1U1RA 1FF2A 4IFYA 2KYZA 1QSLA 4RW6A 2JH3A 4I69A 4ZPWR 3M9NB 5J2PA 4D3HA 5L9XA 2HVEA 1CJKB 4WPAA 4K4SA 2LU2A 2HWIA 4DQSA 4ZVGA 5L1JA 3G87A 4OYIA 3KYLA 1ZPWX 3HLUA 3NGRA 4DCPB 4RWXA 4M5DA 2XHCA 2PMZD 1V5IB 1RKIA 4C3KA 1TMMA 3GQCA 3QZ7A 3CCSS 2LEBA 3QJJA 3PTWA 4ZVTB 4DL6A 3OBIA 2MEWA 2GC8A 4ECSA 1EARA 3PZPA 1K0TA 1MU2B 4BBYA 4IFVA 3QRRA 1HWJA 2RDIA 3B78A 2BRLA 1RISA 2NXUA 2CNNB 3MWBA 1TKXA 1WF2A 3OXGA 1R8CA 3N9UC 4FNHA 2BR0A 3Q0AA 1OIAA 2PGCA 1EIYB 3L9ZA 1HYSB 2F7VA 1S9EA 4H4OA 2KG1A 2FLPA 1MNEA 3RR8A 1S99A 2AT1B 2DNGA 1S1XA 1ZOTA 2XMUA 3U7JA 4FYXB 1VLOA 4YB1P 2FVCA 2VG6B 4BLGA 1T3NA 3FSIA 4KPYA 5KG2A 5H9FJ 3HVAA 5EWGA 2P9GA 2HLTA 2IAJB 1CC7A 1FWPA 2VC1A 2XTJP 3VCDA 1O8BA 1NCLA 1NK0A 1KNZA 4YHHF 1H0HB 3W63A 2CXEA 1Z2ZA 4RUCA 3HDSA 3CCQS 4DQQA 1Q7YT 1E6YA 3CDEA 1M5VC 2R8IA 2NZCA 4JV5F 1VISA 1H2VZ 2EEYA 1P8GA 1K9MT 1O0PA 1SC4B 3TVYA 4WYWA 1HIYA 2V6AA 2VFTA 2AEJA 4RNMA 5K14B 3NP5A 3PO4A 4QW9A 2G0IA 2IYIA 5KFCA 2UUAJ 1SJ1A 1B70B 4RW9A 2XCPA 3JYTA 1EX8A 4Y0FA 5GAGI 4OHWA 3MR3A 4FYDA 3P4UB 4FF2A 2DNZA 2HWHA 2GO9A 3IC1A 3ULHA 2UU9F 1RWKB 4OI1A 3G8SA 2YNHB 3DDNA 4HTIA 3KLEB 4DS4A 4USTA 4USVA 1REGX 5KFQA 5G4DA 4DWIA 1PBAA 4LVNP 1X4EA 2G4BA 3PRBA 2VOOA 1FJGF 4NXNJ 1S6UA 3AOAA 2XMWA 3RAMA 1IQTA 4J9RA 2RRBA 1TK0A 1XIQA 3M32A 1KS2A 4KSEB 1VIXA 1YITS 4DZDA 3QPIA 1AYEA 2GMJA 5FDLA 4DQRA 1SJFA 5H9FK 4LF7F 3Q8QB 1IBKJ 1IXKA 3MECB 4OI6A 4H4KC 2ZH4A 2FJAB 4I6AA 4QOTA 1RAEB 4P2SA 3VTIA 1RE1B 1RI7A 1GT8A 1P1TA 1FCAA 2A6MA 3BKUA 3K7RA 1Y11A 2QTWA 2FY8A 5IM0B 4DCJB 3FBBA 1F1BB 4YB7A 5HATA 4NI2B 2MZQA 4X66J 2WAQD 3AD8C 5KFMA 4OZ5A 2V94A 3VV2B 2J76E 1SCJB 4MK7A 4B9SA 4NXMF 3DRRB 4DR2J 1X4DA 2V67A 5C2CA 1PKUA 1IJEB 2HGMA 4U8YA 1FESA 2MY8A 3AAWB 3GIRA 1YRUA 1J5EF 3MMAB 5CQGA 4CLUA 2VFRA 2YKMA 3NBPA 3D6MB 5JMNA 3B6BA 4NCGB 2ZH3A 1PYTA 3C6UB 1WI6A 1SJRA 2B4VA 1R43A 1YQHA 2GNKA 2L9DA 5B0AA 3TAMA 1Y0HA 3V6DA 1WJ9A 3QLHA 1L3TA 2GQQA 2IBOA 3X3UA 3GONA 2Q1LA 5HLFA 3KNGA 4OX6A 2BBEA 3FSXA 4UUXA 3BBBA 2VQFJ 4CM0A 3WC2A 2CPXA 4HLBA 5B0CA 4YFUA 1MROA 2I1RA 2XGQA 1DURA 4F3QA 1LK5A 3DRSA 4ZLJA 1APSA 1D09B 2HIQA 1Q16B 2R7UA 3DOKA 3CD5A 2R2RA 1RZMA 1ROFA 4UW2A 4ZVHA 4ZVRB 2BE2A 1IUJA 2B6AB 2DH9A 2WB4A 1TL1B 4ECVA 2MZTA 2SXLA 3OD2A 2MQOA 5F0WA 3R1HA 4JI3J 1F5AA 3KLVA 2GVDA 1CC8A 1DHMA 1M5SA 2COLA 1UVNA 5IT9U 2KJWA 1HPZA 4KIAA 2X3DA 2IVMA 4PPDA 5IXUA 2L3MA 5M2RA 2PA3A 1VMBA 1J27A 3NS5A 3UCGA 2FVPA 5K8OA 3BEGB 3HT3A 2DO4A 1H7XA 5RUBA 3FBEA 4ZN3A 2VJUA 4B3SJ 1QAYA 2RE1A 2RQKA 3W9JA 2CZVC 2M52A 1LW0A 4WYLA 3CCVS 2J6UA 2P5VA 3KHHA 2KI2A 1RLCL 2OHDA 2YH1A 3E2EA 3GIJA 1VK3A 2ZM6J 1ZAWA 2QA4G 1PO6A 2VPXB 1JLQA 2FHJA 2KRBA 4LRAA 2EFVA 2B4UA 2C3MA 2OD6A 3EM1A 2G1HA 2MZ1A 2R2TA 4JYAF 4KH0B 2YNGA 1RTDB 1D8YA 5E3QA 2CPHA 3MM7A 2KM8B 4B3TJ 4M1KA 4F7VA 5KFKA 2LQJA 1RHMB 2RAQA 2KT2A 3KLIA 1AUDA 2YNIA 2XZWA 1F6TA 2RRNA 3QATA 4HHUA 4UOFA 3J7YU 1T05B 1M5PC 2ZM6F 1JIHA 3EYZA 3TEHB 1RA6A 2B56A 4CM2A 5HQ8A 3CF5Q 1CSJA 1NJIT 1N6QA 2F40A 4YB6A 2AHOB 5CYMB 4IOAQ 1C0UA 4C11A 4EZ6A 3PR5B 1TP7A 2OPRA 4EEYA 4CYUA 2L41A 1KHWA 1V3SA 1YZ6A 1NUEA 3AQOA 1RT6A 3BJYA 2CQ1A 3Q24A 4YS2A 2DGSA 2UXBF 3FGVA 3K58A 5ETVA 1S1XB 2DNNA 2J8SA 4H4MA 4LF5J 3QO9A 3MUMP 1IWGA 4PZVA 5AE1A 2VOPA 5C42B 2K7JA 1S59A 3PEHA 4KO0A 1REVA 1TAQA 2YY3A 1XN9A 4WP9A 1NDCA 1S76D 4Y28C 2AKWB 2V2VA 3LGNA 1Q1KA 1YX2A 1IM6A 2G0CA 1I51B 1YK9A 4DV7F 1VQ7S 1ZM2A 1S4EA 4U95A 1UFWA 5B0EA 1PG5B 4HH1A 3TOQA 1SJ3P 5CCMA 1Y4ZB 1SQEA 4X4VA 1S1TB 1X31C 2B0GA 4ECRA 5J1PA 3GE9A 3G96A 3H5SA 3J7A1 3P45B 2PMWA 2UXCF 2ERRA 4C8OA 2WB1D 5HVFA 5L39A 1RUSA 3RR7A 4DR4F 4K4ZA 3QZ8A 3BGFA 3QT8A 4LFAF 2A2DA 3KUHA 4N77A 1DLOA 3X1LB 2QG9B 1RWXB 1S1TA 2B9XA 3IWLA 1FNMA 3HF5A 4LBPA 4OI4A 4RW9B 3JYTB 1XQIA 1S1WA 3TNVA 3SBMA 1RYSA 4YN3B 1LWFB 1FRIA 3W3SA 2JFKA 2C1EB 4QWCA 4NWBA 5E2QA 1WOOA 2PD1A 5I4MA 4ZCLA 1NSQA 1D1UA 4CO1A 4I56A 3C16A 2E7XA 4K8RA 4UTGA 4ECZA 1C2PA 4QU7A 4LR9A 3WBZA 1RBOB 4DHVA 2CPJA 2R7WA 2JLGA 1Q8IA 3A8IA 3TZXA 4ELUA 1HBMA 3FK4A 3GV5B 4AQYJ 3BGLA 1MN9A 1X8DA 1HQUA 2GVZB 1IBLF 4OI2A 3V6HA 1FWKA 2B9WA 3D1OA 3R2CJ 3VVUA 1IBKF 2RVJA 4C7QA 4PCQA 1L5UA 1H98A 2XGPA 2HS4A 4QBUA 4ZPVR 3UDVA 1V9OA 4DXLA 3LO3A 5HP1A 5HK4A 3MEDA 2A18A 2ROGA 2LA6A 5DJBA 3TUJC 5AE2A 1AT1B 2X7IA 3D3CJ 5HBMA 3S8SA 2CQIA 5CA5A 3I55S 2FC9A 1GX6A 3SCLE 1RBAA 3DYAB 5F8LA 5C2GA 3NNCA 4LFBJ 5JJBA 2QFIA 4HT7A 1NZAA 3HHLC 5EGYA 2XO7A 2RNEA 4OV1A 2YX7A 3CMAS 2LECA 3OLAA 2NUUG 2X3GA 4FYYB 5FDLB 3TQEA 2AGQA 3MAAA 4J9PA 4OYZA 2W7OA 5CZVA 2CJKA 2FZGB 4HEA9 1BHNA 2MKKA 2DRDA 1G1XA 4QIEA 1PIEA 4YY3J 2FZCB 1T9UA 5AXKA 3UDEA 1NK8A 1K1SA 2EK1A 2BKOA 1UEUA 3OR1B 4HT5A 4PG5A 5C25B 5A2QU 4DSEA 4NI2A 4ECWA 3K8WA 1B3TA 3ZZZA 4LRBA 2C28A 1NHVA 4QR2A 2E1CA 4DR7F 4ILRA 4X62J 2HK2A 1HHSA 1XMOJ 4OZ1A 3FUYA 3QYYA 3NNHA 5F8GA 2YPYA 4OLOA 2CJBA 1J2VA 3HJVA 3IA0A 4I7FA 4RW4A 2UUCJ 2IM2A 4R8UB 4ZITA 2ZE2A 2MQ8A 4UOCA 1FDAA 1NSPA 4H54A 3R5JB 4PWUA 2LVWA 4QIGA 2LQ8A 4O0NA 3J7YI 4LF8F 5DQIA 5KT6A 1TK8A 1DBDA 1RT4A 5D4NA 2E5HA 1DZ5A 2H4WB 1TL1A 1HWUA 1KFDA 3DLKA 4O4RA 1GQEA 4OJHA 2JSXA 2CPYA 2EFGA 2PDAA 3O5TB 2ZJPQ 4NLSA 2M5YA 4NPOA 2OUGA 3SFUA 5KFYA 2J9DE 1X9SA 2VBXA 2UUCF 1RT1B 1U24A 5D77A 3KOAA 1AW0A 1IJFB 1HPZB 5IWAF 2DY9A 4P71A 4DV1F 1WSVA 2M9KA 2LDIA 2DGXA 5T7LA 3WC0A 4CNZA 2DHXA 5BYSA 3JB9k 1QLNA 1SBRA 3DOMB 2DPJA 1PAUB 2BJ1A 4UOGA 4BS2A 2HQCA 1RT1A 1SV5A 2K3KA 1NSKL 2QJ3A 3ILOA 1SUQB 3AXKA 2HYIB 4JI7J 1TTHB 1VRUA 4NLOA 1IQZA 1Y3JA 3KK1B 2OEJA 3I31A 3OQ2A 2D3UA 3GV8B 3FSYA 3M8QB 2KRRA 1SUQA 2QSWA 3R8YA 4B02A 1FERA 1RA7A 1RCOB 2CDQA 2W2MP 1VFJA 1T9YA 1QD1A 2AZ3A 2IBKA 2N4DA 1QTNB 3RRKA 3W65A 4JI2F 4ZLPA 1C1BB 2DNMA 2W4DA 1LWCB 5KFNA 3IAM9 3OTCA 5IV3A 2V68A 4AYBD 1TZ0A 2W2OP 2CA9A 3CC2S 4CCHA 1M1GA 2GQCA 3AOCA 2DGQA 1S7IA 1VQYA 3A4TA 2B4PA 3GG1A 4Y34A 5DG8A 2MLZA 4IG3B 3HFKA 2Z30B 2G9OA 3FRYA 4KKOA 1EB0A 3CCZA 4URQU 4AUKA 4TN2A 1KC8T 3RBEA 2HZVA 2YH0A 1Y5NB 2IIHA 1BE4A 1D3WA 1FEHA 3W61A 4KV8A 3H2UB 2XY5A 3KTQA 3GV7B 3T9ZA 1H7WA 1NLKL 2I38A 4I4BA 3CC7S 3D1QA 1N5SA 5AXNA 3KUGA 2ZD1B 4V1Ak 2VFUA 1H6KX 2FJDB 3RBXA 2HFNA 3KK2B 1ZYQA 2J0QD 2R7TA 3FVYA 4N7TA 2Y3YA 3MTJA 5KFEA 1UFLA 4O4GB 2CQBA 5HI7A 1REVB 3DCAA 2CG8A 5GAGU 4X4QA 3IXQA 1YIJS 1NJXA 2LEPA 1YHQS 3DN9A 5D4OA 2WOMB 4BC9A 1VI7A 3H59A 3KK2A 1Y5LB 2V9KA 2OPRB 3W66A 5D3GA 1TV6A 2C3PA 2OPSB 4F36A 4EZ9A 2F4VJ 1JWWA 2MQNA 2DVIA 1RT6B 3M05A 2D3ZA 3I0SA 5AJ3F 3VALA 2KZMA 3HK2A 4WE1B 5EHHA 3F41A 2IA0A 4K0KJ 2BX6A 3M8PB 3EVWA 5E3PA 3D9BA 1R8BA 3W5XA 5H9EJ 1OY9A 1DLOB 2VV5A 2ZWPA 3PKMA 5CXTA 2ZUGA 4H4KA 3GILA 2W2PP 1JQGA 4NRTA 4Q0BA 1CJUB 1WHXA 2R7QA 2JZ5A 3D28A 4QYRA 4HVZA 2B3TB 2HFUA 1S9GA 2FQQB 2XMJA 3G86A 5FLXY 6AT1B 2NXCA 2BKPA 5L38A 3OW2R 1HNZF 2V69A 2VD3A 4ENOA 2X1AA 4A48A 2GMHA 1HKAA 3NEKA 3TA0A 1S6QB 4ELTA 3C15B 1V3RA 1UWBB 2EFNA 3HFZB 5F41A 1WKKA 2VB6A 3I6PA 4MKYA 1TFYA 2O5DA 4RW8B 4DZ6A 3QBCA 1SC1B 4I2PB 4OZJA 3W5YA 1YJNS 2DR8A 2NCKL 4O23A 3BKTA 5H9EK 2FLLA 4RPFA 3RUBL 2FGCA 1BUXA 1T9XA 3MHYA 2GHPA 4ES3A 5GAHU 3VAHA 4QIWD 4DL5A 1FJGJ 3JSRA 4WIIA 3BSOA 3PACA 4LSLB 4ECXA 2GS8A 1RTIA 5J2QB 1SPBP 1CJVB 4DBQA 3AH6A 2KFNA 1WI8A 4I2PA 5F3TA 4JI8J 4PXEA 2DH8A 3LA0A 2VKRA 4LFCJ 4CLYA 1UKUA 2AU0A 3MM8B 4ID5A 1KOHA 4NLVA 1KD1T 4NEYA 3BR9A 4IOBA 3NOGA 3WIUA 2J9EA 3TYTA 5DQGA 4ZN1A 3V81B 2HHQA 1P6TA 2Q6CA 3MCSA 4KGVB 4AFFA 2XWYA 2XMVA 3OFEA 2DCUB 2ROPA 3HSDA 4TU9A 5KG4A 1U1LA 2HQDA 3AD7C 2MLYA 2DNOA 4WBFA 1SL0A 2DR5A 3ADAC 3VAFA 1Q79A 2O66A 3PVXA 1C4CA 2P9EA 3IR6B 1DQ8A 3D2WA 2OH2A 2VODA 2EC0A 3RG6A 1FK9B 4AL6A 2WSCC 4X65F 1EKSA 5KG6A 4DSLA 2XZTB 1LXNA 4QWDA 4ZIVA 2HNDA 4AD6A 4DV2F 3RW6A 3GJRB 4HDGA 3EZ5A 4GVBA 5E3RA 1S1VA 2EK6A 3L95X 2V0NA 5CHCB 5IM0A 4BWMA 1LW0B 1U2RA 2XY6A 3W2VA 5K8NA 4DL2A 4MAKA 4Z7YA 2OEKA 3W8GA 4CO4A 1TU0B 2ZH7A 4JI2J 2RH3A 2K3IA 4HDHA 3L7UA 3DRRA 4QPTA 2QT7A 4DOZA 1Q4RA 4ZLLA 3I5AA 3LGHA 2E7VA 1NEEA 4USUA 3PIPQ 2UVUA 2YTCA 1KVIA 4TXSA 1RT7A 4ED5A 2OP5A 3W2VB 1P27B 2R4FA 2HFOA 3KJFB 3CJ3A 2ZJQQ 3BREA 3ISNC 3QGPA 2UUBF 2ZBIA 3UDLA 2Z4PA 5CYQB 5AT1B 4A8YA 1FJCA 3M8WA 4ILLA 1ZPVA 3WZ0A 1T05A 1DRZA 5J2PB 3N6MA 2DH7A 2LA4A 4ZCKA 4DPXA 4J9KA 2E5LJ 2CADA 1EJ7L 3F56A 3NS7B 3PRDA 1GMUA 1XR6A 2XSFA 3KJVA 5H1SV 2IHR1 4I6WA 2QZ8A 2R7SA 2JEIA 1NK9A 3NS6A 4YMEA 3TO8A 4CYUB 2VONA 1TL5A 3H5XA 1HMVA 1LW2A 2CWXA 4J91A 2VASA 4LF4F 3HVWA 2CYYA 4NL5A 4YR3A 3DKDA 1VQKS 3R5BA 3QT7A 2ADCA 3OVBA 1DQAA 5ETPA 1HNWF 3M9MB 3D66A 4L3NA 4U67Q 2BJ7A 1TKZB 2E5JA 2GAGC 3SI8A 3EICA 2WVEA 2HS0A 3DMJB 3MEEA 4NA1A 4ZPBA 2J5AA 3DOMA 3MPVA 2R2SA 4NZ6A 2AJ4A 4K4WA 1S57A 2M3DA 1WDTA 2HNZB 1BQNA 1MWYA 2V50A 3IFEA 3MPDA 5T41A 2ZUAA 3IRXB 2HK3A 2BDPA 1HWLA 1YZ7A 4UF4A 3CJ0A 3CJKA 3TA2A 1BLUA 3H4BA 4G1IA 1NU4A 4A8KA 3C2PA 3GSIA 4OV6A 4A8XA 3DGPA 2IMOA 4NLDA 3PJWA 1B7YB 4TY8B 1WELA 4WU3A 2VC0A 3VGTA 3TAQA 4Y2KA 4J9OA 1RK8A 5KT2A 2LMIA 5F0UA 3HM9A 5KFLA 4PAAA 3RRGA 1IBMJ 2C2ZB 1JXEA 2DGOA 3OR2B 4UT4A 3NMRA 1O6XA 2NLWA 3KG0A 3GFYA 3NXZA 3HO1A 2V4RA 2HHTA 5CZXA 1UP1A 1UETA 4NLTA 1NRKA 3J81j 2B43A 3W9HA 5K14A 4DCOB 1LK7A 3CCRS 5EN1A 1QDUB 2F3JA 1Q7LB 5DGAA 2ILYA 4CO0A 2CPDA 4C8ZA 2IDLA 5HSPA 1U8SA 3IM9A 2YKQA 2W9CA 3EGVA 4JI1F 4N41A 4ZS6A 5DLGA 1IBMF 2N7YA 2E5LF 3SSSA 2ZEJA 1TUGB 1QAIA 4O3SA 2DXEA 2OJ3A 4B9NA 3MCMA 3ZNJ1 2E9ZA 1TKTA 3RAXA 1HA1A 4F4KA 2OELA 4F3MA 2GGPB 2JC1A 3GCWP 3V4IB 2LXIA 2M88A 2JEJA 4JI8F 3AQPA 4NASA 3Q23A 2FIUA 3C19A 4QYZK 4C8LA 2YXLA 4TKTA 4USHA 4ZVSB 4I0WA 1UVJA 1H3DA 3PM9A 1CJTA 1T0TV 1N5YB 3AA8A 1N33J 3HHLD 2FJWA 2RQ4A 3PYDA 2BYCA 3I9ZA 3M8SA 1KVJA 3DNCA 3DYAA 1TL7A 3ET6B 2N7CA 1UMJA 4Y2MA 3H0PA 3RTVA 4WXOA 2XO6A 4DQPA 4NRUA 4OYAA 3J80U 2OPPA 3DRPB 1S6PA 1WEXA 3AHPA 3H42A 1K44A 3I0SB 4R0EA 4ZVQB 5C24B 4C0OC 5ETNA 4LFAJ 2AX0A 2W01A 4LF2A 3U1MA 3US5A 3NG8A 3BO4A 1MWQA 4DF4A 4F26A 1RYRA 1KQSR 3ZZYA 5CD4H 2GIRA 4DX5A 2DCLA 3HXMA 1R0AA 3MEGA 4NLGA 1S0VA 1KWMA 2CJQA 4MMOA 5F8NA 5C24A 4DR6J 1UPMB 3BYRA 1LEOA 2C3UA 3LTOA 1TVRA 4FPIA 3SIPB 5B7WA 2VQFF 2F9JA 5LOQA 2V63A 3PJ9A 2Y1IA 3TANA 1NKEA 3MR5A 3CDBA 2XSJA 2K2PA 2CFXA 2UUWA 3FFIA 4TYBA 3LAMA 2NPFA 3BQ2A 1C0TA 4LQ3A 2HURA 2D69A 1S1WB 1S10A 5KFTA 4EUVA 2JFDA 1G7CB 2JOQA 5LXRA 3CCES 2DXDA 4EFAC 2Q66A 1S9FA 2H5IB 5CD4A 1IBLJ 4K4UA 2Q6BA 5KOXA 5EDWA 2B9YA 1FX2A 3QQCD 3KLHB 2P9CA 2QLFB 3O1LA 3UO0A 2YBVA 4LF8J 2HVIA 5HMXA 3EPIA 2EBEA 2N4CA 4FP9A 4P9SA 4HI1A 2VPZB 1WEZA 4KHMA 2D41A 4NXNF 2UXBJ 1DJ0A 1HBMB 3EXYA 5B0BA 1YJRA 2CNLB 1R31A 4HHHA 1DTQB 3CJRA 2FHMA 2XLIA 3I5CA 1FT8A 4O3RA 3QGHA 4W92B 4TQRA 1BC6A 3NAHA 2L9WA 2WVCA 4AE5A 1I5OB 3BQ1A 3I4HX 2DPIA 1Y10A 1UL3A 4FXWA 3UCUP 2CQ0A 2XZDB 2VBYA 4JB8B 4QWBA 4Y65A 5DGBA 5M2UA 1R0CB 3I9V9 1NK4A 3GIIA 1T7PA 1DTTA 4IRKA 5KFDA 1V6HA 2WONB 3KLFB 1LKZA 3GB0A 4QR0A 3MM5A 2IPOB 4FXVA 3CIZA 3M2RB 1WC4A 3R6LB 2YNFB 4ATNA 1TL4A 2UXCJ 4L72B 3OVSA 4WJBA 3WX4A 2ZDOA 2BACA 3SYZA 2PC6A 2U1AA 1X5TA 1WHYA 3VVTA 3WIVA 1RAFB 2YWHA 4DN0A 5ETLA 1W7WA 1WOSA 1NM2A 4HL9A 2ZH5A 2V34A 2DNKA 4B3RF 4DX7A 3Q8PB 5F9NA 1R3NA 1GH8A 4URSA 3CD7A 1X9WA 4GKKF 3LPYA 2M8HA 5GAEU 1LFWA 3NWRA 4NYOA 3HHNB 1IR0A 3EGWB 2CUYA 4IYQA 4PG8A 1QVFR 1A9NB 2CWKA 2XYPB 2G2ZA 2BXJA 4OX9J 2P6TA 2V4JB 4PWWA 4M5HA 3R5CA 1KTVA 1VGYA 4XPCA 4FVCA 1Q5VA 4C0HA 4DFMA 2WZ1A 1N6QB 2CQ4A 2J8AA 4ECQA 3ENWA 1HHTP 2GQ2A 3ELHA 3CUNA 5HAOA 4WKYA 1VQPS 4PXBA 2QL9B 2WW8A 4DU7A 2C2DA 2CQ3A 4AT1B 2G2YA 3K89A 1HNWJ 4AL5A 1WTFA 4C2MA 2JRSA 4NA3A 3N0VA 1CJKA 4DSIA 3TZYA 3EE3A 4IFVB 3MAQA 1CQNA 2MGZB 1VC0A 3PHEA 1FXRA 5KFGA 4X64F 3OSNA 3MFIA 4FBUA 2XMMA 4JI0F 4BWJA 2XEXA 2IJFA 1AZSA 4QW8A 3OVAA 1N48A 4V19J 4PG6A 5BYRA 3K5OA 2MSTA 1TUVA 1JLAA 3CJ4A 1X7VA 3JS9A 3CCLS 4DV4J 3W7BA 2HWTA 2FPHX 4C98A 5FD1A 4DSKA 1M1HA 3ILIA 2MKSA 2KM8C 3R7BB 4KHPJ 1TR0A 3ENQA 4IG0A 2ZBRA 1BXNA 2DK2A 4B9TA 4DG1B 1UA0A 3GCXP 2UXDF 2ROEA 2HBRB 2CAJA 3MPWA 1SC6A 2BUNA 3KG1A 4F0KA 2XMTA 3M8YA 5JXSA 2RD5C 3GMGA 1OY8A 2LP4A 3DOLA 4Z37A 4MKAA 1NB2A 2C2NA 1RT3B 3TUIC 1F0XA 1WC1A 3CO0P 3Q2TC 3LW5C 3CB4A 4L6V3 4AXJA 2N3OA 5K8PA 4X4UA 4OJ1A 1RWMB 2J9DA 3LALA 2BEFA 1BGXT 1BY9A 2HIYA 3IRWP 1N34J 1UJ5A 2QMUB 3QAEA 1EHWA 3VHQA 1I3OB 4FDFA 3R97A 4A8WA 1PYOB 3U02A 4DUTA 2R8HA 2M2BA 4X4TA 1XNQF 1PCAA 5ETSA 3R9LA 1R8AA 3SSRA 1RAIB 4ZKAA 4GC6A 3C6TB 2EKNA 2VG7B 2VDIA 2ADBA 4ID8A 4NLRA 1H74A 1C1BA 2EFQA 2CKWA 1GMWA 1Q8LA 2GCFA 3DU6A 1CULB 3UPFA 3JTOA 1F2HA 5E7OB 2BANA 3BS9A 4C6AA 2VIHA 2GMLA 3K5NA 3M1VA 2IVYA 1Y00A 1FD8A 4OMFG 5J2QA 4ETZA 5BR8F 1WOPA 2AJ0A 5THWA 3V5RA 4Y2CA 2A6OA 3MMCB 3WHIA 1FNOA 5A0YB 5LMUF 3MD1A 1M90T 3D6FB 5J2NA 5F8HA 4LRDA 4QR1A 1FRXA 3THTA 4NEZA 1IKXB 1B0PA 3TEGA 3HHKA 4YY3F 3E8OA 2M8DB 4EO8A 2DXFA 3KLEA 4NXMJ 4ED0A 4FZVA 4Q2MA 3MECA 4JI6F 2DO0A 2WTFA 3MMCA 4KE5A 2YWKA 4LBIA 1VQ5S 2ZD1A 3PW5A 3RGIA 1NPPA 2H4YB 3M2UB 5A6WA 4LSZB 4YOEA 4LFCF 4CT8A 1NHKL 1YJVA 1WC6A 3NGKA 3OL8A 3HSJA 2C2RA 4I2QB 4KGZB 4IRDA 3OUYA 2DNPA 1R27B 4LJMA 4ECUA 4MFBB 4YDXA 5I3QA 5KFVA 1A6LA 2IM0A 1S4FA 1D9DA 4UY8T 4JI5J 1UVMA 2YNFA 1FJEB 1X5SA 4KO0B 3QFWA 4J90A 2EKYA 3AJDA 2E44A 4NOHA 2I6WA 1KR4A 3JXOA 1HYSA 1SB6A 4QYZJ 1F9HA 3TUZC 3A3OB 3MR7A 4J7CA 5D4LA 4DUZF 2XNRA 3EZOA 1S9GB 3RYLA 3I82A 4ZP7A 1ZM9A 2ZDPA 2XI3A 4P2FA 4XDDA 4C48A 2CQPA 1VBXA 2AYMA 5EWEA 1WWHA 3OT9A 2X1GA 4PXDA 3KLGA 3QLHB 5DM7Q 2HBQB 3P96A 4ITSA 4DL4A 4Q0BB 2ZH8A 3FFIB 2QGFB 4EBDA 3HVTB 1F9FA 1IM4A 4WK1A 3HPOA 2APOA 2HLUA 3FBCA 3H98A 4HH0A 5ETQA 3VWSA 2DKOB 4YP3A 3ZO7A 3DLKB 1ITPA 4DUYJ 4EK2A 3TVKA 2AWZA 1MROB 3AY0A 3T6BA 2BKNA 3AT1B 2XYHB 2POKA 5U47A 2QL5B 2JEGA 4ANCA 1HBUB 4OX7A 2F65A 5KFIA 3TI0A 2BOAA 5K8MA 2FD2A 2R8GA 3IWNC 1ZS6A 4EYHB 3GSDA 2DHAA 3DDKA 1S6OA 2ZKTA 4HACA 4Z7CA 4F02A 1SIWB 2FHKA 4CH7A 5B09A 4M94A 3MPYA 2RRAA 2HQ3A 2GW8A 5D78A 2RKIA 2DHHA 3DOKB 3OV7A 4DV2J 2HMIA 3P5BP 3CCJS 1CS4B 4CH0S 3FMWA 1PILA 2ABYA 1SI9A 2AJ2A 3HKZD 3PY8A 1WHWA 4M5GA 4NZ0A 2CPZA 2J7WA 4PKDB 1LNQA 2CJXB 3ZZ0A 5F8MA 4J9SA 4J9NA 4JI7F 2MQMA 3N28A 1R6YA 2W24A 2ZZMA 2ZITA 2FDNA 1OQ3A 1CS4A 1H73A 4DR3J 3NGSA 2JVRA 3JQJA 1LXJA 3CEDA 2YQ3A 3NY0A 5MLCV 1QVGR 3PDNA 3BKFA 1RTJB 1M5HA 3MMBA 3MM7B 4IG3A 4LR8A 3RB4A 3SQGB 2GIFA 1PC4A 3DHWC 4DV0J 1RT2A 3PW2A 1F60B 1U09A 2XM3A 3ZZPA 5B08A 3JQKA 3T1HJ 3O8WA 3ETOA 4DX8H 2W7AA 3UVJB 4RNNA 4EU0A 1LWXA 3F0NA 3FJ2A 1RTJA 4K5RA 5HJYA 4G1QB 4LF5F 3GR1A 1RT2B 4KFBB 3J7Z5 2AJFE 3SZ2A 4DU8A 4NCGA 5HL7Q 5GMDA 1VR6A 2YNIB 4OZNA 2HHPA 3UQSA 5F9LA 4F0MA 1FRMA 1G2EA 1JLAB 4NYPA 1VQNS 2CIMA 1HW8A 2NYHA 4M5LA 5KG3A 1JJ2R 1WDDA 4UUWA 1ZZFA 2BZ2A 4ELVA 1X4GA 2KXHA 2AMCB 4E0DA 1IKYB 1J5OA 1UW9A 3UR0A 4PYDA 1MMLA 2YKAA 2QLJB 4S0MA 4F04B 2J6SA 3KNAA 3DOLB 4DPYA 1JB0C 1PYSB 1PC5A 4OZ3A 1TL7B 4A8FA 3CW2C 2J7UA 3T41A 3G6VA 3QRPA 1T9WA 1TKXB 4OZ2A 4DV5F 3KJQB 4ZDNA 4F0HA 1Q81T 2W8KA 4QIFA 3U27A 2HVZA 4RZRA 1KLMB 4TU7A 3G6ES 4DLGA 1B64A 3T9NA 2NUHA 3OL7A 1T03B 2RHSB 4E2FB 2OTJS 4P2MA 4DMZA 3DI6B 2OPQA 4I6YA 3CSKA 5G0RB 4OHVA 3BSCA 2H5JB 2E7WA 5J1EA 1SC3B 5JVHQ 3TZZA 4JV1A 1WC3A 4DR5F 3RBDA 3S6EA 3KK3B 2QIFA 1D9FA 4C3MA 5L1IA 4ZHRA 1X60A 3QO9B 1QUPA 3B4MA 4RBTA 4PWDA 2R2UA 1ZETA 3D54A 3JSBA 2QE5A 3IP0A 3C16B 4NX9A 3W1YC 1Y7PA 5J1NA 9ATCB 5KFHA 3S01A 1ZM4A 3UI3A 2HRYA 4C8MA 4QWAA 1S12A 2CQHA 3F44A 3I4PA 4IDKB 1CG2A 1Z1ZA 5I3UB 4J9LA 1N36J 1LWFA 3OFHA 4OYWA 1Q8KA 4X84A 4DR5J 1H38A 1RB0A 3R27A 3C46A 2GVZA 2RB7A 3MZIA
chains in the Genus database with same CATH topology
5LT5A 1KSPA 4RNFA 4ED6A 2X1BA 6FDRA 1YJWS 3BSNA 5HP1B 4FS1A 1OPZA 3C66A 2RJZA 1WTBA 1E6YB 1UVIA 2UVRA 1TFWA 2JVOA 2DB1A 3MXHP 1FTRA 2D74B 5K9FA 5LXYA 2D9PA 4X66F 5CYMA 1JLFB 2HHHF 3K0JA 3EGNA 4HKQA 4TYAA 1S0MA 1RWUA 1Q53A 2JHEA 2QA2A 4Q45A 3PKYA 3EPGA 4A8MP 5KG1A 1FE0A 5KFZA 2DHSA 3MF5A 1S0OA 3VAKA 2LXFA 2WOMA 2V9WA 2KG0A 4H4MB 2AP6A 4A8OA 3IG1B 1XR7A 1Q8BA 4OJGA 4R5PB 1N32F 2RUGA 4WE1A 5BJRA 3DU5A 4WFBQ 2CQCA 3G8TA 3MAHA 2OD4A 1PGZA 4KBIA 2OPPB 3DRPA 4LSNB 2ZC4A 3MMBB 5K5MA 1H2UX 2YWFA 3M30B 4IQMA 3I0RB 3NCRA 4EWTA 2GO8A 2M4MA 1WEYA 4NLQA 2IVFB 2P6SA 1VS3A 1X0FA 2Z2MA 2VPYB 3V6JA 1HBUA 1XNRF 4PXCA 3ZC4A 1HFEL 3HZEA 5D6GA 3J81Y 1YRTA 4R8UA 5KFBA 3K57A 3DRXA 3V6DB 2AYBA 4PUOB 4PRFA 1BQXA 2XSJB 2CQ2A 2ZVSA 2CPEA 2VFVA 3BDEA 2NSCA 3VAMA 1F5CA 4F4WA 3VQSA 3MM6B 4I1TA 3BGRB 4ECYA 3CMES 2KXFA 4TNOA 1XTZA 4ZCIA 5DRKA 1HNXF 4DS5A 3BSAA 3CCMS 5KFOA 1NH8A 3C6UA 3SFGA 4DF8A 5KT3A 3TARA 1N52B 2LCWA 3D0GE 4GKJF 1KQFB 2R7XA 2DGUA 4NLYA 4DDFA 2VA3A 3MEKA 3VZHA 2YX1A 3HZGA 3TR5A 2NR0A 3T3FA 3DLGA 3SDEB 3M8QA 3N01A 2RMLA 4C7QA 1YIJS 3H5UA 5L1LA 3M32B 4BHQA 2RKIB 4Q8EA 3MM8A 4ID5B 2JL9A 3V81A 2D7SA 3DLGB 2O3DA 4TY8A 4O44A 3SDEA 4WFNQ 4KB7A 2L48A 1X4AA 2ZC3A 4YQWA 2JX2A 2LQ9A 2L08A 2DGTA 3LP1B 5E0OA 5LSRA 2A10A 2HGLA 1YI2S 1T95A 1K0VA 4CTAA 3Q8RB 3IR7B 3Q8SB 1DAXA 3GIMA 2EPIA 3MM5B 4ERDA 3HHEA 2W7PA 3IN5A 2FVSA 1NK7A 2WSEC 2EFOA 1HR0F 4PWDB 4IO1A 3N5FA 3KKFA 1C1CA 1XK8A 3O44A 2GFFA 4RNHA 4WFXA 3H2LA 1FRKA 2KO1A 1OS5A 3KHLA 2N3LA 5F3ZA 3HP6A 1JLCA 2BANB 1J5OB 2XULA 1NB7A 2ZE2B 2KU7A 3PX0A 1OWXA 5BYQA 1TV6B 2OPSA 4FVMA 1R8HA 1KFSA 3ZFVA 3UW1A 5IZHA 1TK5A 3IWXA 2BM0A 4KKOB 4ZPTR 2W9BB 5HROB 3UD4P 1QAXA 1OPIA 4PR6A 1MSWD 2AV5A 1QTMA 3G6YA 2O01C 4X4PA 1JLBB 3NMAA 2IJNA 2R8KA 2IC3A 3J7ZT 1FJ7A 2VG5A 3BO3A 2WBRA 4OIXA 2XS2A 4M5DB 3QAUA 5DDQC 1FRHA 2JEFA 4JI1F 4ZVEA 4ETXA 1R7IA 4PQAA 3I56S 2QEXS 2FJEB 3LP2B 5GAEI 3H40A 1XC9A 2QSFA 2DNLA 1T3OA 1U7LA 1N36F 4CIOA 4C8NA 3H8YA 2XS7A 2HNZA 3AB2B 2Y1JA 2EWHA 4OI3A 4I67A 1WD6A 2MY7A 4FF3A 4NZ7A 1C0TB 3AB4B 4ECTA 1VRTB 4OI0A 4UQTA 1E6VA 4OHYA 1HNVA 3FNNA 3UE2A 3PW0A 2NS1B 5CCLA 4IQXA 1AROP 1HBOA 2ASJA 2YKNA 4YUDA 3GFZA 4JOUA 3TA1A 2YVSA 3D0HE 2V8HA 4DLEA 3C6TA 2MKCA 4QPXA 1RT5B 2MPUA 1HNVB 4ZP9A 3RW7A 3IBWA 4IDKA 5I3UA 1FVSA 2MZJA 4QJVA 5EWFA 4B3OA 3P49B 1Q82T 2HHUA 2XI2A 2V2KA 4FN5A 4G6VB 4KHRA 5E41A 2KT5A 5DLGA 3MM9B 4QU6A 2CQDA 3LOUA 4QIVA 1HQUB 4RX6A 4W90B 2RS8A 5GADI 1GNKA 2IRYA 3HMJG 4Q43A 1D8ZA 1JMTA 2RIJA 1C4AA 3P5TL 2Z8QA 2DNYA 3MDFA 2KZZA 2BV3A 7FDRA 4RW8A 5KFFA 3NAIA 4C0BA 1U1OA 1Z4UA 5B0GA 3IGVA 2K7KA 3LUYA 2ATLA 3FZ2A 1N4LA 3GZ7A 2MQLA 4I2QA 1LFPA 3CIMA 4LSLA 5GMKa 1U47A 1URNA 2DRBA 4QCLA 1HARA 5KFPA 4XK8C 1K8AT 1Q86T 1TQLA 5E33A 4O44B 3M2VB 4OQJA 2HPUA 4DV5F 1FDDA 2VFSA 3FEYB 2E1AA 2MYFA 1G6BA 4RKUC 1F5BA 2OKQA 1YJTA 3OUYB 2AYGA 2H9ZA 1K1QA 2G13A 2NZ4A 1FKPB 3BB5A 1MW7A 2FJVA 2F1FA 4DV0F 2GX8A 2IRUA 2LU1A 4BC7A 4CNYA 4F25A 1JJ4A 3DLEB 1U45A 2U2FA 5L9NA 1W2IA 1C1CB 4CO3A 2Z2LA 4NCAA 1L3SA 3OPKA 2J7KA 5EUHA 2FJBB 2GA7A 4Q2LA 3CPWR 1M5KC 2OAUA 4IR9A 3MUVP 3GFXA 2QO3A 2UZAA 4FS2A 3BN7A 4ZPDA 4U9RA 4N8NA 1DQ9A 1X5PA 3ICLA 3CJ2A 3TRGA 4CQ1A 1R8PA 1IKVB 2CVEA 3SXLA 1N33F 1T94A 1TKZA 2Q3PA 1LQ9A 2BE2B 5M2PA 2KFZA 1S0NA 3BGRA 3CDUA 3ITHA 1F2GA 1FRLA 1VBYA 4ZP6A 3T5LA 5KFAA 2OIHA 2HHWA 1WHVA 4JI5F 1SKWA 1RT4B 2EW9A 2KVIA 1JKHA 3MUTP 2QV6A 3I96A 5CYJA 2IC3B 2LXUA 5MAOA 1ULRA 3KJVB 1ZTWA 4DFJA 4B3TF 1KLNA 2XBPA 1UAWA 3MFHA 2EBGA 1SKSA 2PIIA 2QYCA 2D1CA 3MD3A 2OMOA 3OTEA 1S9EB 4H4OB 5KG0A 3KLFA 2RF2B 1NKBA 2MQQA 1SV5B 4NLPA 1X4HA 2D3OR 1NKCA 2W4PA 2DITA 2R8JA 1AXQA 2IAJA 4F8RA 4Q44A 5ITHA 4IFYB 3CE8A 3G71S 5I3PA 4ZCMA 1HWIA 4KV8B 1OQ6A 4J37A 1TKTB 3KFWX 5A8WB 4RUAA 4EYHB 1JLGB 4I7FB 3KHRA 3OHBA 3BN4A 1ZAVA 2W9AA 2Q43A 3JSYA 3OXLA 1VQLS 2HGNA 2UVWA 4XO0A 2J0XA 4OFZA 2W9CB 2B5JA 2DIVA 4Z2XA 2FC8A 3VF0B 1BQMA 1JLGA 4IKAA 2VL1A 3LGMA 2C3YA 2Y0SD 3FZBA 4X62F 1XMOF 3NLCA 3KMSA 1VC5A 4LIRA 4J9MA 1EP4B 2ZOGA 2ZH1A 1NAQA 2EI5A 4O3OA 5IFMA 4AL5A 4B3SF 2DGVA 4X4SA 2WHOA 1OSDA 5T7LB 1S1UA 1S49A 1BWEA 3F73A 3TVZA 4Y6IA 4I64A 3T6JA 5HROA 2PI4A 4IR1A 1ELOA 2ZHBA 1FD2A 1NH7A 3LWLA 1TL3B 1Y9OA 3VZIA 1VRUB 3HHLB 4K59A 4NLWA 2ILZA 4ZOSA 3BO2A 2HVHA 3LANA 1NK5A 1HD1A 3V4IA 4ED8A 1IKWA 1XMBA 2QA4S 1TL3A 2BW2A 4HTJA 5C42A 4N56A 2PO4A 5E3CA 3HHLA 4ES2A 3CDAA 2MJUA 4CZCA 3UFCX 5GAHI 2VKZG 2NQPA 1XERA 2CG4A 3I0RA 1NK6A 4ZHRB 3PNIA 5DDOC 1B7FA 4A8SA 2HHVA 2MXYA 3PW4A 4X4OA 3VAGA 5G0RA 4F2SA 3C3LA 5GADU 1NJZA 3JTNA 1VQ4S 2WRMA 1N0UA 4LT6A 3QJLA 4GC7A 4ED7A 3I5BA 2MSSA 5D4PA 4YDDB 2AF6A 2GHVC 4OJ3A 2EFPA 5E3AA 1JX4A 2HYIB 3BM7A 1U6FA 2AJ1A 1OO0B 3FRZA 4TLRA 3K8VA 1O5JA 3I32A 1RDRA 2LLZA 2ALZA 2IFXA 5IS2A 4DPOA 4WFAQ 3W2WB 1N5TA 3MM9A 1DTTB 3M1VB 2DD8S 3LH2S 3MEDB 2R7RA 2BQRA 4WZMA 5DO2A 4D3GA 2OSQA 1DARA 5B0DA 3OSPA 2K1RB 2V8GA 4OLPA 4IO9Q 1X9MA 2E9RX 4JV2A 5DETA 4IOCQ 1S77D 1GAOA 3IAS9 4KAIA 5DM6Q 4JBCA 3H4DA 1XWLA 4GO5X 1IKXA 1JKHB 4XPEA 2B6AA 1UVLA 2HAIA 1FK9A 4X2BA 1KHVA 3M8PA 4O3PA 3DFEA 1X0PA 2BRKA 2HNDB 1VK8A 1XR5A 3R3TA 2QMWA 3THPA 2ASYA 2GV1A 3MURP 2JWNA 1HQEB 1L3VA 1GTEA 1N88A 2BJDA 2RT3A 3PW7A 4Y2AA 2V4JA 5FJ4A 4NMLA 2XC9A 2AX1A 4Q8FA 2AQ4A 1IKVA 1H2TZ 3UNGC 3VR1A 1NNDA 4A47A 1OSCA 4E98A 4DV4F 1S79A 3DLEA 2DNHA 3QIDA 4IRCA 2UUTA 3L7PA 3NKYA 1W2BR 3DHXA 3JAMY 2OO4A 4O0IA 4KTQA 1I6JA 1U2FA 4X4NA 3HVTA 1RGVA 2PI5A 2Y1RI 5AE3A 1D9AA 1ZM3A 4LQ9A 3DRYA 4F50A 1VOMA 1KRPA 2C3OA 3VAIA 2RQCA 4IG0B 1SH2A 2ACYA 3FCHA 1RKJA 4LF6F 5HLFB 4PUOA 1L3UA 4FF1A 3HHDA 5A6PA 2XNQA 2EG1A 2DJWA 2MJNA 3PIOQ 3J80Y 2LDYA 4LIWA 3BZQA 3M9OB 1FKOB 5LSOA 4DG1A 4TU8A 2FTRA 1ZTTA 2FVQA 2JLFA 2WONA 1FA0A 1QSYA 5AXLA 3PO5A 5LSLA 1UW4A 4ZPCA 4WK3A 1MMNA 4C8KA 3LF0A 1D0EA 2VG6A 2XLJA 2NREA 2YNGB 3L7OA 4KQZA 1RTDA 1EETA 2FHJD 3PR4A 3MEEB 1WACA 4DJBA 4HI2A 5J2MA 2B7CB 4PQUB 4Q5VA 2F8MA 5DDRC 3H25A 2B5JB 4MYTA 4N5SA 4WFZA 1S7HA 2VH7A 1YVFA 3DXBA 4NA2A 3PFEA 2UVVA 2KXNB 1KTQA 3JSMB 2RDJA 4ED1A 3UR3C 4DL7A 4PQUA 2MZSA 2JDJA 1FDNA 5CYQA 4ZMMA 4USIA 5D8HB 1FHTA 5J2NB 3CVKA 1UWBA 2DR7A 3LP0A 3D5MA 4KRWA 3FEZA 4EO6A 2F8HA 5IQ6A 1AFIA 2HNYA 3IS9B 4TY9A 3OTBA 2M7SA 1YRXA 3CCTA 3E51A 3L09A 2O1PA 1HI8A 2UV8G 1HBNA 1VLYA 1GTHA 1YGYA 1YWXA 3CGIA 3EUNA 3HX9A 4MJKA 1UJ4A 3VQTA 2HW3A 2K1RA 4ICLA 4IUFA 2FY1A 4RW6B 4AXIA 2CRLA 1IKYA 1N8RT 3U1NA 3JTPA 1HI0P 3DMJA 4I68A 2B51A 1N54B 2QMXA 3FQLA 1VIOA 2E1RA 1Z2LA 4LUBA 5LL6d 3ZZOA 4URGA 4RNNA 5D3GB 2KTQA 2BJEA 2PFFB 1P1LA 3IGNA 5DLFA 1LWEA 2E5GA 3LP2A 2VA2A 3CJKB 1X4CA 1JLBA 1TVRB 2QLXA 3MTKA 3UDCA 1MU2A 3RB6A 2IM1A 4WXWA 3T1AA 1QE1B 2PA8D 2XMKA 3K2YA 2N82B 3OFFA 1VRTA 3CWJA 2HS3A 1VHFA 3ZZUA 2YKPA 2OFHX 3SV4A 1N0VC 1Q78A 3ZZTA 3MGJA 4LVOP 3SV3A 3OXFA 2FLNA 1N5QA 3FQKA 3S7RA 2DR9A 1RT7B 1E6VB 1QAJA 4RBUA 1KQGB 3U1LA 2KT3A 3K59A 2UP1A 2WK4A 4MIWA 5HMZA 4K50A 1NJWA 4KJIA 1JNRB 4B08A 1MMDA 3AJ2A 2HQIA 1YJ9S 1I1GA 4DFPA 2XY7A 4MIAA 3NCQA 2ZH9A 2XG8A 3CDWA 2BA9A 3NNAA 4DR6F 3POTA 1SXLA 3P3DA 1VQ8S 5KFWA 4ED3A 3TAPA 4A46A 1JLEB 4B9LA 4Y00A 1U1NA 4WTYA 4ALZA 1YBAA 2LQ5A 5KFUA 5KAKA 1S6PB 3FDSA 3LP1A 1U1KA 2HHXA 2KH9A 1JLEA 1VQ6S 4M63A 1A7GE 4DFKA 1NO8A 2W4CA 3TX8A 2ZZNA 1N34F 1ZAXA 2MKIA 4N47A 2V5HG 1HNIA 2CPFA 4DEZA 2F9DA 2JLEA 2MMYA 2KN4A 4MTPA 2V8DA 4ILMA 1R89A 5T14A 3L3CA 2V4QA 4XAKA 3C8YA 1KQKA 2ASLA 3MOZA 1WG1A 2RU9A 4K0KF 2LQBA 3QIPB 4FNIA 4B3MF 3QMQA 3R5AA 2NPIA 2J0WA 4R25A 3ZZRA 3T5JA 5DM7Q 2GHWA 2ZOFA 4F4YA 3GIKA 4FXDA 2DRAA 3SCKE 5HO4A 1FO1A 3MI7X 3CO9A 2ZNZA 2KHCA 4XIUA 1RTHA 3GYXB 4YR2A 2DT9A 2LYVA 2QFJA 3R5DA 4X4RA 4UQGA 1S48A 5LMNF 2X51A 1WF1A 4U6PA 4U7CA 3MMAA 3G8QA 3T5KA 3K5LA 4RW7B 3DM2A 4EGLA 2HRUA 1WF0A 3EXCX 3OTDA 3UD3P 3RAQA 5A8KB 3MM6A 3T5HA 3PEJA 3CD0A 3TAMB 4OZ0A 3IO1A 2A2CA 2VG5B 2KKHA 1SH0A 5KFSA 4DV6F 2OTLS 3E01A 4K4XA 3IRXA 2ZHOA 1SKRA 5A8KA 1MWZA 3NRBA 4B17A 4DL0C 5J2MB 1FXDA 1W25A 1YSJA 3RRHA 4FF4A 3AA9A 3LWMA 1IKWB 2IYGA 1YJUA 2MGZA 4K4TA 5KFJA 3E01B 1X4BA</