4OZLA

Glnk2 from haloferax mediterranei complexed with amp
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
119
structure length
104
Chain Sequence
DLPNDGGIKLVMAIIRPDKLADVKTALAEVGAPSLTVTNVSGRGSDLHQKVKVECVVADTPAEDVADAIADAAHTGEKGDGKIFILPVENAIQVRTGKTGRDAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of a PII signaling protein from a halophilic archaeon reveals novel traits and high-salt adaptations.
pubmed doi rcsb
source organism Haloferax mediterranei
molecule tags Signaling protein
molecule keywords Nitrogen regulatory protein P-II
total genus 22
structure length 104
sequence length 119
ec nomenclature
pdb deposition date 2014-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00543 P-II Nitrogen regulatory protein P-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ozlA00
2V5HG 1V3RA 4YB6A 3AH6A 2NS1B 1O5JA 2NUHA 3LF0A 2EG1A 3CE8A 2ZOMA 2XBPA 1UFLA 1V6HA 4C3LA 3X3UA 3NCQA 4RX6A 3MHYA 1UMJA 5L9NA 5D4NA 2O66A 1Q1KA 4YB5A 2ZFHA 4CNZA 3N5BA 2J9DE 1UL3A 2GNKA 4USIA 3TA2A 1V9OA 4CO4A 4WK3A 3TA1A 2GX8A 1NZAA 2JJ4D 4D3HA 4NYPA 2NUUG 3AA8A 2CZ4A 4RLEA 3L7PA 1NAQA 3BZQA 3O5TB 4OZJA 4CO3A 3AHPA 4RWWA 1XK8A 2J9EA 1J2VA 1P1LA 1NH7A 1H3DA 2EG2A 1HWUA 4OZNA 3HLUA 1VHFA 1QY7A 2XG8A 5D4PA 4OZLA 4CO0A 2RD5C 4Y65A 1UKUA 4RWXA 4C3MA 3M05A 1OSCA 4NYOA 1VFJA 3O8WA 4CO5A 1GNKA 4IYQA 4AFFA 3TA0A 4YB7A 5D4OA 5DS7A 2Z0GA 2J9CA 4E98A 2J9DA 4C3KA 5D4LA 3T9ZA 2E66A 4CNYA 1NH8A 3GSDA 2VD3A 4ZK7M 3OPKA 4Y6IA 4WK1A 1PILA 4CO1A 3NCPA 2DCLA 2XULA 1KR4A 2O67A 4USJC 4R25A 4USHA 5DRKA 4D3GA 3DFEA 1V3SA 4CO2A 2XZWA 1O51A 2PIIA 3AA9A 3NCRA 2GW8A
chains in the Genus database with same CATH superfamily
3EVMA 4MFBB 3AQOA 5AT1B 1JXVA 1GMWD 2BKPA 4TYAA 5J1PA 1W26A 2K7JA 3E01A 3CT9A 3KLIB 5HI7A 2IYIA 2KH9A 1IM6A 4YB6A 2VG7A 2F7VA 3PYFA 1TL3A 2PN6A 1DAXA 3U02A 4ECYA 2HMIB 4KO0A 4USTA 1SH2A 2NUHA 4PWWA 1YIJS 2DNOA 5CD4A 3J81j 2XLJA 3R5DA 2B6AA 2BABA 2HPUA 2E44A 1Q8IA 3GSIA 2H5IB 1WEXA 3TW0A 3RRGA 4OHZA 4J37A 2IM1A 3VHQA 3DOLB 3V6DA 4OI6A 4JV2A 2POKA 4KB7A 3CDEA 4LSLB 5E33A 4QWBA 2UUBF 4TLRA 1S6QA 2GQCA 4ZHRA 2E1RA 3J81Y 5CYQB 2GQ2A 4O4RA 4CM2A 4ED2A 3W65A 2GNKA 1JLQA 1T3OA 2IM0A 2Z2LA 3QFHA 2R9LA 1CJUA 4O0IA 4AT1B 2AJ1A 2DHAA 3UW1A 4DR7F 4ZVUB 3D4JA 5H9EJ 4EK2A 1NZAA 3ZZOA 1SKSA 3N28A 3VQTA 4A8WA 1RBOB 1UVLA 1L3TA 4EBDA 2WW4A 1K47A 2R7UA 2ZH3A 2DD8S 2FHKA 4PG6A 3DLEB 5ETRA 2JVRA 4RLEA 4E8UA 5IM0A 4RZRA 4DV7F 1KDNA 3WIVA 3KYLA 4DR4J 2IY5B 2Z57B 4K7QA 5K9FA 2YKNB 1AYEA 2LA4A 1CBKA 3QZ7A 1X4DA 3HJFA 1OYDA 2RKIA 4X66F 1VQLS 1LOUA 1HMVA 2QYCA 2QEXS 3LWMA 4LF6F 2ZITA 2H65B 4K5RA 3IBCB 3S1TA 4Q45A 2MZTA 3MR3A 1QUPA 2VOPA 1BWEA 3M2RB 3FRYA 1VHFA 2XYPB 3R1LA 2RD5C 2YXLA 3IS9A 4YHHF 2OD6A 4DEZA 3R2DJ 3MPDA 4RWXA 1ZA2B 4B3SF 1KD1T 3M32A 1KQSR 2HHVA 4UOCA 1DTQA 1JLAA 4LREA 5IC6B 4YR0A 1VFJA 3MM9A 3OUYB 4EYHB 5HAOA 4C11A 2OLWA 4RUBA 1WG4A 3UVJA 1FD8A 2VPYB 2I1RA 2XC9A 1X9WA 4IR9A 1LW0A 1YJVA 1BE4A 2MQPA 4LRAA 3CCVS 1P1TA 4RW6A 1VJQA 1K73T 5DS7A 4E98A 5KG3A 5IT4A 5DDRC 1UZDA 3OW2R 2HZVA 4ILLA 3R6GB 4DI6A 1CQNA 1JKHA 2JEGA 2UVWA 3D9BA 3OR2B 1IVZA 1RJJA 3ITHA 3TUZC 1NH8A 3PW2A 2O1PA 2B9WA 3RB6A 2X1GA 3IR7B 4FXDA 4IOAQ 1XNQF 1Z4UA 2VV5A 1E6VB 1FF2A 2CWXA 4K4TA 1QVGR 4UUXA 1RLDA 1TL7A 1SKRA 1VIOA 4CO1A 4RU2A 2DCLA 2Y8YA 4C0HA 1TKZA 2DCUB 1RWOB 2E5IA 2DXEA 3DFEA 3NGRA 3QAUA 5BYSA 3J80U 2RUSA 3B82A 3D6HB 4ZVFA 4YDDB 4DV3F 5DLGA 4NA3A 4RW4B 5FLXY 3UDCA 4C4WA 1T8EA 2C2KB 4TU7A 4QWEA 2VQEJ 3F73A 3DXSX 5KFCA 1DHMA 3SCIE 2H4WB 2Y3YA 1U1OA 6AT1B 2GMHA 2LXUA 4I56A 2NLWA 4IH7A 1SJFA 2LEAA 2JX2A 3HVTA 4IH6A 4R0JA 2L48A 3KLFB 4ZVGA 2PT0A 3C8YA 2ZH9A 3PFOA 2RJZA 4OYAA 3MEEB 1U47A 2KZMA 4NLUA 1T95A 3L9ZA 2OTJS 1O5JA 2EFOA 5CYJA 2XGQA 4C8YA 4P10A 4X4TA 1NXIA 3OTDA 3LANA 3UFCX 3DDKA 5HN0A 5KFHA 4DG1A 2VDHA 2HS3A 1SB6A 4L6V3 2ZOMA 2XBPA 1NK5A 1M5OC 4JI4J 5HATA 3KJFB 2ILYA 1WC4A 5JMNA 1SL2A 4B3SJ 3BN4A 1Y9OA 2BJ8A 3C6UA 3FSXA 3LGNA 5G4DA 4ZVTB 4QQBA 4ZPVR 1YRTA 4CWBA 1N88A 3MPUB 2VOOA 3RAXA 3NG8A 4CLUA 3LALA 2CRLA 3MMCB 3M9NB 3G9CA 3I9ZA 3R5GA 1L5UA 3CD0A 1UVKA 3OV7A 1F3VA 2W7AA 1T05A 2BXJA 2GGPB 4YY3J 2IVMA 4KRWA 3TA1A 3UCUP 3PKYA 2DISA 2LKZA 3OFGA 4OX6A 4HEA9 4N47A 4JV1A 1SJRA 1TK8A 2CDQA 5IWAF 5J1EB 1FKOA 3R5AA 2BJ9A 2GV1A 1RB0A 4GMKA 5GAGU 3UDVA 3SDEA 3AA8A 1G4CA 3MPYA 2JNJA 1UTAA 2IHR1 1VLOA 4Z37A 4EO8A 4YEAA 3TOQA 3WX4A 2PDAA 5HO4A 2SXLA 2G0CA 4PXBA 4CO3A 3C16A 5FDLB 4OX7A 2HGMA 4ANDA 1F9EB 1WOOA 4MKAA 2X1AA 2AX0A 4NZ6A 2W8KA 2B8QA 2FVCA 4MK9A 3NMRA 2XO6A 2NREA 2APOA 3BSNA 1RHUB 1RSCA 2ROGA 4EU0A 5BJRA 1VI7A 2A18A 3QGGA 4MKBA 3MURP 3UNGC 1MSWD 2QSFA 3CDWA 4UQTA 1BQMB 1FDDA 3EDQB 3MECA 1GMVA 4ZS6A 2AZ1A 5F8LA 1VQ7S 3QFWA 1B0TA 3F41A 4ECZA 4DFPA 1OSCA 2HNYA 3MEDA 1HQEB 1R6VA 1XTZA 3EICA 1HHSA 2LEPA 3D68A 2R8HA 1N34J 3MEKA 2NXCA 1TL4A 3Q2SC 2CPJA 1U2CA 4NEYA 3GCXP 1N0VC 2KJVA 4WKRA 3H20A 1FRXA 3L09A 2ALZA 3N0VA 1FDNA 2BANB 3IMQJ 3MAAB 3M8YA 4IG0A 3S6EA 1TAUA 2RF2A 4NLQA 5HQMA 1WORA 2LVWA 3I82A 3TEHB 3G8QA 3ZFVA 3HT3A 2YWFA 4NYZA 2ADCA 3T9ZA 3VAJA 4WP9A 3PVXA 2V4JA 3BR9A 1TKTB 4BHQA 1KLNA 1RWVB 1FE0A 3ENWA 2F9DA 1NKBA 2VD3A 3AB4B 2UZAA 2WOMA 1S9EA 4MT1A 8AT1B 3SYZA 1FRIA 1AZSA 1FEEA 1RHJB 3IA0A 4WK1A 2KI2A 4CQ1A 5AXMA 1SI9A 2BJDA 5A8RA 1HPZB 4DV4J 2FVSA 4ZP6A 3DMJA 2WTFA 1OY9A 2JFKA 2J0WA 3U1LA 5HK4A 2MXYA 4R5PA 3QPIA 5HVFA 5SZTA 1MN9A 4A48A 7AT1B 2J0XA 1S7HA 3LP2B 4FNHA 1VQ8S 5DJBA 4RPFA 5M2UA 2E7XA 3R27A 3PKMA 2DIVA 4RKUC 4A8FA 2G0JA 3R5JB 4KE5A 2HHQA 3RR8A 1RHRB 2DR8A 1N48A 2MQ8A 3EVWA 2JSXA 1GH8A 3HT0A 2VA3A 2GAHC 2OHDA 2HFNA 2J7KA 2M8DB 3W62A 3P96A 6FDRA 5CZXA 3D0GE 4OYIA 4TVAB 4ZP8A 4DF4A 1R0AA 2XS7A 3N5FA 1K0VA 3DU5A 2X3GA 2AX1A 1H7WA 2M2BA 4NLYA 3VAFA 2XI3A 1F2GA 1S9GB 2HHXA 4N56A 4XK8C 4ZCKA 1RE1B 3HZGA 2LFVA 2DNNA 1J5EF 1IWAA 4CI0B 9RUBA 4AL6A 2AGOA 1KHVA 2GVDA 4USMA 4OI3A 1UMJA 4KY3A 3RW6A 2D3UA 2YKMB 3M30B 3SXLA 4WTOB 1WG5A 5DO2A 3PYGA 1S1VA 3C14B 1WOSA 1UL3A 4DLEA 3JAMY 5KFZA 4RNMA 1RTDB 2HYIB 3W60A 4GC6A 4USVA 2EVZA 1I1GA 4LF8J 2UUWA 4O44B 2ASJA 2VIHA 2OFHX 3I6PA 1R27B 2OEMA 3LTOA 1QE1B 2FPHX 3OR1B 1YJWS 2ZH8A 4J9OA 4NYPA 1FFWB 2DH9A 5D0HA 3EJMA 3RU0A 5I4MA 2CDRB 1GXLA 3BB5A 1S6UA 3K2YA 3HD2A 4KQZA 3VVTA 2D69A 3FCWA 4JI1F 4PYAA 3GJQB 3MM8A 4UT4A 1D9AA 2GJ2A 2ZM6F 1TELA 4ED0A 2R8JA 1G7CB 4JI1J 4C9DA 4NLRA 2N7CA 1NNDA 2VONA 1RWPB 4P7VA 1NPPA 1Y00A 3PR4A 2HFZA 3PRDA 4P6QA 1TR0A 4WTYA 3A3OB 3W9IA 5LM7E 4KC5A 2HRUA 1FVQA 3FBFA 3IWXA 2VKZG 1MW7A 1TV6A 4X65F 3Q23A 4K8RA 4YFUA 2F8MA 1R43A 1DBDA 1BHNA 4OI1A 1C0TA 5LMNF 1HYSA 1UVIA 4I2QA 3CCUS 1KVIA 2YNFB 4DSKA 4GKJF 3M2VB 4AQYJ 2UUTA 1S77D 2FDNA 3DLKB 4HDHA 4MIBA 3V6KA 2E5LJ 1KOHA 3KWMA 4MK7A 3RBDA 3KNAA 2BA9A 1CPZA 2AGQA 1TL1B 3UNYA 1PYOB 1AW0A 3J7YU 2VODA 4PWDA 3T5KA 2B4PA 2K8GA 4HT5A 1BGXT 1T02A 2L9DA 3OTEA 5CQGA 2HHPA 2QLXA 3ZXWA 4XPCA 2XY6A 2C2DA 2QC3A 3G86A 1K1QA 4X4VA 4EO6A 5HLFB 5I3UA 1X5TA 1T03B 2H3EB 5A76A 4RW7A 1CJVA 3PW5A 5A0YA 4F67A 2X51A 3W2WA 3I96A 3M9OB 4WFNQ 3GIIA 2R8IA 2DNZA 2FC8A 2G9OA 1ZM9A 3Q8UA 2QN6B 4GO7X 1C0UB 5HROA 2PMZD 2B3TB 2OIHA 3HO1A 3VCDA 1RWNB 4KV8B 3HFZB 3Q8SB 1YI2S 1FJGF 3ETOA 4LRCA 2W9CA 1RTJA 1KC8T 4FYXB 2CQPA 3DRSB 4ETZA 5A0YB 3CCJS 1XNRJ 2OELA 3QT6A 3SQGA 2UXCF 5I3UB 2B8PA 1H7XA 4Q2MA 4NLXA 1ZTWA 3EGZA 1PAEX 2UP1A 2X1FA 2J0QD 1TAQA 1S12A 3PO5A 4NXNJ 4PWDB 4YUDA 4R8UA 3TANA 1VQ4S 3HK2A 3MFHA 3CJRA 3FNNA 3I4PA 1TQLA 1UA1A 2ZOGA 4U9RA 5AXLA 4TQRA 2HAIA 2YNGA 1O51A 3CVKA 1JJHA 4XAKA 4WZQA 1D1UA 3HSJA 3J7A1 1RAAB 2KZZA 5KT7A 5DZ7A 2YX4A 3A4TA 4LF5J 1HYSB 4PXDA 2FZCB 3LP0A 3KXDA 4YP3A 1S1XA 5KFDA 4M5KA 2CPEA 3S7RA 3CJ5A 2YKAA 1Y3KA 2YNIB 2W8LA 3PRBA 3LPYA 5C2CA 1V5IB 1RTZA 5T41A 1WF2A 1REVB 1R8AA 3D3CJ 1BQNA 2CPYA 2MHEA 2PMHA 3TAQA 2P9GA 2M3DA 3H90A 4V19X 3K59A 3QWUA 4N41A 4TXSA 3U1MA 2FJEB 2VG6A 2FJDB 3UE2A 4UOGA 4KHMA 5GAEU 3DI6B 3N6MA 2HWIA 2LQJA 3NOGA 2D74B 2KO1A 5L46A 1VC5A 5D4NA 5ETLA 1PC5A 4ANEA 5DGBA 3QRQA 4ED6A 1IKWB 3V81B 1GK8A 2V8HA 3G8TA 2AJ0A 3N6LA 3NWRA 1NSPA 3DOMB 1U6FA 2ZUAA 3SCJE 2QA4G 1RBAA 4PXCA 2UU9F 1V9OA 2V9KA 4CO4A 1FNXH 4G1QA 3GFZA 4WFXA 5KFTA 1HR0F 4LFCF 4DR4F 4E2FB 2VFSA 4GRSA 2DVIA 2YKMA 3EGVA 2KYXA 4E0DA 3FVYA 2C3OA 4G6VB 3B4MA 1DY3A 2G0IA 4DV4F 1KVJA 2NZ4A 2D7SA 2ZBQA 4M5DA 5DQIA 3KLEA 5F0UA 2QRRA 4NL5A 2MKIA 2QZ8A 5HMWA 5D8HB 1S4EA 4FPIA 4M5GA 2F4FA 2WONB 4K2JA 3LH2S 3T41A 1RBLA 2CXEA 1NHUA 3CMAS 3VAMA 4HTJA 1HL6A 1T3NA 3BF4A 4QYZK 2E29A 3CCMS 5HL7Q 1S5ZA 1WKJA 1RT6A 3GTYX 4URGA 2EFGA 4DFKA 3T1YF 1SL1A 4CLZA 1VQKS 4HTIA 4NXMF 3P5BP 5DG8A 3MD3A 2Q6CA 2AEMA 5EUHA 5IV4A 4DL5A 1EKRA 2MHNA 1VRTB 2RQKA 2RRBA 3ISNC 4OX8A 4C8ZA 1XN9A 5IT9Y 2H9ZA 1YZ6A 3K5PA 2MZJA 1U8SA 2B4VA 4IDKB 2UUCF 5KG1A 3N4WA 1X8DA 4JI4F 3OJSA 2V2KA 5F9LA 5K20B 2BJEA 3BBBA 3MGJA 1UKUA 2HFVA 2W9AA 4OZ0A 4CLWA 4DQIA 1S1TB 4A4JA 4KHRA 3DRYA 1HD1A 2MSSA 3PEJA 3KUGA 3NMAA 3ZNUA 4DS5A 4GVBA 1HARA 1WDTA 5F8JA 4R5PB 1FCAA 4JV5F 1KHWA 4JI5F 1A9NB 2A3JA 1JLFB 2CQBA 2W4CA 3IM9A 3QYYA 4KT0C 3TWZA 2QA1A 1G6BA 2GMJA 4U95A 2F63A 2Z0GA 5DQGA 2N3OA 2X1BA 2C1EB 3I5AA 5C24A 2WOMB 5A8KA 1RAGB 4HYKA 4JI3F 4JI6J 1U6BA 2RILA 4L74A 1PJ5A 3KTQA 2PA3A 3UN3A 2WCXA 2G1HA 3JYTA 4DV2F 1UW4A 2JEJA 1AFIA 3KLGB 2HLTA 1TL5A 2MJUA 1Q95G 5LXYA 3EWGA 1JWWA 1Y0HA 4RJVA 2V9WA 2GIFA 1I3OB 2I5JA 1OQ3A 2FVPA 2R2SA 2VQEF 4IG0B 2RAQA 2OJ3A 2BANA 1RKJA 2CQDA 3D1QA 1HIYA 3HXMA 5K8PA 4DXLA 4XIUA 3JQMA 2AYMA 3N6NA 4UOFA 5D3GB 2XYGB 4XTTA 4ILRA 4UW2A 4ZLJA 2MGZB 4F2SA 2DHHA 5D77A 1S9FA 2FJAB 3I56S 3MXHP 3MEGB 3V2UC 3NY0A 4Y2KA 2KFZA 2V34A 3A8IA 2QG9B 2YWGA 2VC1A 1FFGB 1U26A 1NM2A 5LT5A 3MCMA 1LKZA 3GYNA 3SBMA 4Q43A 4DSLA 3OTCA 4OV1A 5B0BA 1C1CA 1S79A 2A2CA 2VBZA 3HM9A 1RZMA 5H9FK 4DQRA 1APSA 1BD6A 1WSRA 2Y1LB 3AOAA 4MYTA 4OYXA 5L39A 3RBEA 4TY8B 3E51A 3AH6A 4LSZB 3TJ9A 4JV5J 2I8EA 3J7AN 4EI2A 2UVVA 3BBFA 2IJFA 3HD1A 2KM8C 1VDHA 3Q24A 3MI7X 1URNA 1ZA1B 2B5JA 1EIYB 1Q4RA 4TU9A 2U2FA 3T1AA 2EXUA 4FVMA 4DQQA 1V6HA 5K8OA 1VRUB 3TVZA 5KG7A 4KHPF 3T19A 1FKOB 2XY7A 4CM0A 5HMZA 1W25A 3BEGB 3MMAA 4YN3B 5HSPA 1X9MA 1RTHA 3BH7B 3BPDA 3O6QA 1Q7YT 1QAJA 5A8WB 2YTCA 5LSLA 2Q66A 4Z7YA 1LEOA 5J2MA 3KMQA 3FEYB 2JLEA 3ZTPA 4DV0J 2AW0A 2P9EA 5KG4A 5KFBA 3NGUA 3F44A 4IG3B 5A8WA 2W2QP 2HAFA 4FDFA 4QWDA 2VFTA 2HNDB 1F3FA 2AHOB 1RT4B 2QX0A 3LWLA 4ED3A 2NPIA 3PR5B 3CJ0A 3CXCR 2NUUG 3CCRS 2KU7A 2IBKA 3OL9A 4P74A 4UZBA 2B5JB 1HI8A 2RDIA 1UA0A 2CADA 4X2BA 1R8PA 1YRUA 4PXEA 1SQFA 3DLLQ 1LW2B 4N8NA 1S0OA 4I2PA 2J7WA 4FVCA 3EZOA 2ZJRQ 1WC5A 4ZJOA 3K58A 2I38A 3Q83A 3QIDA 4LRBA 4NXNF 1XMOF 2W24A 4L3NA 5KG2A 2N82B 2FHOB 2XMUA 3IFEA 4WWSA 3DDNA 5KFUA 1IR0A 1LXJA 2FZGB 3MM6B 2ZH5A 2PA8D 4RW4A 5RUBA 5BR8J 4QBUA 5JVHQ 1SJ4P 3RZAA 1XBWA 5KTQA 1B99A 2M8HA 4OYOA 1TKZB 1T9XA 1WC3A 2CQ3A 2FY8A 2NXUA 3ILOA 4J5OA 4EFAC 5GAHU 3MMBB 1KN6A 4LF7J 1IBMF 3MCNA 2C42A 1RWKB 1MMDA 1HWJA 3LP1B 2ZHAA 1FRMA 3GB0A 3KK1A 1YJ9S 1TMJA 1VRQC 4LF7F 1E6VA 1NRKA 1K1SA 5D4OA 5BXIA 4HH1A 3TZWA 3VGVA 3PV8A 1NMEB 2KTQA 1KQFB 4DUYF 1EB0A 3KLGA 1HBUB 2UUAJ 1KWMA 3JYTB 3VV2B 4J9SA 2HFOA 3TUIC 3HI9A 2UV8G 2ZDOA 1IBCB 5A8KB 2IMOA 4UUWA 3AY0A 9ATCB 4RW6B 1QAXA 2IJRA 5DETA 1HNWF 1A0OB 1JLFA 2BKOA 2GAGC 3PACA 2FIUA 2IDEA 1UEVA 1LFWA 3HULA 2VFRA 3IM8A 3VZIA 4CYUA 1RT3A 1QVFR 3I55S 4P9SA 2JEFA 3UR0A 3EGWB 3LPEA 1VC6A 3IRXB 4CO2A 3TJ8A 4ED7A 3IS9B 4GKJJ 5D15A 4LFBF 3VTIA 4IKAA 4LSNB 3NLCA 4IDKA 2YPYA 2MKSA 2DGUA 2V5HG 1A6LA 3ZZUA 1M5HA 3I87A 5ETQA 1R6YA 3JAMU 4PZVA 1I51B 2MQNA 3ILJA 4M63A 4IFVA 4UZCA 5IV3A 1KS2A 4ID5B 3HPOA 1CVJA 4UF4A 1H38A 2BOPA 3SCLE 1VIXA 4FYWB 1QAYA 1EHWA 2OEKA 1IJEB 2YQ0A 1WEYA 1Y5NB 2QLBB 4H4MA 4X84A 1UFWA 2ZC3A 3V4MA 4X4RA 3GILA 2WONA 4B3MF 3OFEA 4F04B 1WF0A 4W98A 4YR3A 3J80Y 2BQRA 1NEEA 1UWBB 3DLEA 3H5YA 1SC4B 3GFXA 3HHNB 3HF5A 5KFXA 2CNKB 1DARA 4JI2F 1L3SA 5EGYA 5D6GA 4NLWA 2GJFA 3B8HA 4EWTA 1C4AA 3J81U 3NGDA 1YJNS 2YBVA 1Q8LA 1WHWA 3JSMB 2J9DE 2K3IA 4NMXA 4DF8A 5L1JA 3GIKA 2YX7A 4L3KA 2CKWA 3BYPA 3BSCA 1E6YA 1S57A 4P2SA 1JLQB 4NEZA 2H51B 5D0RA 1FK9A 4NCGB 2F5GA 5KFRA 4DPWA 4DU7A 3UQSA 5CYQA 1X5OA 3KMSA 1S6QB 4ZHRB 4ZKAA 5DLFA 4HKQA 4F4KA 2ALYB 4LJMA 3QIPA 4DR2F 2MQQA 1J5OA 4AXJA 1VBKA 4KPCA 4M94A 4CCHA 1ZM4A 1HBNB 2BBEA 2F8EX 2RS8A 2DNPA 4LBIA 4WFYA 1RWWB 5B08A 3Q0AA 2HS4A 2W1BA 3DLGA 3P45B 4ECTA 4C0OC 3T1YJ 2OPRA 3P4UB 3PX4A 4KGKA 1TL3B 2HVDA 4DV5J 2FHMA 1TKXA 5B0CA 3B54A 3TQ1A 1LK5A 2V8VA 2OPSA 3V6HA 3LP0B 4ZCIA 3TX8A 4ERDA 3DM2A 3U1NA 4EBEA 1M1GA 1T9VA 2V67A 2BQUA 2PO4A 5F8IA 1NBEB 5L8RC 2RNEA 4PPZA 4NASA 2HFSA 5B09A 1AA1B 1GX5A 2YWEA 3AB2B 3MTJA 1M0SA 4C2MA 4DQSA 1NHKL 1H2UX 3PRVA 2ACYA 4LUBA 3KK2B 4B3OB 2HHTA 2FUG9 1SPBP 4K5SA 5T14A 2OSQA 4G1IA 3UI3A 1KP6A 2RHSB 1J5EJ 4Q7AA 4CO5A 4IYQA 5J1NA 1KOOA 1R89A 1YRXA 3FEXB 3SQGB 2B0GA 2MQOA 2Y1IA 2QO3A 4FZVA 1WI6A 3UN2A 3PO4A 1N5TA 1NZ8A 4RBVA 2XEXA 3BS9A 5HP1A 5CYMA 4ZJQA 3DLBA 1LNQA 4I64A 4K4UA 1DFDA 3CSKA 3G82B 3P5TL 3RBXA 4CTAA 3SCKE 2DHSA 5BYRA 5HVHA 5DM6Q 4OLPA 1NCLA 1CJVB 2DO0A 2CJYB 2U1AA 3DRRB 3IGNA 2LA6A 3MM5A 1FERA 1XIQA 2XMMA 5T7LA 3RAMA 3VF0B 1S76D 3ZZZA 5LMUF 3V4IA 2YPZA 3OL8A 5C7PA 2AT1B 3NGKA 3KUHA 4F7VA 4W90B 2O67A 3C66A 4ENOA 2RSQA 4YS2A 4NLOA 3I0RB 2E9TA 3W66A 5DZ6A 1N5VA 3BN7A 3DOKA 1RT7B 3CO0P 3DLKA 3PG9A 4KH1B 5KFWA 1LV5A 1UW9A 3FCVA 3JTPA 1S99A 5LSRA 2RQ4A 3QGPA 3GJSB 2JL9A 3DN9A 2G2ZA 4USUA 2CQIA 2DNYA 1C0TB 2YWKA 2ZVIA 3SI8A 4LQ3A 2KXFA 3IG1A 5ETVA 5KFQA 1K9MT 1RWUA 1TV6B 2K1RB 2L3MA 3VQSA 1V3RA 2ZVSA 4J91A 4OJGA 2ZH1A 4W4MA 4OYMA 3C46A 2H4YB 1IQZA 2M7SA 3P3DA 4C8MA 3TVYA 2PI5A 4F25A 1SH3A 2CQ4A 5LXRA 4CP5A 3LF0A 1HQUB 5G0RA 4DR3J 4WF9Q 4DSEA 3H40A 3MM8B 4PQUA 5BR8F 4P73A 2VDIA 1TKDA 4Q0BA 3CEDA 1WTBA 4RNNA 2YKPA 2Y0BB 4X64J 3H4DA 2XWXA 4ED1A 4RX6A 1BY9A 1RK8A 3WQPA 1Q53A 1SVDA 2VF3A 3PJWA 4XDCA 5KOXA 1IBKJ 2E5LF 1HWKA 2HLUA 1MWQA 2MZRA 4KHPJ 1GQEA 1QE1A 5HJXA 1P9YA 2CPHA 1N52B 4B3RJ 3OFHA 1HI0P 4KTQA 4F3QA 1IKVA 3TA2A 5JVGQ 2AWZA 4Z7CA 3HX9A 1SIWB 2H48B 3D0IE 3ZZYA 3IO1A 5HMYA 5DQHA 4U6PA 1BMQB 2V8DA 2LCWA 3HCXA 4WYLA 3BQ1A 4BWMA 1S1VB 3C14A 4WZMA 4LRDA 1JK9B 3M30A 1U1NA 4M5HA 2IJNA 2DPIA 3G6YA 1FA0A 4B9TA 1XC9A 3POTA 4WP8A 2QA4S 1IKYB 1OPZA 2FYXA 3D66A 4X4PA 2R4FA 2FHJA 1T9UA 3NRBA 1NK7A 1S9GA 3J7YI 1Q5YA 1DTTA 2IYGA 3AOBA 1VLYA 2EW9A 2JWNA 3PFEA 3PCOB 5DDOC 2BW2A 4M5MA 1F5CA 3N9UC 3GQCA 2XS2A 1VQPS 5IWAJ 5HANA 2GS8A 1J2VA 2EKNA 1KQKA 3CW2C 2HHSA 4DHVA 3DYAB 3GJTB 5IQQA 1HW8A 2DNHA 1IKVB 1H3DA 2RE1A 4F4AA 5L1KA 2KB2A 4YQWA 3ENQA 3K0JA 3TQEA 2YVSA 1A7GE 4NE9C 4I1TA 2B4UA 4CH1A 2J5AA 1SXLA 1N36J 2QV6A 3NGSA 3PJ9A 4RO0A 2E7VA 2CYYA 3MZIA 2E1AA 4CLLA 5C42A 3CJ3A 1UJ5A 4NYOA 4K4XA 1LFPA 2A1BA 2G13A 4U8YA 3IGVA 1N56A 4PQUB 1AUSL 1L3KA 3AXMA 3L4BC 4KGXB 3VZHA 2XMKA 1YSJA 5AJ3F 4OHXA 5G0RB 1GNKA 3CCQS 1HPZA 3W63A 5A8RB 2NXJA 4FP9A 2CQGA 2VHGA 2CUYA 3TAMA 4JUZA 1FWKA 1F6TA 5D4LA 2K1RA 3KK3B 3SIPB 4MKVA 1DQ9A 3H5UA 4BC7A 2MB0B 4JI2J 2QE5A 1FKPB 3ZTOA 4M5NA 4OZ2A 4DPUA 2BEFA 2ZZTA 1N54B 3M6WA 2CNNB 3C6TB 1VQSA 2DGQA 2IBOA 4DV1J 4LF4J 2EC0A 1OWXA 4NLTA 3TAPA 3QWPA 2V94A 3FGVA 4TNOA 1IM4A 1RT7A 2ZBRA 4WFBQ 3CMQA 3HKWA 1Q78A 1VYAA 4P2MA 3I0RA 1I94F 2ZD1B 3PEHA 4DV7J 1S6OA 3R5CA 1QSLA 1KRPA 2OPPB 2IMWP 2IRUA 5DRKA 4D3GA 1HQEA 4NOHA 5GAEI 2BMBA 4LR7A 3WZ0A 4Y3CA 3Q8VA 2XZWA 3DRRA 3MM5B 3IC1A 2XWYA 4MH8A 5KG0A 4CTAB 2RU3A 4NXMJ 3ETMA 1CJKA 2H54B 2B7BB 3BBCA 4ES2A 1N34F 1RCXB 1FJCA 1YVFA 3VAHA 1SBRA 2M4MA 3TR5A 1U4BA 3JQJA 1FTCA 4B08A 4A8QA 1TP7A 1JXLA 4QR1A 2CNOB 4DR5F 4FPRA 1MMLA 3OSPA 3GV7B 3HDSA 2CPZA 2W2MP 2LU2A 4RL1A 1BWVA 3CIMA 3OXLA 4MYUA 2M70A 4FN5A 3QLHA 3OTOJ 2CNLB 1UFLA 2CAJA 2WZ1A 4ZVQB 1CS4A 1P9QC 4LF1A 2XMAA 2YX1A 3FQLA 4RBUA 1D8YA 2R3VA 4B3OA 5J1EA 3H8YA 4KH0B 5ETKA 4F4ZA 3DC2A 3ZTRA 1T7PA 3FFIA 4YB5A 3I4HX 2IDLA 3GMGA 1S10A 3BDPA 2ZKUA 3NNAA 2BZ2A 2OEJA 3OQ2A 1NDKA 1TZ0A 3DM2B 1U45A 2J0SD 2Q1LA 1TVRB 4DX7A 5DGAA 3PM9A 3HJVA 4PG8A 3T5LA 1RWXB 5B0FA 3H5SA 2HVHA 4URSA 2ZE2B 4HACB 3CWJA 3G87A 5AE3A 2R2TA 2FVQA 1VGYA 2LQ8A 3CJQA 4J9NA 3BQ2A 3C6UB 1QDUB 2OPRB 3T5HA 1FI4A 3VR1A 4OYWA 5LJ3Y 2O01C 3DLGB 4QCLA 2HGLA 2UXDJ 3BGUA 1VR6A 1T9WA 2CZ4A 4NLGA 2AJQA 1RKIA 2DO4A 4HI1A 2AF6A 4DOZA 4O4GA 4DG1B 3QJJA 4NI2B 3FSYA 3MCSA 2IAJA 3QIPB 4WU3A 3BJYA 3FDSA 3KUEA 3FBCA 5F8MA 1HHTP 2QMXA 2DBBA 4LFBJ 4DLGA 2Q43A 5E2QA 5HQ8A 1FEHA 1HWIA 3C2PA 5MAOA 3HVTB 3VAIA 4F0HA 1DRZA 3OLAA 1SCJB 1X4HA 3TYTA 2N3LA 2HQFA 1S1WA 2N7YA 2VB6A 2KJWA 3SQOP 1MROB 3HLUA 5HMXA 2V6AA 4GC7A 4DSFA 1QY7A 3QSIA 3CUNA 1SJ3P 3JSMA 4N76A 4ELVA 4CO0A 2PFFB 1JLGB 1RABB 3EXYA 3QSYB 2J8AA 3RB0A 2Y8WA 1ZETA 2CG4A 3WDOA 1U25A 1RACB 2G2OA 1UWBA 5C25A 1RUSA 1EAYC 1FJGJ 1W2IA 3TZYA 1BC6A 4A46A 3GIMA 5L9XA 4F4WA 4ECRA 2UU9J 4K0KJ 2HIYA 3THVA 4JV0A 3SFUA 3W2VB 4H4KA 5KFAA 1PYSB 2OAUA 3VGTA 3KJVA 4C8OA 4YHHJ 2WSEC 2AZ3A 4PQAA 2HSEB 3LGHA 4CH0S 1T0TV 4IOCQ 4J9KA 4ID5A 2VASA 3PTWA 2XGPA 4DV2J 3KDNA 4IQMA 2QA2A 4CNYA 3DXBA 3OD2A 2YKOA 3EPGA 1T11A 5EX3A 3OL7A 2GMLA 5KFVA 2RU9A 1JKHB 1RAHB 1I5OB 4LSNA 1RT5B 4HDGA 4DSIA 3SEOA 4H4OA 3MCOA 2P6SA 5L38A 1B70B 2MZQA 1CQMA 3FEZA 1KTQA 3H59A 4UQGA 4FYDA 3VAGA 2PFDA 4IQXA 4F3MA 1JJCB 3M8RA 1SQEA 3CB4A 3FBEA 4L72B 4CYUB 3QNWB 2MQMA 2V2VA 4R25A 1DTQB 4Y00A 2F40A 3FK4A 4DL7A 4OZ3A 3EZ5A 1VBZA 1O6XA 2VFUA 5IT0A 2HHUA 3CF5Q 2NYIA 3K5OA 3GU0A 5AXNA 4DWIA 3NOCA 1BQXA 3K5MA 1ZPWX 1WJ9A 3IWNC 1EJ7L 3DHWC 4NZ0A 4OMFG 5GADI 2MZSA 2EEYA 2MSTA 4LBHA 1HMVB 2IM3A 1AFJA 1WHYA 2RKIB 4DN0A 3TI0A 3J7Z5 3KJVB 3E8OA 2PEBA 3W2VA 3HHLD 3KK1B 1Z2ZA 2MQLA 4LRFA 2B9YA 3NKYA 2Q3PA 2I6WA 4X62F 3QZ8A 3MUTP 3P49B 5L1IA 3BGLA 3W8GA 3R97A 3M6XA 5JUMA 2GFFA 2JHEA 4RUCA 2IA6A 2XQCA 3GV8B 1M5KC 3EM1A 1FXDA 3CTRA 2L08A 1JLGA 3W5YA 4U96A 5U47A 2FGCA 4ZVHA 4DR2J 3MM6A 1Q16B 2ERRA 2BRLA 4U8VA 3D1OA 1MROA 1ZS6A 1S1WB 2C3YA 2Q79A 3NS7B 2P9CA 2V8PA 5KFMA 1S0NA 1XMQF 4QWAA 1T9TA 1U24A 3TEGA 1WEZA 3DHXA 4QYZJ 4NZ7A 1RAIB 3BYRA 1CJTA 4I2PB 4QPTA 2MGZA 2XLIA 2BUNA 2ZWPA 1S0VA 4MIAA 3IP0A 4LSLA 1BUXA 4NI2A 3DOLA 5KG6A 4ATNA 2MZ1A 2B9EA 4O4GB 1ZZFA 2VPWB 4H54A 1JLEA 2JC0A 2B6AB 1X5SA 2V2QA 1OO0B 5GAHI 1X4EA 2C2ZB 4IO1A 4USWA 4ZLNA 2FLPA 4I6AA 1RT4A 1U1LA 3SSQA 5J2PB 2DPJA 2HNDA 5GMKa 1XWLA 2DKOB 3EE3A 3TO8A 3UR3C 5IS2A 4B9LA 4U7CA 1BXNA 2WRMA 2HMIA 2VG7B 1VC0A 4ZN1A 4LF6J 1JNRB 2J9EA 2ZE2A 4HACA 4O23A 1NJXA 1EKSA 3KLIA 3NP5A 2FQQB 1ULRA 3JQKA 4QZVB 2F4VF 3HHLB 4LF5F 4PG4A 2W2OP 4ICLB 3QMQA 4BLGA 5J2MB 3F0NA 2MYFA 1IR2A 1HWUA 2OP5A 2KYZA 4OZNA 1YG0A 4HHHA 1RTHB 2OI2A 1HQ2A 2VZ9A 3MMAB 4ECWA 3GJRB 1OQ6A 2DYAA 4DDFA 3KHHA 4OIXA 2JZ5A 1WG1A 1TU0B 4IOBA 4JI6F 1N6QB 1VRUA 4ZIVA 1JLCA 4RU9A 3V6JA 4JI3J 1F9HA 4ELTA 4Q8FA 3W3SA 2PE8A 1MWYA 5E3RA 1HNZJ 3QLHB 1B7FA 3K8VA 3VAKA 3PXGa 5B0GA 1NK0A 2D9OA 3ET6A 1UZHA 1KSPA 1SKWA 1P6TA 3Q22A 5D78A 5E41A 4QW8A 3OT9A 1LXNA 2DH8A 2QMUB 3B4DA 2R8KA 2DRAA 1QD1A 2CQCA 4BC9A 1HHQA 2DNGA 2ACMA 2CJXB 2E7WA 3PIOQ 4DV0F 1XMQJ 1NJWA 1C1CB 3LUYA 3LO3A 2DGSA 1CJKB 1VQ5S 3M8PA 2ZH6A 2XSFA 1PYTA 1X31C 2A10A 3QO9A 2V68A 4P71A 3WIUA 4FF4A 3ZZRA 4K0KF 2VBWA 2GO9A 3C3LA 3AJ2A 4G65A 3UD4P 1YWXA 4WKYA 3MEGA 3W5XA 2GIRA 3R7NB 4F50A 1XR5A 2WSCC 5CCMA 3H2UB 3A12A 1B4SA 2KT5A 2WVEA 2OPPA 4FKXA 4KBIA 1RHKB 4O3PA 5D3GA 4DR6J 2Z4PA 2ZD1A 3FUYA 2ASYA 1WKKA 3F56A 3S01A 1ZAWA 2YNHA 3ADAC 5KFEA 1Y10A 4LR9A 2I5JB 4UOHA 1HBMB 4PYDA 3WC0A 3H7HB 4DPTA 4CZCA 4NLSA 3CD7A 1Q0NA 3TJAA 2N4DA 1QSSA 1XMBA 4C48A 1FDBA 3T3FA 1PIEA 1GAOA 1NK8A 3KK3A 2XCPA 2EBEA 1WC0A 4QIGA 3BKFA 3EDRB 1PAUB 1HNIA 2WB4A 5C24B 2LDYA 1PSDA 3UD5A 4WCEQ 4ZCLA 2R42A 2NYHA 3IBFB 1HNZF 1EETA 3PW0A 2DR9A 3M6VA 3M8ZA 3AQPA 2YWHA 2LLZA 1ZYQA 4Y2MA 4Q44A 1XEZA 3QRRA 1MN7A 3ZNJ1 1U1PA 1FRLA 2RDDA 1N5SA 2Z2MA 5BYQA 4F0MA 4X4QA 4GVBB 4GKKF 2Z30B 3T1HJ 3DNCA 4C3LA 2C2OB 2QLJB 4KPYA 1S1TA 2YQ3A 4UTGA 1X4CA 1WHXA 2AMCB 2DNMA 2OKQA 2O66A 4WXOA 1DLOA 5C42B 5HVGA 2VICA 3PX0A 4KAIA 3DLHA 1EQ0A 2V2ZA 4ZN3A 3M6UA 1YZ7A 4MKYA 3JXOA 3OJUA 2XSJB 2CFXA 1OPIA 2EK1A 3THPA 4FS2A 4MMOA 2YWWA 1FD2A 2GC8A 3R1HA 2X7IA 3D0HE 5GMEA 4LMZA 1M1HA 1CULB 2HRTA 2ZJQQ 1GMUA 1FNMA 3DGVA 2FC9A 3H4BA 1IBLJ 1RT6B 2FJWA 4K4WA 4I6YA 4OI0A 1EP4B 4J9MA 1I6JA 1KLMA 3ILLA 2ZWOA 1KTVA 3RB4A 3DU6A 3MM7B 2HHWA 4C6AA 2EK6A 4G1PA 4DZ6A 3POTB 4AQYF 3L7UA 2XMWA 2WSFC 4ZPWR 4NLPA 3NGTA 4LBPA 4R0EA 3KHGA 1NK6A 1PJ7A 1UAWA 2KHDA 3CCTA 2VPXB 4RW8A 1F1BB 3W61A 3I32A 3BQ0A 4FXVA 3RB3A 3VGUA 4Y2AA 2ZH2A 4KKOB 5ETOA 1N33J 2DJWA 1U1QA 2XLKA 4L75A 2I0XA 1HWLA 4P2XA 1QSYA 4I7FA 1SQGA 1RU2A 2CWKA 2DY9A 2C3UA 1IKXA 3L3CA 2GHWA 3MWBA 7FDRA 1F60B 5KT2A 4ELUA 1X4FA 5D4PA 4AL5A 2XMJA 2OSRA 4OZLA 3V81A 4K50A 3O2IA 3DGPA 4ID8A 4TN2A 4RW9A 2JLGA 1M5PC 3CULA 2DRBA 3UD3P 2HHHF 2FJVA 2KG0A 2V4RA 3BREA 2DR6A 4CH7A 3IXQA 1UFKA 3HFKA 4NA2A 5D0GA 1UVJA 4Q0BB 2RVJA 3TUPA 3WBZA 1S0MA 2DTJA 1BQNB 1TK5A 1WSVA 4J9LA 1D9FA 4M1KA 3M8QB 1ICEB 2YKQA 1JMTA 5ETTA 5ETPA 3WX8A 4CDIA 1DJ0A 4DPYA 3BO3A 2YNIA 2J9CA 2M5YA 3BSOA 1PGZA 4P2FA 2FJXA 4CLKA 2V4QA 4FBUA 4ZOSA 2W2NP 4CIOA 4HH0A 1CC8A 2E66A 4B9SA 3CJ4A 3IG1B 4DMZA 8ATCB 2C3PA 4Q8EA 5F0WA 3TNVA 1U49A 5ETMA 5K14A 2M88A 1RWMB 1V5VA 1VHIA 4ZCMA 3OVSA 4OQJA 5AJ3J 1VS3A 2YNGB 2HQIA 3DOKB 5FJ4A 1PBUA 1FDAA 4QWCA 1C2PA 2A0FB 2HBQB 2E9RX 4LVNP 2UUAF 4DS4A 2EC2A 1KR4A 3GIJA 2D3O1 4USHA 2XO7A 5DG7A 2FLNA 1HW9A 4DN9A 1S59A 1YBTA 3UN5A 2L41A 2HBYB 4ZVSB 1Q7LB 5F8GA 3DRSA 3OL6A 1FHTA 3FZBA 3EYZA 1RTJB 1X4GA 3ISND 3NCRA 2W9CB 1U1KA 4F02A 3GP9A 1VBYA 1F5BA 1OYEA 2CG8A 2IM2A 4K2XA 4X4OA 2XCAA 1SC1B 5CYMB 2HHHJ 1C0UA 1QLNA 5HROB 1SJQA 1N4LA 2JH3A 2LEBA 4FYVB 1L3UA 3W2WB 4JBCA 4OJ3A 1QAIA 2R7OA 1U0HA 4NMLA 1YTYA 2BDPA 1T03A 6FD1A 3L95X 1ZM2A 2EG1A 5HLFA 3DRPB 4QIVA 3CE8A 4Q5VA 3TARA 1OIAA 4K59A 4N5SA 3QBCA 1ZZNA 4C98A 1CG2A 3U7JA 5IZHA 2HGNA 1TL1A 4RNOA 2R8GA 5IT9U 4ILMA 5HQLA 3KK2A 2AYBA 2J76E 1UCNA 1N5YB 1OY8A 4OJ1A 4I67A 1YBUA 2LP4A 1ROFA 4FXWA 5IFMA 2BRKA 1RISA 1JNZB 2FZKB 1UEKA 2JDJA 3LW5C 3M2VA 4NRTA 3H0PA 5F3ZA 2KFYA 2R7RA 2DGXA 2QT7A 2OGUA 3CCWA 4PEOA 1UJ4A 2W25A 3CDUA 5KFOA 3K5NA 1TTHB 2LXIA 2PMWA 3RGIA 3B6BA 4DCJB 3CC4S 1C1BB 2AEJA 2ZZNA 2OPSB 3N01A 1KEKA 2PD1A 1TKXB 1F9FA 1RDRA 5KFSA 2VU5A 1GXTA 1RHMB 2G1DA 4MJKA 4DQPA 4QU7A 3SV3A 2ZKTA 2A2DA 4J90A 3NS5A 1T05B 3MOJB 3MUMP 3HMJG 1HBNA 3FMWA 3PYEA 1F0XA 1L3VA 2BE2B 4GVLA 1U48A 3CJ8A 2ZNZA 1J5OB 3PHEA 2VG5A 1MLAA 4IO9Q 2ZBPA 4Y34A 2LXFA 1NLKL 1RADB 1YJTA 3BGFA 4ER8A 3WC2A 2JRSA 2Z8QA 3AHPA 5LJ5Y 4RWWA 4PG7A 5I42B 1PO6A 3CCSS 1RXOB 4DUZF 3OR1A 5A2QU 1FK9B 3M2UB 1RA7A 3HHEA 4KR0B 4NCGA 1SH0A 2L9WA 1E6YB 4LVOP 4O44A 4C7QA 1HNXF 1PC4A 2DGOA 2MKYA 1RT1A 3K17A 4F8RA 2CQ1A 1H2VZ 1Q8BA 3HVAA 3M1VA 4HLBA 2CJBA 2D1CA 5E7OB 4P75A 4DL6A 2HWTA 1NSQA 1DQ8A 1UJ6A 3GR0A 1RU1A 4Y0FA 4Y65A 5HBMA 3BO2A 3WHIA 2XS5A 4I0WA 2V50A 2DIUA 3BGOP 4WIIA 2BQ3A 3GCWP 1C4CA 2LDIA 2OPQA 3GZ7A 1Y5LB 3PY8A 3MMJA 2MLZA 4DR5J 4ES1A 4ETXA 4JI0J 4YDXA 5CABA 1VQ6S 5JXSA 2HQDA 2AQ4A 4CRJA 4H4MB 2GIQA 4N8OA 3E3XA 1DZ5A 1FRJA 3OFFA 3SSSA 5KFNA 2BYCA 2G4BA 2RRAA 4QJVA 2DH7A 2Z2ZA 5IXUA 2W7OA 1U02A 4IFVB 4ZJLA 4BCAA 4QU6A 1D8ZA 4C97A 3K57A 2XNRA 3NBPA 3M7VA 3LQVA 3NBPB 5K5MA 4PR6A 2HK3A 2QIFA 3NS6A 1PJ6A 2BACA 3HZEA 4Y6IA 2WK4A 2QFJA 2ASLA 4KFBA 1RGVA 4LT6A 3IRXA 4KJIA 1X4AA 2ZEJA 3IR6B 4LIRA 1M5SA 3I5CA 2PSZA 2ZUGA 4V1Ak 2E5GA 2CJ9A 2HZCA 3LP2A 3NCPA 1HA1A 1RT3B 2RMLA 4QYRA 4WPAA 2IVFB 1OY6A 2QGFB 5K8MA 1AB8A 4IRDA 4PPDA 1Y3JA 4M5IA 3DMJB 4MK8A 4YB1P 2GVZA 2YH0A 4FF1A 2MLYA 2UXBF 1D09B 2O3DA 2KDOA 1EX8A 2MKHA 4DR3F 4NWBA 4ZA1A 3UWTA 4DR1F 2A6MA 3GV5B 5J2PA 2KT2A 1OSDA 1S9EB 3H5XA 5IOLA 4CLTA 2ZHBA 3SV4A 2G2YA 2YY3A 4JI5J 2IPOB 1HD0A 2ATLA 1TKTA 4YMEA 2B4OA 2AU0A 1HBUA 1NPRA 4WU2A 5CHCB 2XYHB 4A8SA 1S4FA 1FWLA 2B43A 2RF2B 2XHCA 1HNWJ 2C2RA 2HURA 4DX6A 4KGMA 2VG5B 3LP1A 1Q79A 1JXEA 3MAAA 1RAFB 3T1HF 4UY85 4ED8A 2BE2A 4ECQA 4O3RA 3MMBA 2I2YA 2M9KA 2CPFA 2E1MC 2QJ3A 1SC3B 2WVDA 5GAGI 4XPEA 4ECVA 2VKRA 2HK2A 3FRZA 1TFWA 5B0AA 2HNYB 3DCAA 4DL3A 1R7IA 1HNVA 2RHQB 4FS1A 1BQMA 3MECB 2H1YA 3FSIA 4ZPDA 2F8HA 2MTLA 1OMSA 1WC1A 4WXWA 4A47A 5J2QB 2FD2A 4J9UE 3PHTA 4USIA 4C8LA 3MAQA 1R8BA 4GO5X 1JX4A 3CC7S 1S7IA 2E9ZA 2COLA 3K5LA 1G2EA 2MPUA 2CZ9A 3D1HA 4J9QA 4BBYA 2LECA 2WW8A 2W01A 4F36A 1AT1B 2WVBA 2GX8A 4RR5A 3ZTQA 1B0PA 2AYEA 5KT3A 5EWGA 1LW2A 1N5YA 1R31A 2BOAA 4X4NA 2HBRB 2CVIA 2WAQD 2F9JA 1NJYA 2BE9B 3M9MB 3MUVP 1GEHA 3L7OA 4Y28C 4IRKA 1FT8A 1RP5A 4U67Q 1G1XA 1IQTA 3HFVA 2NPFA 1U1MA 2GHPA 1NAQA 5JJBA 1ITPA 2EFVA 2VQFF 5B0EA 4DFMA 1N32F 1AUDA 2PGCA 1WHVA 3U27A 3ULHA 1DQAA 4EEYA 1U0HB 3JS9A 2B7CB 2M0GB 2QL9B 4AL7A 1U2FA 2NXEA 2QMWA 4IG3A 4DCOB 2GGPA 4ZPAA 2XZTB 4JB8B 2RQMA 3LOUA 1FTRA 2VC0A 3A3NB 2RT3A 1JJ2R 2VPZB 2XG8A 5E3CA 5AE1A 4XO0A 1VK3A 3SSRA 2E5HA 2ZH4A 5J2NB 3NAIA 1TUWA 3M05A 1JB0C 4TKTA 5E0OA 4ZVRB 4F0KA 1X0PA 2ZH7A 4IFYA 5A6PA 2DRDA 4BDPA 1HI1A 1XMOJ 4MAKA 3ZC4A 3MPWA 5K8NA 3MR2A 1QJHA 5CAAA 2AYGA 4IUFA 1IWGA 1XR7A 2HBZB 4FBTA 4OFZA 3CPWR 3N79A 5EN1A 2F3JA 4WJBA 2HQ3A 2JC1A 5F3TA 5M2RA 3TA0A 5KFPA 4TY8A 4O3SA 3OHBA 2J9DA 4ZPBA 2OH2A 3TZZA 1Q8KA 1NO8A 3JSBA 4ZVPB 3MOZA 4K4YA 1NKCA 2UVRA 2B51A 1GTHA 2NZCA 5L9NA 2KVIA 1NDPA 1TUGB 5GADU 5L1LA 4HT7A 2BV3A 3CJKB 3M8QA 2MKKA 4DR1J 4B3RF 2HVEA 5E3AA 1UPMB 3G71S 2UXDF 2FHJD 3MR7A 1Z2LA 3Q89A 1NPKA 4O3OA 4DUYJ 1S72S 3JTOA 3MFIA 3LAMA 3CCES 4OI2A 1B7YB 4G3IA 2LQBA 2GCFA 2QL5B 1X9SA 2K7KA 4N7TA 1H72C 1LWCA 1TL7B 1YQHA 2GQQA 2HKEA 4KGZB 3DGPB 3CCLS 3QRPA 1H2TZ 1LWEA 2AIRB 2JVOA 2L9NA 2HEKA 5FLXU 2CZVC 4N77A 4ANCA 4K4VA 4ZITA 3PYDA 1IKXB 1WWHA 2AJFE 3LAKA 3OTOF 4DV6J 3GE9A 3JTNA 4I7FB 4X65J 5CZVA 1IUJA 3TVKA 2KL8A 4A8XA 4KKOA 2E1CA 2W7PA 3KG4A 4OHVA 1S49A 4ZPTR 4RW8B 3Q8PB 4DV3J 3UDEA 1LW0B 5EHHA 4RNFA 3UCZP 1VBXA 1XQIA 1U7LA 2K06A 2V63A 2WHOA 4AE5A 2R7QA 3UVJB 1NJIT 4LF4F 2C2EA 3GFYA 4C11B 3MM7A 1RYRA 3A8JA 3MM9B 3Q86A 3OHAA 4Q2LA 3OUYA 3MR5A 4U7UK 2RS2A 2EFQA 3M32B 1KLMB 3MF5A 1KNZA 1EP4A 3M8WA 1NDCA 2HS0A 1X4BA 3MHYA 2DNQA 2VL1A 3R2CJ 4LFAJ 4CT8A 4LF9F 4LF8F 1CULA 3M2RA 1G3OA 1VISA 1MU2B 2MY8A 1VRTA 2VBXA 1MU2A 4WK3A 2XSJA 3O3LA 3K89A 4CLSA 3RAQA 1OS5A 3PW7A 3AD7C 1LWXA 3RG6A 1Y11A 1DLOB 4ZMMA 5F8HA 2IVYA 2X3DA 3VVUA 2OMOA 3BR8A 4WP3A 5MLCV 1KBRA 3D2WA 5H1SV 4ZP7A 1I94J 4IRCA 3HKZD 2BM0A 3FKBA 1QUVA 5ETNA 4ED4A 4PRFA 4ZPCA 5IM0B 4I68A 1IBMJ 3KLEB 4M5DB 3GPAA 3KJNB 1NKEA 1UEUA 2OD4A 1OJ4A 1TK0A 1RAEB 3CMES 1H73A 1EETB 5EWEA 1WDDA 3FZ2A 4FNIA 3D7SB 1HNIB 1DURA 2J7UA 4A8MP 2DXFA 4G1QB 3G8SA 5E3QA 1WOPA 2PC6A 3EGNA 3ILIA 3ELHA 3DOMA 5KT6A 2R2RA 2XMTA 2F65A 3JSRA 4EMDA 3PDNA 2RRNA 1IKWA 2HWHA 1LWEB 5E3PA 2HQCA 3PNIA 3KJQB 4RBTA 3GYGA 3KNGA 4DV5F 3BKTA 3DI6A 1LWCB 2K2PA 1Q5VA 2VG6B 3S8SA 1RI7A 2ASDA 2NQPA 1U09A 4B3TF 2DNKA 4LF9J 3ZZ0A 4JI8J 4DL0C 2OFGX 2DXDA 4ZP9A 5KAKA 4EBCA 1U1RA 1REVA 1ZBTA 1FJ7A 3IWLA 1Y4ZB 4KO0B 2CQ2A 4JI8F 5C5JA 3CJKA 4ECUA 5DG9A 1M5VC 1ACMB 3EMTA 3T5JA 2XHWA 1BLUA 1S1XB 3E01B 1IJFB 2H5JB 1P8GA 2ZC4A 4FF3A 2E1PA 3DDIA 2F1FA 2ATCB 3KDOA 4KIAA 3AD9C 2YNHB 1SC6A 3OPKA 4DX8H 1YJRA 2QLWA 2QFIA 4HHJA 1QM9A 4EGLA 4Y2CA 2GO8A 4EZ6A 2DGTA 2CIMA 1YLXA 2KVQE 1YHQS 3QGHA 4R8UB 5A2QY 3RTVA 3PJXA 5KOWA 2DR5A 2E5JA 4USJC 4CLFA 2DY1A 3GR1A 3G4SS 4DUZJ 1JLCB 2EKYA 4IFYB 4PKDB 1NUEA 2NR0A 1IR1A 4I69A 3TZXA 5J2NA 2PIIA 2AJ2A 2EPIA 1M90T 2IC3B 1H6KX 2HNZA 4WFZA 2WBRA 3THTA 4LR8A 2EFPA 4A8OA 4X62J 4KV8A 1VQ9S 4UY8T 4ICLA 4B02A 3HHLA 2GJIA 1PKUA 3NL0A 1YJ7A 2ABYA 2MJNA 2PEHA 3O1LA 3R5BA 1K8AT 5I3QA 4PABA 5ADZA 1H0HB 1FJEB 1YITS 2R7SA 2ROPA 4RW7B 2JLFA 3CO9A 1FESA 3C15A 3CJSA 3B78A 3QQCD 1VK8A 1WUUA 3EVOA 4KGVB 2RIJA 4FKYA 1NSAA 3FCHA 1PCAA 1J27A 3H2LA 3UCGA 1RTIA 1JLEB 4DBQA 3AFGA 3D54A 3RW7A 4B9NA 2XMVA 2FGOA 3T9NA 1B64A 3H2VE 4B17A 4ZLPA 2CJQA 4BWJA 1U6ZA 4F4YA 1CJTB 5KFYA 2CPDA 3AD8C 4OL8A 1WKLA 4EUVA 4CNZA 3N5BA 2YNFA 3Q8RB 1XNQJ 1CLFA 4I2QB 2IIHA 2DNLA 1WACA 3HVWA 2VJUA 2OO4A 3HHLC 1QTMA 3JSYA 4C8KA 1WI8A 2JEIA 2LQ9A 3CD5A 3K7RA 3K8WA 7FD1A 2ZHOA 2FB0A 2MY7A 5J2QA 1IXKA 1X7VA 4RNHA 2J8SA 2UUBJ 2Y9HA 1HR0J 4LFCJ 1HNVB 2YH1A 3PZPA 4M95A 1FXRA 1GXUA 3KHRA 1IBLF 3E2EA 2ADBA 1Y7PA 4JP8A 1D3WA 2HZAA 1FO1A 3FC9A 3FQKA 3OTBA 2OUGA 3BGRB 1TMMA 3HSZA 3AOCA 2XY5A 2JFDA 1X0FA 3A8KA 4WFAQ 3VWSA 2AP6A 3SZ2A 3BZQA 3I9V9 3CIZA 1HFEL 4OZJA 1MMNA 3C19A 3OVAA 2Z58B 5AXKA 5B7WA 1NJZA 4LIWA 4TU8A 2UUCJ 1P1LA 1GT8A 4YOEA 1S48A 4DPXA 1LK7A 1NH7A 3BM7A 2EG2A 1RA6A 2WVFA 4ZLLA 2RDJA 1X5PA 2AD9A 3V5RA 2HRYA 1F2HA 3GYXB 3J7ZT 3I0SA 2R2UA 1XJWB 4H4KC 5A6WA 4C3MA 1GX6A 3EXCX 2GVZB 3QT7A 1VQYA 3W9HA 1S1UA 2GVDB 4CLYA 2WB1D 2N4CA 1RT2B 4OV6A 5E5NA 3LA0A 1SUQA 3O8WA 4J9VA 4LQ9A 5KT5A 4A8YA 2DR7A 4B9UA 2ZZMA 2Q6BA 2R7VA 2BJ7A 2KHCA 5IC4B 4AD6A 1NHVA 2RH3A 2ZDPA 2D3OR 2MKCA 1EZZB 1P27B 4KFBB 4H4OB 3QJPA 1AXQA 2AGPA 1R0AB 1K0TA 1H98A 3T6JA 1RT5A 1MG7A 4C3KA 2HVIA 2W2PP 2CJKA 4AXIA 3CC2S 4WE1B 4JI7J 2BKNA 2EI5A 4CLPA 3VALA 1B0VA 3US5A 1VOMA 4XDDA 1ZAXA 2C2MB 5KFGA 3H98A 3AJDA 4OZ1A 4TQSA 2Y1RI 3GLJA 2VJVA 2BJ1A 3W1YC 3ZO7A 2DHXA 2B56A 4OJHA 1RQ0A 1FVSA 1KONA 2QL7B 1SJ1A 3R7BB 5I3PA 1SL0A 1Q86T 4FF2A 3CDAA 4HHUA 1NSKL 3OLBA 4P7TA 3I31A 1EARA 1UPPA 4EYIB 4QPXA 2HG4A 2AEFA 4J7CA 5C25B 5CD4H 2DT9A 2GZOA 2OPQB 2ILZA 3BSAA 1NDLA 2BW7A 1N0UA 2KRBA 3DRXA 3AODA 1VQMS 2ROEA 3H25A 5HBMB 4J9RA 1FWPA 2WBMA 2VUGA 1LWFA 3HVRA 2YQ1A 1AZSB 4OX9J 2GW8A 2RQCA 3NWGA 4X4SA 3M1VB 2FLLA 4QIWD 4V19J 1KFSA 1RT1B 4WYWA 1ELOA 4URQU 1Z1ZA 2V4JB 4PAAA 1W2BR 1RTDA 4NA1A 1VJWA 3M2UA 4NLDA 1Q81T 5CCLA 1PBAA 2C3MA 5DDQC 4Z2XA 2XM3A 4DL4A 5I42A 1RCOB 2NS1B 3D6FB 2UV8A 2IAJB 5SUHA 2DGWA 3EPIA 2Z56B 3GG0A 1Q82T 4ITSA 1YBAA 2W9BA 3A13A 2XTJP 4J9PA 2HW3A 4HVZA 3W5ZA 1S6PA 1GMWA 5ETSA 1N36F 3BH6B 2P6TA 1JLBA 1SV5B 3ICLA 3MEDB 4U7UD 5DM7Q 1AROP 3CCZA 1D0EA 2ZFHA 3QAEA 3SFGA 1HBOB 3DLJA 1JIHA 3TP2A 4AYBD 3KHLA 4YR2A 2D41A 3OBIA 5CA5A 1WELA 2B9XA 1NB2A 2FLOA 4X4UA 4QOTA 1C1BA 2AJ4A 1KQGB 2KXHA 1XERA 1U8WA 5AE2A 1TVRA 2MMYA 5DDPC 3LGMA 5CXTA 4IR1A 4PUOA 2DEJA 2CA9A 1RLCL 1NK4A 3GONA 4DX5A 1F5AA 4I4BA 1NB7A 3C16B 3BV8A 3FFIB 5FDLA 4DCPB 1TFYA 3P6YC 4RUAA 3R8YA 2D9PA 1RAOA 3NAHA 3KOAA 4DR7J 3KLHA 3SMZA 1TUVA 1W7WA 1CS4B 2J6UA 3JB9k 1N33F 4DV1F 4ZIWA 1PG5B 2MEWA 3SDEB 1LQ9A 4B9VA 2LQ5A 3OSNA 3CDBA 2IFXA 3HSGA 3DRPA 3EZUA 5KFIA 1MWZA 2P8IA 1R8CA 3IAM9 4ZVOB 3KLHB 2VFVA 4AUKA 3ENAA 3O5TB 4MTPA 1HNXJ 4OX9F 3X1LB 3ZZTA 2HIQA 3AAWB 2BVZA 1VMBA 4QR0A 3TX0A 2XZDB 3MR6A 1ZTTA 1FRHA 3RR7A 1X60A 4PUOB 2EBGA 2P5VA 4NCAA 4X66J 4ZDNA 4ECXA 1N5QA 2BX6A 2DNRA 3CGIA 3IR5B 2GA7A 1WF1A 1XR6A 2IRYA 2VBYA 3MMCA 1HBOA 1S97A 4F2RA 1V3ZA 1VQNS 1SKUB 1N32J 4X64F 4OHWA 2FVRA 4DUTA 2BJ3A 1JLBB 1SV5A 3BDEA 3RRHA 3Q2TC 1IBKF 1S6PB 1YKWA 4HI2A 2BM1A 2KRRA 3I5BA 2LMIA 3OXGA 4C8NA 3UO0A 2J6TA 1UVNA 3R9LA 2W4DA 3O44A 2W9BB 3G6VA 4JOUA 2NXNA 5FD1A 4L76A 3PW4A 4NRUA 4EZ9A 3QGIA 2XNQA 3DKDA 3GG1A 4NPOA 5KFFA 3M8SA 3RJMB 1WTFA 4GKKJ 1FE4A 2VH7A 3C6TA 3AXKA 2QSWA 3D28A 3MEEA 4PCQA 4B9MA 3Q8YA 5F9NA 2KKHA 2MLXA 2RUGA 1FKPA 3EUNA 5K14B 5LL6d 3KLFA 3KFWX 1UP1A 1KFDA 2O5DA 1KKHA 2A6OA 4DU8A 1REGX 2I9SA 3GSDA 4BS2A 4ZK7M 2W4PA 1YGYA 3KG0A 3IRWP 1FNOA 2QLFB 2KXNB 5IQ6A 1LWFB 3TAMB 1GFWB 1ZAVA 2IA0A 5EDWA 4M8LA 3KLVA 1PILA 3NEKA 1JJ4A 1VCTA 2AV5A 3EX7B 1CEZA 2C2NA 2HQGA 2MKJA 3G2XA 4Y2IA 4ZVEA 1MNEA 5F8NA 2CJAA 2XULA 4DJBA 4PWUA 2GHVC 3MDFA 4WBFA 4CT9A 1UETA 4NLVA 4OYPA 3CJTA 4RW9B 3MTKA 2FTRA 5KFLA 5KFKA 2KG1A 1ZH5A 4K4ZA 3QT8A 2PI4A 2ZOFA 4C0BA 2LU1A 4OHYA 2KT3A 3AA9A 4ALZA 4LF2A 2QYGA 4ES3A 2CQHA 2R7WA 1NK9A 3RRKA 2UVUA 5KT4A 1U0SA 2FJBB 1SIZA 3ITHB 1GTEA 3DYAA 5LOQA 3OR2A 4WE1A 2DB1A 2VQFJ 5HJYA 2BR0A 1WNEA 2Z2YB 4TYBA 3R7SB 2HFUA 1RAJA 4FYYB 3KG1A 4HR2A 4OYZA 2NSBA 2NSCA 4S0MA 5THWA 5M2PA 4K4SA 3R6LB 4LFAF 4F26A 2CPIA 3D67A 2R7TA 2XB2D 2K3KA 4O3NA 3ONQA 1DTTB 1R0BG 4PG5A 3QJLA 2DITA 1SUQB 1CSJA 4L73A 1T94A 4JI0F 1JLAB 3Q8QB 1RT2A 2RB7A 2ZNYA 3M4XA 1M1KT 1YDLA 3FBBA 4ECSA 4B3MJ 1IKYA 1H74A 1FRKA 2D3ZA 1S1UB 3NCQA 5H9FJ 3X3UA 5LSOA 4HL9A 1VQOS 4DL2A 1QTNB 2BE7D 3FJ2A 3OVBA 1Q1KA 3I0SB 3KKFA 3VGSA 2J6SA 3HP6A 3HHDA 4JYAJ 2DK2A 1XNRF 4QR2A 1D9DA 4JI7F 4ED5A 3GFHA 2OTLS 1UVMA 5B0DA 4JYAF 4MIWA 1HKAA 3A1YG 2ZM6J 2C22A 1YX2A 5KG5A 3ENVA 1JQGA 1IN0A 3MD1A 3RBZA 4YY3F 2AKWB 2DEIA 2JJ4D 5FIIA 2YKNA 3ZZPA 3D6TB 2V69A 4D3HA 3PX6A 5H9EK 3CJ2A 3BGRA 2FY1A 2F4VJ 3NNHA 3W7BA 1T9YA 1FFSB 4W92B 2HVZA 2ZBCA 3R3TA 3G6XA 1KVKA 3L7PA 2Y1JA 2QTWA 3GIRA 2M52A 3W64A 4DR6F 2OMLA 3MAHA 2KN4A 4IH5A 2XI2A 3HHKA 1K44A 1ZOTA 1HQUA 3G96A 2UXBJ 2V0NA 2MDAA 3NXZA 1N8RT 3BPSP 1XK8A 4DPOA 1YJUA 3TUJC 1ZM3A 5KFJA 1Y5IB 3IAS9 4O3QA 3UPFA 4NX9A 4USKA 1RYSA 2DGVA 5GMDA 1CJUB 3D3BJ 3BKUA 3D5MA 3HSDA 3MPVA 3W9JA 5EWFA 1O8BA 1URRA 4I6WA 3AT1B 5ITHA 2EFNA 3ISZA 4KSEB 3PIPQ 1CC7A 1HBMA 4P72A 1U2RA 2KFNA 4P52A 4OYBA 4M5JA 3T6BA 3UDLA 3V6DB 3QT5A 4NCBA 3IBWA 4O0NA 1FKAF 5EX0A 1HLWA 1RHQB 2ZBIA 1RTIB 2VA2A 5LMNJ 3V4IB 3AJ1A 3RYLA 5T7LB 3CD6S 2V8GA 4KYZA 4AFFA 3D6MB 3C15B 4WIQA 1NU4A 4YB7A 2UXCJ 5CH7B 3QO9B 3NNCA 2CVEA 3CNQP 3ZTSA 1O0PA 3W8PA 3H42A 3M8PB 4TY9A 3G82A 1R0CB 2ZJPQ 3P8BB 2NCKL 4DSJA 4OLOA 5HP1B 3FMBA 4B3TJ 1R8HA 1EQMA 4MFBA 3IN5A 1WD6A 3BO4A 4QIEA 2HNZB 4DFJA 2IC3A 4F4XA 4F3OA 3A8EA 1ZPVA 4TLQA 1FXLA 1R3NA 3ET6B 2KM8B 4QW9A 4OI4A 3GWCA 2C28A 4DZDA 1YK9A 1WC6A 2DHGA 8RUCA 2WVCA 5LMUJ 2EWHA 3A3PB 3RUBL 3QATA 2Y0SD 5C2GA 1N6QA 3G6ES 5F41A 2R7XA 3OXFA 5GVQA 2CPXA 4A8KA 1UWAA 1V3SA 2CQ0A 1FX2A 2P2CB 4QIFA 4DV6F 4RUHA 2JOQA 2H5EA 4M5LA 5D0EA 2LYVA 1B3TA 4OZ5A 1FX4A 3TRGA 2IRXA
chains in the Genus database with same CATH topology
4MFBB 3AQOA 4TYAA 5J1PA 3E01A 2K7JA 3CT9A 3KLIB 5HI7A 2IYIA 2KH9A 4YB6A 2VG7A 2F7VA 4ECYA 1TL3A 2PN6A 1DAXA 3U02A 2HMIB 4KO0A 1SH2A 2NUHA 1YIJS 2DNOA 3R5DA 2B6AA 2BABA 2HPUA 2E44A 1Q8IA 1WEXA 3TW0A 3RRGA 4OHZA 4J37A 2IM1A 3V6DA 3DOLB 4JV2A 4OI6A 2POKA 4KB7A 3CDEA 4LSLB 5E33A 4QWBA 2UUBF 4TLRA 1S6QA 2GQCA 4ZHRA 2E1RA 3J81Y 5CYQB 2GQ2A 4O4RA 4ED2A 2GNKA 1JLQA 1T3OA 2IM0A 2Z2LA 2R9LA 4O0IA 2AJ1A 2DHAA 3UW1A 4DR7F 5H9EJ 1NZAA 3ZZOA 1SKSA 3N28A 3VQTA 4A8WA 1UVLA 1L3TA 4EBDA 2R7UA 2ZH3A 2DD8S 2FHKA 4PG6A 3DLEB 5IM0A 2JVRA 4RLEA 4E8UA 4DV7F 4RZRA 3KYLA 5K9FA 2YKNB 2LA4A 3QZ7A 1X4DA 3HJFA 2RKIA 4X66F 1VQLS 1LOUA 1HMVA 2QYCA 2QEXS 3LWMA 4LF6F 2ZITA 4K5RA 3S1TA 4Q45A 2MZTA 3MR3A 1QUPA 2VOPA 1BWEA 3M2RB 3FRYA 1VHFA 3R1LA 2RD5C 3IS9A 4YHHF 2OD6A 4DEZA 4RWXA 4B3SF 1KD1T 3M32A 1KQSR 2HHVA 4UOCA 1DTQA 1JLAA 4YR0A 1VFJA 3MM9A 3OUYB 4EYHB 4C11A 2OLWA 1WG4A 1FD8A 2VPYB 2I1RA 2XC9A 1X9WA 4IR9A 1LW0A 1YJVA 2MQPA 3CCVS 1P1TA 4RW6A 1K73T 5DS7A 4E98A 5KG3A 5IT4A 5DDRC 4ILLA 2JEGA 1CQNA 1JKHA 2UVWA 3OR2B 1RJJA 3ITHA 3TUZC 1NH8A 3PW2A 2O1PA 2B9WA 3RB6A 2X1GA 3IR7B 4FXDA 4IOAQ 1XNQF 1Z4UA 2VV5A 1E6VB 1FF2A 4K4TA 1QVGR 4UUXA 1SKRA 4RU2A 1VIOA 4CO1A 2DCLA 4C0HA 1TKZA 2DCUB 2E5IA 3DFEA 3QAUA 5BYSA 3B82A 4ZVFA 4YDDB 4DV3F 5DLGA 4NA3A 4RW4B 5FLXY 3UDCA 4C4WA 1T8EA 4TU7A 4QWEA 3F73A 3DXSX 5KFCA 1DHMA 3SCIE 1U1OA 2GMHA 2LXUA 4I56A 2NLWA 4IH7A 1SJFA 2LEAA 2JX2A 3HVTA 4IH6A 4R0JA 2L48A 3KLFB 4ZVGA 2PT0A 3C8YA 2ZH9A 3PFOA 2RJZA 1U47A 3MEEB 2KZMA 4NLUA 1T95A 2OTJS 1O5JA 2EFOA 5CYJA 2XGQA 4C8YA 4X4TA 3OTDA 3LANA 3UFCX 3DDKA 5HN0A 5KFHA 4DG1A 2HS3A 1SB6A 4L6V3 2ZOMA 2XBPA 1NK5A 1M5OC 2ILYA 1SL2A 3BN4A 1Y9OA 3C6UA 3FSXA 3LGNA 5G4DA 4QQBA 4ZPVR 1YRTA 1N88A 2VOOA 3RAXA 3NG8A 3LALA 2CRLA 3MMCB 3M9NB 3G9CA 3I9ZA 1L5UA 3CD0A 1UVKA 3OV7A 2W7AA 2BXJA 2GGPB 2IVMA 4KRWA 3TA1A 3UCUP 3PKYA 2DISA 2LKZA 3OFGA 4OX6A 4HEA9 4N47A 4JV1A 1SJRA 1TK8A 2CDQA 5IWAF 5J1EB 1FKOA 3R5AA 2GV1A 4GMKA 5GAGU 3SDEA 3AA8A 3MPYA 2IHR1 4Z37A 4EO8A 4YEAA 3TOQA 3WX4A 2PDAA 5HO4A 2SXLA 2G0CA 4PXBA 4CO3A 5FDLB 4OX7A 2HGMA 4MKAA 2X1AA 2AX0A 4NZ6A 2W8KA 2FVCA 4MK9A 3NMRA 2NREA 2APOA 3BSNA 2ROGA 4EU0A 5BJRA 1VI7A 2A18A 3QGGA 4MKBA 3MURP 3UNGC 1MSWD 2QSFA 3CDWA 4UQTA 1BQMB 1FDDA 3MECA 5F8LA 4ZS6A 1VQ7S 4ECZA 1B0TA 3F41A 4DFPA 1OSCA 2HNYA 3MEDA 1HQEB 1XTZA 1HHSA 2LEPA 2R8HA 3MEKA 3Q2SC 1TL4A 2CPJA 1N0VC 2KJVA 4WKRA 3H20A 1FRXA 3L09A 2ALZA 3N0VA 1FDNA 2BANB 4IG0A 3S6EA 1TAUA 2RF2A 4NLQA 2LVWA 3I82A 3G8QA 3ZFVA 3HT3A 2YWFA 4NYZA 2ADCA 3T9ZA 3VAJA 3PVXA 2V4JA 3BR9A 1TKTB 4BHQA 1KLNA 1FE0A 3ENWA 2F9DA 1NKBA 2VD3A 3AB4B 2UZAA 2WOMA 1S9EA 3SYZA 1FRIA 1FEEA 3IA0A 4WK1A 2KI2A 4CQ1A 5AXMA 1SI9A 2BJDA 5A8RA 1HPZB 2FVSA 4ZP6A 3DMJA 2WTFA 2JFKA 2J0WA 3U1LA 2MXYA 4R5PA 3QPIA 5SZTA 4A48A 2J0XA 1S7HA 3LP2B 4FNHA 1VQ8S 5DJBA 5M2UA 2E7XA 3R27A 3PKMA 2DIVA 4RKUC 4A8FA 2HHQA 4KE5A 3RR8A 2DR8A 1N48A 2JSXA 1GH8A 2VA3A 2HFNA 2J7KA 2M8DB 6FDRA 3P96A 5CZXA 3D0GE 4ZP8A 4DF4A 1R0AA 2XS7A 1K0VA 3N5FA 3DU5A 2X3GA 2AX1A 1H7WA 2M2BA 4NLYA 3VAFA 2XI3A 1F2GA 1S9GB 2HHXA 4N56A 4XK8C 4ZCKA 3HZGA 2DNNA 1J5EF 4CI0B 4AL6A 2AGOA 1KHVA 4OI3A 1UMJA 3RW6A 2D3UA 2YKMB 3M30B 3SXLA 1WG5A 5DO2A 1S1VA 4DLEA 1UL3A 3JAMY 5KFZA 4RNMA 2HYIB 4GC6A 2EVZA 1I1GA 2UUWA 4O44B 2ASJA 2OFHX 3I6PA 1R27B 3OR1B 1QE1B 2FPHX 1YJWS 2ZH8A 4NYPA 2DH9A 3RU0A 5I4MA 3K2YA 1GXLA 3BB5A 1S6UA 4KQZA 4JI1F 3MM8A 1D9AA 2GJ2A 2ZM6F 4ED0A 2R8JA 1G7CB 4C9DA 4NLRA 2N7CA 1NNDA 2VONA 4P7VA 1Y00A 3PR4A 2HFZA 3PRDA 4P6QA 1TR0A 4WTYA 4KC5A 2HRUA 1FVQA 3Q23A 3IWXA 2VKZG 1MW7A 1TV6A 4X65F 4YFUA 2F8MA 1R43A 1DBDA 4OI1A 5LMNF 1C0TA 1HYSA 1UVIA 4I2QA 3CCUS 1KVIA 2YNFB 4DSKA 3M2VB 1S77D 2UUTA 2FDNA 3DLKB 4HDHA 4MIBA 3V6KA 1KOHA 3KWMA 4MK7A 3RBDA 3KNAA 2BA9A 1CPZA 2AGQA 1TL1B 1AW0A 3J7YU 2VODA 4PWDA 3T5KA 2B4PA 2K8GA 4HT5A 1BGXT 1T02A 2L9DA 3OTEA 5CQGA 2HHPA 2QLXA 4XPCA 2XY6A 2C2DA 2J6UA 3G86A 4X4VA 1K1QA 4EO6A 5HLFB 5I3UA 1X5TA 1T03B 3PW5A 4RW7A 5A0YA 4F67A 2X51A 3W2WA 3I96A 3M9OB 4WFNQ 3GIIA 2R8IA 2DNZA 2FC8A 2G9OA 1ZM9A 5HROA 4GO7X 1C0UB 2OIHA 2PMZD 2B3TB 3HO1A 3VCDA 4KV8B 3Q8SB 1YI2S 1FJGF 3ETOA 2W9CA 1KC8T 1RTJA 2CQPA 3DRSB 4ETZA 5A0YB 3CCJS 3SQGA 2UXCF 5I3UB 4Q2MA 1H7XA 4NLXA 1ZTWA 3EGZA 2UP1A 2X1FA 2J0QD 1TAQA 3PO5A 4PWDB 4YUDA 4R8UA 3TANA 1VQ4S 3HK2A 3MFHA 3FNNA 3I4PA 1TQLA 1UA1A 2ZOGA 4U9RA 5AXLA 4TQRA 2HAIA 2YNGA 1O51A 3CVKA 1JJHA 4XAKA 4WZQA 1D1UA 3J7A1 2KZZA 5KT7A 2YX4A 1HYSB 4PXDA 3LP0A 4YP3A 1S1XA 5KFDA 2CPEA 3S7RA 3CJ5A 2YKAA 1Y3KA 2YNIB 2W8LA 3PRBA 3LPYA 5T41A 1WF2A 1REVB 1R8AA 3TAQA 1BQNA 2CPYA 2MHEA 2PMHA 2P9GA 2M3DA 4V19X 3K59A 3QWUA 4N41A 4TXSA 3U1MA 2FJEB 2VG6A 2FJDB 3UE2A 5GAEU 4KHMA 4ED7A 3DI6B 3N6MA 2HWIA 2LQJA 2D74B 2KO1A 1VC5A 5D4NA 1PC5A 5DGBA 4ED6A 1IKWB 3V81B 2V8HA 3G8TA 2AJ0A 3N6LA 1U6FA 3SCJE 2QA4G 4PXCA 2UU9F 1V9OA 2V9KA 4CO4A 1FNXH 4G1QA 3GFZA 4WFXA 5KFTA 1HR0F 4LFCF 4DR4F 2VFSA 2DVIA 2YKMA 2KYXA 4E0DA 3FVYA 2C3OA 4G6VB 3B4MA 4DV4F 1KVJA 2NZ4A 2D7SA 4M5DA 5DQIA 3KLEA 5F0UA 2QRRA 4NL5A 2MKIA 2QZ8A 5HMWA 5D8HB 3CMAS 2WONB 3LH2S 3VAMA 1NHUA 1T3NA 4HTJA 1HL6A 3BF4A 2E29A 3CCMS 5HL7Q 4URGA 1VQKS 1RT6A 4DFKA 3T1YF 2EFGA 1SL1A 4HTIA 4NXMF 5DG8A 3MD3A 2Q6CA 5EUHA 4DL5A 2MHNA 2RQKA 1VRTB 2RRBA 3ISNC 5IT9Y 4OX8A 4C8ZA 1XN9A 2H9ZA 3K5PA 2UUCF 2MZJA 1U8SA 2B4VA 4IDKB 5KG1A 3N4WA 1X8DA 4JI4F 3OJSA 2V2KA 5F9LA 2BJEA 3MGJA 1UKUA 2W9AA 4OZ0A 4DQIA 1S1TB 4A4JA 4KHRA 3DRYA 1HD1A 2MSSA 3PEJA 3NMAA 4DS5A 1HARA 5F8JA 4R5PB 1FCAA 4JV5F 1KHWA 4JI5F 1A9NB 2A3JA 1JLFB 2CQBA 2W4CA 3QYYA 4KT0C 2QA1A 1G6BA 2GMJA 2Z0GA 5DQGA 2N3OA 2X1BA 3I5AA 5C24A 5A8KA 2WOMB 4HYKA 4JI3F 1TFYA 1U6BA 2RILA 3KTQA 2PA3A 3JYTA 2WCXA 2JEJA 1AFIA 4DV2F 1UW4A 3KLGB 2HLTA 1TL5A 2MJUA 5LXYA 1JWWA 1Y0HA 2V9WA 2I5JA 1OQ3A 2FVPA 2R2SA 2VQEF 4IG0B 2OJ3A 2BANA 1RKJA 2CQDA 3D1QA 3HXMA 5K8PA 4XIUA 5D3GB 2AYMA 3N6NA 4ILRA 4UW2A 2MGZB 4F2SA 5D77A 1S9FA 2FJAB 3I56S 3MXHP 3MEGB 3V2UC 4Y2KA 2KFZA 2YWGA 2VC1A 1U26A 5LT5A 1LKZA 3GYNA 4Q43A 4DSLA 3OTCA 4OV1A 5B0BA 1C1CA 1S79A 2A2CA 2VBZA 3HM9A 4DQRA 1APSA 1BD6A 4MYTA 5L39A 3RBEA 4TY8B 3E51A 3AH6A 2I8EA 2IJFA 2KM8C 3Q24A 3MI7X 1URNA 2B5JA 1Q4RA 4TU9A 2U2FA 3T1AA 4FVMA 1V6HA 5K8OA 1VRUB 3TVZA 5KG7A 4KHPF 3T19A 1FKOB 2XY7A 5HMZA 1W25A 3BEGB 3MMAA 1X9MA 1RTHA 3O6QA 1QAJA 1Q7YT 5A8WB 2YTCA 5LSLA 2Q66A 3KMQA 5J2MA 3FEYB 2JLEA 2AW0A 2P9EA 5KG4A 5KFBA 3F44A 4IG3B 5A8WA 4QWDA 2VFTA 2HNDB 1RT4B 3LWLA 4ED3A 2NPIA 3PR5B 3CJ0A 3CXCR 2NUUG 3CCRS 2KU7A 2IBKA 3OL9A 2B5JB 1HI8A 2RDIA 1UA0A 4X2BA 1R8PA 1YRUA 4PXEA 3DLLQ 1LW2B 4N8NA 1S0OA 4I2PA 2J7WA 4FVCA 2ZJRQ 3K58A 2I38A 3QIDA 4NXNF 1XMOF 2W24A 4L3NA 5KG2A 2N82B 2FHOB 2XMUA 3IFEA 3DDNA 5KFUA 1IR0A 1LXJA 3MM6B 2ZH5A 2PA8D 4RW4A 4QBUA 5JVHQ 1SJ4P 3RZAA 1XBWA 5KTQA 2M8HA 2MGZA 1TKZB 2CQ3A 4J5OA 4EFAC 5GAHU 2NXUA 3MMBB 1IBMF 2C42A 1MMDA 1HWJA 3LP1B 2ZHAA 1FRMA 3GB0A 3KK1A 1YJ9S 4LF7F 1E6VA 1NRKA 1K1SA 5D4OA 4HH1A 3PV8A 2KTQA 1KQFB 4DUYF 3KLGA 1HBUB 3JYTB 4J9SA 2HFOA 3TUIC 3HI9A 2UV8G 2ZDOA 5A8KB 2IMOA 4UUWA 3AY0A 4RW6B 1QAXA 5DETA 1HNWF 1JLFA 3PACA 2FIUA 1UEVA 1LFWA 2VFRA 3VZIA 1RT3A 1QVFR 3I55S 2JEFA 3UR0A 3EGWB 1VC6A 3IRXB 4CO2A 3IS9B 4LFBF 3VTIA 4IKAA 4LSNB 3NLCA 4IDKA 2MKSA 2DGUA 2V5HG 1A6LA 3ZZUA 1M5HA 3I87A 1R6YA 2MQNA 4M63A 3HPOA 4IFVA 1KS2A 4ID5B 1CVJA 1H38A 2BOPA 3SCLE 1VIXA 1QAYA 1IJEB 1WEYA 1Y5NB 4X84A 4H4MA 3V4MA 1UFWA 2ZC3A 4X4RA 3GILA 2WONA 3OFEA 1WF0A 4YR3A 3J80Y 2BQRA 1NEEA 1UWBB 3DLEA 3H5YA 3GFXA 3HHNB 3HF5A 5KFXA 1DARA 4JI2F 1L3SA 5EGYA 5D6GA 4NLWA 3B8HA 3NGDA 4EWTA 1C4AA 1YJNS 3JSMB 1Q8LA 1WHWA 2J9DE 2K3IA 4DF8A 5L1JA 3GIKA 2YX7A 2CKWA 3BSCA 1E6YA 4P2SA 1JLQB 5KFRA 1FK9A 4NCGB 3UQSA 5CYQA 1X5OA 3KMSA 1S6QB 4ZHRB 4ZKAA 5DLFA 4HKQA 4F4KA 4LJMA 3QIPA 4DR2F 2MQQA 1J5OA 4AXJA 4M94A 4CCHA 1ZM4A 1HBNB 2BBEA 2F8EX 2RS8A 2DNPA 4WFYA 3Q0AA 4ECTA 5B08A 1T05A 2HS4A 3DLGA 4C0OC 2OPRA 3PX4A 4KGKA 1TL3B 2FHMA 1TKXA 5B0CA 3TQ1A 1LK5A 2V8VA 2OPSA 3V6HA 3LP0B 4ZCIA 3TX8A 4ERDA 3DM2A 3U1NA 4EBEA</