4OZNA

Glnk2 from haloferax mediterranei complexed with atp
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
119
structure length
116
Chain Sequence
DLPNDGGIKLVMAIIRPDKLADVKTALAEVGAPSLTVTNVSGRGSQKSQWRGEEYTVDLHQKVKVECVVADTPAEDVADAIADAAHTGEKGDGKIFILPVENAIQVRTGKTGRDAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of a PII signaling protein from a halophilic archaeon reveals novel traits and high-salt adaptations.
pubmed doi rcsb
source organism Haloferax mediterranei
molecule tags Signaling protein
molecule keywords Nitrogen regulatory protein P-II
total genus 25
structure length 116
sequence length 119
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2014-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00543 P-II Nitrogen regulatory protein P-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4oznA00
3X3UA 2EG2A 2J9DE 5DS7A 2ZFHA 4CO3A 4CO1A 2PIIA 2GW8A 4AFFA 1J2VA 2RD5C 4CO2A 4C3LA 3BZQA 3TA2A 1VFJA 1NH7A 4C3MA 1V9OA 4OZLA 1V6HA 1NZAA 2CZ4A 1PILA 4CO0A 4WK3A 4YB5A 1NAQA 1NH8A 4CNYA 4Y6IA 2GX8A 2O67A 3AHPA 3M05A 3O5TB 1XK8A 1H3DA 4RX6A 1UL3A 3LF0A 4NYPA 5D4PA 3AH6A 1KR4A 1UMJA 3AA9A 5DRKA 2XULA 1QY7A 1V3SA 1UKUA 1V3RA 3L7PA 2V5HG 4E98A 3DFEA 1Q1KA 2DCLA 2XZWA 4R25A 2Z0GA 4CO5A 2O66A 4USHA 1VHFA 4OZJA 4YB7A 3TA1A 1OSCA 2XG8A 4IYQA 3NCRA 2E66A 4C3KA 4RWXA 3O8WA 2J9EA 3OPKA 2J9CA 4D3GA 5L9NA 2NUHA 4RLEA 4WK1A 2JJ4D 3HLUA 4OZNA 3CE8A 3NCQA 5D4NA 4CNZA 2J9DA 3NCPA 4ZK7M 4RWWA 3TA0A 3GSDA 2NS1B 4CO4A 1O5JA 1P1LA 4Y65A 2NUUG 3AA8A 3MHYA 4YB6A 2XBPA 4NYOA 5D4OA 1GNKA 1HWUA 1UFLA 2EG1A 5D4LA 4D3HA 2GNKA 4USJC 3N5BA 1O51A 4USIA 2VD3A 2ZOMA 3T9ZA
chains in the Genus database with same CATH superfamily
2EI5A 2DTJA 3X3UA 3Q0AA 1EZZB 3C16B 1ZM9A 3DRYA 5BR8F 3F41A 1UEVA 3LW5C 3MDFA 3HCXA 2A6MA 2QGFB 4OI0A 5FDLA 4MTPA 3GLJA 2ZFHA 2PT0A 4I67A 4EBDA 3RB6A 2HGMA 1HL6A 4ECXA 1O0PA 3CW2C 2KN4A 4KBIA 2R8HA 1VLYA 4ATNA 2DVIA 2JDJA 1ZTWA 1FJGF 3CJRA 1VMBA 4I2QB 5KG1A 4AFFA 4ETZA 3UWTA 2DHSA 2C1EB 1S6QB 3I32A 4DSJA 5KFDA 3A8IA 1RAFB 2MKSA 3R5JB 4QIFA 4GVBB 3BSAA 4V1Ak 4DDFA 2DXDA 3V6KA 2ZUAA 3LAMA 4OI3A 3UNGC 4LF9J 4FYDA 1RT5A 1NZAA 4HL9A 1IKXA 1DTQA 1SJ1A 3DKDA 4WK3A 1T02A 1SV5B 4KB7A 3CEDA 1OPZA 2BJ3A 3OXFA 1U8WA 2O67A 4DBQA 1C0TA 4JI7F 2VG6A 2J6SA 2IBKA 3NNAA 5L38A 4IG3A 3OTEA 1Z4UA 4TLQA 2AJ1A 4ED7A 3MPDA 3Q2TC 1B7FA 5T7LA 1Q79A 2E1RA 2O1PA 2UZAA 2BE9B 1ZYQA 1U2CA 3CNQP 2FC8A 1B3TA 2SXLA 4MKVA 3GYXB 5DRKA 1PC5A 2NQPA 2L3MA 2HHXA 1JLAB 3ZZ0A 4RNHA 4NEZA 1G1XA 2QLBB 3C6TB 5L1JA 4BC7A 2QA4S 1T9UA 4NI2B 4QR1A 3VAJA 4NXNF 1RTJB 2G9OA 1UA1A 2HVEA 4HI1A 5K14A 4KR0B 3CJ2A 2HLTA 2H65B 4LIRA 1MU2A 3RTVA 3OSNA 2QTWA 3D67A 1Q78A 1VC6A 5GAGI 3L7OA 1XNRJ 4L74A 2XLIA 2HVHA 2MJUA 2NXJA 3G9CA 1ELOA 3H25A 4IDKA 1LNQA 3AXMA 2E29A 3VAHA 1NNDA 3IAM9 4D3GA 4WBFA 3QGHA 4LRCA 5ETOA 2QA4G 1M90T 1NDLA 2R7SA 1IM6A 3GIIA 2XZTB 4MAKA 4DR2J 2PFFB 1R31A 1XNQF 5LMNF 3HLUA 2CQCA 2F40A 4UQTA 6FDRA 3MMBB 3LANA 2QLJB 2BM0A 1UCNA 2J9DA 2BJ7A 3HKZD 3NGRA 5ETSA 2CPZA 4YB1P 1G7CB 1WOOA 2MHNA 3R5AA 3RW7A 3ZTRA 3CCJS 1NJXA 3PYDA 2Y1IA 2GO8A 1S10A 3KK2A 4GKJF 3BBCA 1AZSB 1FFSB 2G0IA 4Y34A 2AP6A 3PX0A 4IRKA 5CZVA 4C98A 2UUBJ 2ZHAA 3K0JA 2UUBF 5F3TA 1JK9B 3GYNA 4P10A 2BEFA 2I38A 2YNHB 2MQPA 4OI1A 2MJNA 4DI6A 4DWIA 1U1RA 2C2EA 3LWMA 3DNCA 3MEKA 4FN5A 4WCEQ 2XC9A 1H73A 3EZOA 4IH6A 4I69A 4WF9Q 1OWXA 3K5MA 5KFTA 3CIZA 1U02A 2EFPA 3PTWA 1O6XA 2QE5A 4G1PA 1HHSA 3JSBA 3H40A 3ISNC 2EC0A 2HNDA 2BJ1A 3N5BA 4ZITA 1KLNA 1ICEB 1J5OA 2VA2A 2ZOMA 3AAWB 4JI4F 2YQ1A 4OL8A 3LGHA 4N5SA 1HNVB 4U96A 3US5A 5IV4A 3D9BA 3T6BA 1SL0A 1GXUA 2B6AA 2J0WA 2Z30B 4LVOP 4UOHA 5IC6B 3DM2A 2ZHOA 4N47A 2NZ4A 3M9NB 4DUYF 1Y3KA 1FT8A 4A48A 4DL7A 4MKYA 1LWCA 3H5YA 1L3KA 1S57A 2FD2A 2MKCA 2DR6A 3KLIA 3O2IA 4IRCA 4NXNJ 4UY85 2FJVA 3HMJG 1HPZB 5E3RA 1JLFA 4QWAA 3Q8PB 3JXOA 1T3OA 3FCVA 3HHLB 2DKOB 4KGZB 3VAGA 2F5GA 5K8OA 5LXYA 1VRUB 4OHXA 2I6WA 4C97A 3TJAA 3EXCX 2VDHA 1YI2S 4B3OB 3QT7A 1V9OA 2GIRA 3LWLA 4OX9J 3NWGA 4OZ5A 3TP2A 4ILRA 4QWEA 4AUKA 2XMVA 1HA1A 3LOUA 4CO0A 1X4GA 1RTJA 4I6YA 4B02A 4YHHJ 4FXVA 3C46A 3G71S 5F9LA 2E5IA 1K8AT 3BPDA 1IVZA 1H2TZ 4NLYA 3PJXA 5KFVA 2CPYA 1X4AA 2ZDPA 3KJNB 4CT8A 2K06A 2P6TA 4ZCMA 5ETRA 3PIOQ 4NLDA 2F8HA 5G4DA 4M94A 1JIHA 1UVJA 2CPXA 3GJSB 1M5SA 4ZN1A 4YR3A 1ZTTA 3E3XA 1XMBA 3OFFA 1ZETA 4I2PA 3FBBA 3R5GA 4ZVUB 2AGQA 5RUBA 1CEZA 2J0SD 3GB0A 4L3NA 5LM7E 2MYFA 4FP9A 1WELA 3JSYA 3W60A 4USVA 2GC8A 1NBEB 2VASA 3T5JA 1JJ4A 4DR7F 4QU6A 1HBOA 2DNQA 3N4WA 3SFUA 2MGZA 3CF5Q 2HGNA 3GYGA 4F4XA 2L9NA 5ETNA 2HWTA 1X4DA 1FKOA 2F7VA 2FJEB 3CDWA 1SKSA 1JKHA 1Y00A 2DXEA 5T14A 2HHSA 1MN7A 4DR1J 1IKYA 3EZ5A 4OYMA 3DN9A 1LXJA 1DLOA 4OHZA 1X0PA 2OUGA 1WEYA 3K7RA 2HBRB 2E7VA 2QMUB 3I5CA 4B9VA 3GJTB 2FTRA 1RGVA 2OPPB 4G1QB 2LP4A 3BKFA 4QJVA 3GIJA 4K50A 3J80Y 4M1KA 4PWDB 5A6WA 5JUMA 1NJWA 3W8GA 3VZHA 2DGUA 3CGIA 3FNNA 2HRUA 7AT1B 4DSIA 4DQIA 1IWGA 2XMKA 1TTHB 1TV6B 1WC1A 2HFSA 3NCQA 2BUNA 1RP5A 4HH1A 2LQ5A 4N8OA 4USWA 5K20B 2FHMA 2GGPA 1AA1B 5IQQA 2QMXA 2AQ4A 4U8YA 2BE7D 2RDIA 1DHMA 1K47A 2XSFA 2BACA 3K17A 2J5AA 4H4KC 2DBBA 2QO3A 4KKOB 3FK4A 3JTOA 4O4GA 5CYJA 2RRNA 5DQHA 3U27A 3MM6B 1SL2A 1WD6A 2R7UA 4J9RA 2CADA 4JV2A 1DZ5A 4U6PA 1AXQA 1FA0A 4WYLA 3JYTA 1AUDA 3W2VA 1TKTB 5GADI 1RJJA 1GNKA 1WC0A 2H3EB 5AE3A 3LP1B 3OLBA 3CXCR 3L7UA 5LSLA 2FY1A 3E2EA 2LFVA 3DLJA 5GADU 3P3DA 5AXLA 1WG1A 2YNGA 3EDRB 3MAAA 1I3OB 3TZYA 2U2FA 1TFYA 4KTQA 1OQ6A 3UN5A 1RHQB 4USIA 1R0AA 2XGPA 4I1TA 2DGQA 2I9SA 4FDFA 4NRTA 5KFRA 4FF3A 2UXCJ 1S0OA 2LU1A 3IWXA 2A6OA 3A12A 3Q23A 3FMBA 2BJ8A 1PYSB 1T9YA 5KT6A 4C8ZA 2WK4A 3M8WA 5I3QA 4X62J 3PW5A 1YTYA 1VQ4S 3O44A 4MFBA 2PA8D 1RI7A 3W61A 1QDUB 5CAAA 5M2PA 4C9DA 1XNQJ 4ZCKA 1RWMB 4DL3A 2C2ZB 2CQGA 3I5BA 3FRZA 3L95X 3DDKA 4TN2A 4JYAF 5K9FA 4DR1F 3OFGA 2MKHA 2G2YA 2RF2A 4JB8B 3KLEB 2PI4A 1JLQB 2BJEA 5JVGQ 1MSWD 3K8VA 4WU2A 4TQRA 4Q8EA 4DXLA 1HYSB 4PKDB 4B3TF 1FO1A 4FKYA 3P8BB 1S1VA 2DRBA 1WKLA 3AB2B 3UDCA 3B78A 1S9GB 4XO0A 5CXTA 4YEAA 3OTOJ 3SQGB 1FI4A 1ZS6A 2EPIA 1CJUB 3IBCB 2CJYB 3WX4A 2FLLA 3I0RB 5CCMA 2PMHA 2AV5A 4DV1F 2LQ8A 2GFFA 2MGZB 3BN7A 3EWGA 4QIWD 4CI0B 4LUBA 3AH6A 5A8KA 3OHBA 1IKVA 1QTNB 2ABYA 2GV1A 2KB2A 2F1FA 2ZE2B 3QFHA 1FWKA 1S1TA 5C25B 2IDEA 2QJ3A 3PX4A 3BGUA 1XMOJ 1SKUB 1H2VZ 1TL7B 3QQCD 4BC9A 4OFZA 1C2PA 2AD9A 1RAEB 2YNHA 3DFEA 3TYTA 3MFIA 4ELUA 4DR5J 2V94A 1KBRA 3H2UB 4M5DA 3WC0A 3Q8SB 1NK7A 2Z58B 1I94F 4LFBF 3DMJA 3HSDA 5D8HB 1RTHA 1T95A 5KG2A 2AKWB 2W7AA 3Q8VA 1RQ0A 2EWHA 4X64J 4PYDA 2AT1B 1U1QA 2KG1A 4FYYB 2NYHA 2ZH2A 3T1YF 4X2BA 2VFTA 1MN9A 3KLFB 3R5CA 1FKPB 4KAIA 1H74A 1GMVA 3NGUA 3QGIA 2M7SA 2PN6A 4L3KA 1MU2B 4OX9F 4P9SA 4JI2J 4KKOA 4F26A 4OQJA 1FRXA 2EC2A 2Z2ZA 3QRPA 3BB5A 1N52B 1BQNA 1B7YB 2AX0A 4RZRA 5AE2A 2ZM6J 3TUPA 4PG6A 1FESA 1UP1A 3M1VB 3TUZC 2LA6A 1S0NA 3ZZTA 2NUHA 1FJGJ 1UW4A 3H5UA 4KE5A 2JSXA 3HFKA 4Z2XA 2DCUB 4X66J 4LF4J 3DRRB 4J7CA 2YNGB 3CCMS 1CLFA 5KFLA 1CQMA 2XGQA 1BMQB 4H4MB 4F36A 7FDRA 4NWBA 2XNQA 5SZTA 4IR9A 3Q8YA 2ZOGA 4ELVA 1R0AB 3O3LA 3GSDA 3M30A 4P7VA 2A2CA 3QBCA 3B8HA 4UZCA 4C2MA 3A13A 2B9EA 1YJNS 4QR0A 2BV3A 2DNLA 2HAFA 2GVDA 2RMLA 3IRWP 2NUUG 2E1CA 3G4SS 5KG3A 5J2PA 4N56A 4DQRA 1DFDA 1TK5A 1E6VB 2WSCC 4DR7J 4R8UA 4JBCA 4DG1A 2N3OA 4EO6A 3CJTA 3SSRA 2BRLA 4K59A 2F4VJ 1NHKL 4I56A 4NLOA 4WE1B 2M8DB 1LWXA 3S01A 3NL0A 1VK3A 2IRXA 2XY5A 2KT2A 4JOUA 1LFPA 4FNIA 3WIVA 5IT9Y 4GO5X 2DIUA 4YFUA 1U1KA 3PY8A 1FERA 1KN6A 4OMFG 4KGMA 2WVBA 1U1MA 4Q0BB 2OP5A 2HNDB 2IJRA 5E7OB 2J9DE 4EZ9A 1LFWA 1OJ4A 3DOKA 1WHYA 3FEYB 4ECZA 2HNZA 3ETMA 1AZSA 1CJTA 1SJQA 1KOHA 3WQPA 4FYWB 4HT7A 4DUYJ 4X4NA 3AOCA 3IM8A 1WSRA 1HQUA 4EFAC 2GIFA 4ED6A 4G65A 5G0RB 2OIHA 1CQNA 2PIIA 2WVCA 4WKYA 2D1CA 1WC6A 1JLGA 2C2RA 1ZM4A 5A8KB 2HRYA 4ZIWA 3GIKA 5HO4A 1KVJA 5K14B 4Y2KA 3WC2A 4XDDA 4CO2A 2KM8C 4PQUB 4C3LA 3L09A 4X4VA 4J9MA 1ROFA 1D9FA 2RUSA 2HVIA 3UI3A 4RU2A 3KOAA 1R0CB 2YH0A 2FHKA 2CNNB 3FQKA 2NPFA 3X1LB 2X3GA 1NPRA 4Q2MA 4U9RA 3T5LA 1JLAA 2RNEA 1AT1B 5IV3A 2VPWB 3DRPA 4YB5A 1NAQA 2P9EA 3OR2A 5KFGA 1YITS 3BQ0A 4TYAA 2VFSA 4IDKB 3AHPA 1TUWA 2HQIA 3W9HA 3R97A 4XPCA 1SXLA 4YY3J 3CO9A 2YKPA 1BLUA 4RW8B 2VC1A 2MQQA 2YKQA 4IQXA 4I64A 2R7WA 1UFWA 4J91A 4DF4A 1N34J 2CKWA 1YJTA 3RB3A 1MWQA 5K5MA 4CIOA 2DH7A 1GK8A 2RS8A 1N5QA 2J0XA 3EJMA 1M5OC 1YVFA 2ZZTA 1GXLA 4TY9A 2MXYA 2WTFA 5EWEA 5JJBA 1VS3A 1ZM3A 3OFHA 1NKBA 5F3ZA 3EYZA 2CJKA 2OTJS 1Q1KA 2BRKA 1KOOA 1N34F 2XNRA 2HHHF 2J6TA 3R2DJ 3F44A 3FUYA 2FZCB 2D9PA 4PABA 2RRBA 2Y8YA 3PKYA 1D9DA 3DLEB 1IBLJ 1VHFA 4UY8T 1WC4A 3EPIA 5J2NA 3CCRS 4OZJA 3KNGA 4H4KA 4K8RA 4DV7J 3MR3A 1TU0B 5D3GB 4IFVB 4DCOB 3RAXA 1C4CA 4OI2A 4IR1A 3AQPA 2XWXA 3AXKA 2ZUGA 3OR1A 4ANEA 2IRYA 4EK2A 4XIUA 4WFXA 2YKMA 2FLOA 3DGPA 1YG0A 3TWZA 2MSTA 1P6TA 3RZAA 2N7CA 4B3MJ 1E6VA 4LSZB 2C42A 4MYUA 2G13A 5AT1B 4ZVSB 1CVJA 4NCGA 1W2BR 1FHTA 4DV4J 4F3OA 3AOBA 5LMUF 2QRRA 5DDPC 2HZVA 4PYAA 1RHJB 2YY3A 1SL1A 1P8GA 5ADZA 5HK4A 1XBWA 2VB6A 3M2UA 2ADBA 5KG7A 4RBTA 3DLLQ 2YBVA 4P72A 4M95A 4ZPAA 2CPIA 2CWXA 1GTEA 1T0TV 1AB8A 2P5VA 2RHQB 2V4JB 3G82A 3PHEA 4HLBA 4DPOA 3CD6S 1HD1A 2VQEF 3PZPA 1N6QB 4UQGA 2EKNA 2C2KB 4FYXB 2EK6A 2OSRA 3RBXA 5D78A 2BVZA 1JXLA 2OHDA 2WSEC 1LK7A 1VRUA 3H90A 4J9PA 1VI7A 2RILA 3IGVA 1D8YA 3D6MB 3BKTA 4KFBA 3MECA 4A8FA 4ETXA 4UOCA 1TVRB 5IM0A 3DRXA 5D4OA 1WUUA 2Q3PA 3ENQA 3RUBL 4CLPA 4ECSA 2EBEA 5F8HA 2IPOB 4FBUA 2Y3YA 4NLSA 1TK8A 4QR2A 4CZCA 1UVIA 2HWHA 4PQUA 4QYZJ 1XJWB 5HQ8A 3JSRA 4LRBA 1RWXB 3R1LA 1UETA 3GR1A 4X65J 2V8VA 1U8SA 3P4UB 3QZ7A 3BO3A 1N32J 1GH8A 1SJFA 2HURA 1W26A 3HHLC 5KT5A 2D69A 4EI2A 5GMEA 2RHSB 1R8PA 3MCSA 2BYCA 3Q24A 1DQ8A 2ASLA 5E3CA 1K1QA 3E01A 1GMUA 4ED1A 2VBYA 1HQ2A 4K7QA 4DV6J 2GHWA 4CLTA 1PG5B 1VRTB 3TNVA 3FSYA 4QIVA 3ISND 3CVKA 4QCLA 1SQFA 4ZVOB 2B4VA 2LQ9A 4J9KA 2YKOA 1KHWA 2VV5A 4GRSA 1UEKA 2LDIA 4IFYB 4W98A 4F7VA 1WI8A 4A8SA 1M5HA 2YVSA 4DCJB 4DV6F 4KH1B 5KT7A 2C3OA 3J81Y 3PYFA 1N48A 4WJBA 2YKNB 2OI2A 3ETOA 2CQBA 1FD8A 3D0IE 1FJEB 1FK9A 2H5IB 3MM7B 3EXYA 1RKIA 3FC9A 1HHTP 2H51B 3T5KA 4ES1A 2H1YA 1MROB 1TMJA 2R7VA 5J2NB 1X4BA 2FZGB 3OQ2A 3EMTA 3P96A 4OI6A 4QZVB 4R5PB 3CC7S 2QG9B 3BGRA 2Z57B 3ELHA 3NGTA 2LU2A 3UFCX 4RNFA 3LALA 3M30B 2B0GA 2WVDA 3R8YA 4O44A 3MI7X 2AW0A 3IM9A 3BSCA 1GFWB 4JI5F 1UPMB 2DY9A 1XEZA 2CQHA 2YKMB 2UV8G 4AXJA 3GTYX 1BD6A 2P2CB 2W2NP 4CWBA 1N8RT 2M4MA 3IRXB 1M5PC 3BPSP 1KQSR 1JNZB 3H2LA 4QPXA 4R8UB 2CG8A 4X64F 2C2MB 3MXHP 1WF1A 2YX4A 4NLXA 2XZWA 1ITPA 4ED5A 5KG4A 3DHWC 4MK9A 1P27B 1I94J 1DLOB 1IQTA 1M0SA 2F3JA 4OHVA 2ZH6A 1U2FA 4BWMA 1EQ0A 2KHCA 2QT7A 2L41A 2JWNA 2KVIA 3CDUA 4BS2A 2JEIA 3CDAA 4EO8A 3S8SA 5KT2A 4LF6J 1CULA 1F2HA 2XS2A 2V4QA 3KUEA 1RT6B 3K8WA 4AT1B 2B51A 4C8MA 2W24A 3N5FA 2ROPA 2WBMA 3CJKA 4C3KA 3ZTPA 1AFIA 4NYZA 1X9MA 3PM9A 3S6EA 2GIQA 1KQKA 3H4DA 1HIYA 4P2SA 3LP2A 1RZMA 2ZH9A 4KH0B 1RTDB 3CC4S 3DLGB 3W65A 4PZVA 2HHWA 2KM8B 4AL5A 3MAHA 1Y4ZB 2KFYA 4WZQA 2HSEB 2F4FA 2Q6BA 2ZBQA 1HBMB 1LEOA 3KYLA 5H9FJ 2I1RA 3CCVS 2D3OR 4DEZA 4PPDA 1R3NA 5D0RA 2QMWA 5B0BA 4WIIA 4B3MF 3UO0A 2C3UA 3KJVB 5B0DA 5C24B 1RBLA 1VQ6S 3M7VA 1FCAA 3FEXB 2HMIA 2DNMA 2RH3A 3DU6A 2EW9A 3RG6A 4DV0J 1S9EA 4YDXA 4OX6A 5B0FA 3NNCA 3UN3A 3T1HJ 3TQ1A 2L08A 4Q7AA 2PGCA 3UD5A 4FS1A 4M5JA 3GWCA 4DN9A 4NYOA 4XTTA 3HVAA 2HFNA 4DPUA 2JH3A 1IUJA 1SC4B 1BHNA 1S9GA 3PW0A 1UWBB 3I4PA 2CQ0A 3BH6B 4DX6A 2V2KA 3H7HB 2HK2A 3V4MA 1CC8A 4RNNA 1T03B 3LQVA 5KFYA 2HS3A 4NPOA 4O4RA 5KFNA 2VD3A 3KMSA 3RR8A 2DT9A 2RF2B 3O6QA 3KLEA 2ACYA 2GZOA 4HACA 5JXSA 2HVZA 4CLSA 1TAUA 2EG2A 3F0NA 3HPOA 3MPUB 2OEMA 5D0EA 5KG0A 1FDBA 4DS4A 2Q1LA 2ZBIA 4JP8A 3J81U 3KLGB 1VC0A 4EZ6A 1WNEA 2V9KA 1U1NA 2YWEA 1UJ6A 4IFVA 2GMJA 3D4JA 3SZ2A 3BGOP 2LEBA 2ILZA 3UD4P 5F8MA 5D6GA 4G1IA 1VC5A 1T94A 1HNWF 1HWJA 1T9WA 2R42A 2K2PA 3HFVA 3BZQA 1S5ZA 1SJRA 3DM2B 2B5JA 4A47A 1VQLS 4N76A 1LWCB 2QSFA 4R0JA 1ZZFA 5HMWA 1RCOB 4K0KF 3W2VB 2QX0A 4NXMJ 2V68A 1S12A 1SC6A 1V6HA 2EEYA 2OFGX 3OXGA 2R4FA 3GPAA 3M6UA 2R8GA 4DUTA 1N88A 2E5JA 4ZPTR 1NB2A 4Y3CA 5F8LA 3OV7A 2ZKTA 2EK1A 2PMWA 2NCKL 1NHUA 1TL3B 5KFFA 1W2IA 4O23A 1HBUA 3U7JA 1EP4B 4B3OA 1U47A 1IBCB 4NMXA 1Q81T 1LW0B 5DZ7A 3THTA 2W9CA 2DNZA 2ZBRA 2VHGA 1KC8T 4FYVB 2R7OA 4KPCA 1OMSA 5A6PA 1K0TA 1D09B 3GG1A 2W8LA 4DX8H 4DFPA 3PCOB 3VVTA 6AT1B 4USKA 4USUA 2FPHX 4DV7F 1YRXA 4F67A 2CDQA 4PG5A 2V8DA 8AT1B 3QATA 1CS4B 3CJ4A 4HTIA 3NKYA 3FFIB 3PACA 5IWAF 2KI2A 3B4MA 5A8RB 1UTAA 4LJMA 2IM1A 2BQRA 4ZJQA 4DG1B 2XCPA 2W4CA 4DL4A 1NJZA 1YDLA 4NA2A 1VQSA 3CULA 4Y00A 4LMZA 2OPSA 4NLTA 5D0HA 4IG0B 3P5BP 1UVKA 2HQFA 4ENOA 5GAGU 3K5PA 4A8KA 4FBTA 1CJUA 1Q8KA 2D41A 2VBZA 2Q66A 2J8SA 4J9LA 5L9NA 4ZVHA 3ENAA 4JYAJ 1VQ9S 3OTDA 5E0OA 2B4PA 1C0UB 1VIOA 2ZVIA 2CNKB 4ZP8A 5BYRA 2IC3B 2JC1A 4L72B 2M3DA 5LL6d 4X66F 3GFHA 3ZNUA 3CMES 2CXEA 1L5UA 3TZXA 2KRRA 2YKAA 5IS2A 1BE4A 3W62A 4LSNA 3K59A 4LIWA 4C7QA 1SKWA 2FJXA 3TA0A 4DSKA 4O3QA 5A0YB 4DSLA 1SJ4P 3I82A 4OX8A 1K0VA 2XI3A 3A1YG 4QYZK 1PGZA 2YTCA 5DLFA 3R2CJ 3B4DA 4PPZA 3MR6A 2IAJA 3HJVA 1K9MT 2E5LF 4ECTA 2UV8A 3WX8A 4JI6J 3MOZA 4PG8A 1UZDA 3LPYA 4OJHA 1FX4A 3H0PA 4KGKA 1U0SA 5DG7A 1YWXA 4ZVRB 1M5VC 4CP5A 9RUBA 4C8YA 2C2NA 1Q4RA 1S6OA 1NU4A 2FY8A 4NX9A 1D8ZA 3L4BC 5KFBA 2GAGC 2KYZA 4TU8A 1VQPS 1PSDA 1BWVA 1F6TA 3QFWA 5IT0A 1YZ7A 4AYBD 4X4QA 1T03A 2IJFA 2LXIA 4I68A 5EDWA 1SBRA 3MM6A 3ZZUA 4UOGA 2MB0B 1EB0A 2WCXA 2CIMA 2JNJA 3CB4A 3SDEA 1U2RA 1HWLA 1SUQB 1VQNS 3MTJA 3PKMA 4I2QA 1IN0A 1XMOF 2HNYA 4NLWA 3ZZRA 4Z37A 2GJFA 1WDDA 5KOXA 4B08A 3VF0B 3PW7A 1E6YA 2Q79A 5HBMB 5CD4H 5KTQA 3KUHA 4P7TA 2HIYA 1WKJA 3DRPB 3N6LA 4NRUA 4OJGA 4USTA 4CO3A 4DSEA 4KRWA 3OUYB 2BOAA 4I7FA 2AGPA 2CJ9A 1UW9A 2GW8A 2VG5B 2W25A 3ZC4A 5A8WB 2CQ3A 4LF8J 2Z56B 3QJPA 3DI6A 3SV3A 2H4YB 2VOPA 2IY5B 1VRTA 2BABA 1UJ4A 5LT5A 5D3GA 4M5LA 3G8TA 3DHXA 4Q2LA 1KLMB 3CIMA 1NK6A 4ED8A 2MZ1A 1JLBA 2FUG9 2DYAA 2IA0A 1T05A 4B9MA 3HHKA 2BANA 2ZM6F 3GIMA 2FDNA 4K2JA 4M5MA 4WFNQ 2V2VA 5EUHA 2GQQA 3ADAC 4B9TA 2GMHA 5L1IA 2B9WA 3SXLA 4AQYJ 4ZLJA 2G2OA 2D3ZA 1TL7A 2M5YA 3IWLA 5KFUA 5AJ3J 1KTVA 2B4OA 4DL2A 1A9NB 4ZA1A 2H9ZA 1Y0HA 3M8YA 5JMNA 3KLHB 1M1KT 3G82B 1R0BG 2ZH7A 5BYSA 2O3DA 3QT6A 2ASJA 1RAAB 3IG1B 2JVOA 3DDNA 3ITHB 3T1AA 4E98A 2ADCA 1KS2A 4PG4A 4H54A 4CTAA 2Z2MA 3MCOA 2BQ3A 1ZH5A 4G3IA 1G2EA 2ACMA 5DJBA 2F9DA 1JLGB 2ZHBA 5CA5A 5D77A 2ERRA 5F8JA 3ILJA 2RDDA 3CJ0A 3HFZB 1VQOS 1HR0F 4U7UD 3C6UB 2F8MA 1HR0J 1R8BA 2PE8A 2QYGA 3NS6A 4F02A 3GV8B 3QJJA 3I0SB 2AX1A 4NLUA 3UVJB 1TMMA 4URGA 4IH5A 4R5PA 5D15A 2XS5A 2E66A 3T5HA 1FD2A 5GMDA 2UXBF 1UVLA 2MY7A 3IR5B 3IBWA 3BDPA 2J9CA 5CYQB 5GMKa 1S9FA 1WF0A 2OEKA 3TO8A 3J7Z5 3HP6A 3NXZA 2CDRB 1DBDA 1VR6A 1ZAVA 3IBFB 3HSZA 1MMNA 5J1EB 4ECRA 1PJ6A 1GAOA 4FVCA 4RBVA 4OZ2A 3MUVP 1RT4B 1EARA 3DOLB 4OZNA 2ALZA 2MKKA 1HNIA 3CTRA 3KJFB 3U1LA 3ZZOA 4TY8B 5F0UA 4ICLB 3WHIA 5D0GA 2C2DA 3N6MA 2CZVC 4RW7B 2YQ3A 2NS1B 1SUQA 2EFOA 2RQCA 2RJZA 1YGYA 3CJSA 3H5SA 3Q8UA 4DV3F 3GIRA 1ULRA 4B3SJ 3M9OB 2M88A 2FVPA 2DGVA 2FHJA 3SCKE 3JQJA 3W2WA 2DR7A 1VYAA 4O3SA 4LRFA 3V2UC 2CPDA 3K89A 2BOPA 1BWEA 2KXHA 4F25A 4LF6F 1LW2B 2IIHA 2BQUA 4PXCA 2WONA 2OAUA 3EM1A 3P45B 1YBAA 2V6AA 2UXCF 2IM2A 3BO4A 2ZD1B 1IXKA 2A10A 2JLEA 1EKRA 2RIJA 3FCHA 5D4LA 4O3OA 1ZPWX 3T41A 5DGBA 4ECVA 3BR9A 3QWPA 1DURA 1RA7A 3TJ8A 1IKWA 1HARA 2XB2D 3KG4A 5I3PA 2MLXA 1X5TA 2Z2LA 4BBYA 4DJBA 4DPTA 2RE1A 3T9NA 5B0CA 2KG0A 1RWKB 1I51B 1FVSA 5I42A 3BYPA 1YJ7A 1R6VA 1RT3A 1RT7A 3CUNA 3AFGA 4M8LA 5DGAA 4CDIA 5A76A 5HJXA 2IA6A 2B8QA 1LOUA 5KAKA 4NLVA 3J7YU 2QA2A 2B9XA 1R43A 3CD7A 5LSRA 1TKZB 2VBXA 3LP0B 2F65A 3GCXP 3ZZYA 2DHXA 3R3TA 1FJ7A 1NHVA 3DCAA 1H72C 4RU9A 3BQ2A 3V6JA 4MYTA 3POTB 4I4BA 4Y0FA 5CABA 2BE2A 1RT2B 5HQLA 2DGOA 3GZ7A 3NEKA 1A7GE 2DB1A 3V6HA 5H9EK 2RU3A 4C0BA 4ECUA 3OL9A 3ITHA 1LWEB 4I0WA 2ZH8A 1N4LA 1F60B 4M5GA 3TZZA 3M4XA 4DR4F 1Z1ZA 2RVJA 5HMYA 4DR4J 2MKYA 3AQOA 3IC1A 2X1AA 1WG4A 3NLCA 2Q6CA 4WP8A 8ATCB 1YJUA 1EKSA 4Y6IA 2ROGA 1NEEA 1KTQA 3E8OA 3LP2B 3J81j 1Y5LB 4CT9A 3QNWB 4RW9B 1K1SA 4WYWA 4EMDA 2JL9A 5T7LB 3W5XA 4MH8A 3MURP 4LF5F 2ZBCA 4J37A 1X5SA 2CNOB 4OZ3A 2BM1A 5EWFA 3BV8A 4TVAB 1IJFB 2R3VA 3S7RA 4PEOA 2WAQD 2W2PP 3NGDA 3PXGa 2QYCA 1L3UA 5EHHA 1X4CA 2CQ1A 1RT5B 2VPYB 5HAOA 3TQEA 4IQMA 1GXTA 2DRAA 4GO7X 4WP9A 3U1MA 1R7IA 3OTCA 2VOOA 2GJ2A 2GA7A 5HI7A 1OY6A 4JI5J 3CJ8A 3EUNA 4OYAA 3H2VE 4F0KA 2V63A 5E3PA 2C28A 3C2PA 2DITA 2IYGA 4C11B 3KHHA 2A2DA 3MF5A 3QT8A 4C0HA 3UR0A 4P2XA 3IN5A 2XTJP 4JI1J 3QZ8A 1GT8A 3W9IA 1Q7YT 4NMLA 2KH9A 1S0VA 3ILOA 2JLGA 3KHGA 1N56A 2J9EA 3D3CJ 3F56A 3OPKA 2KKHA 1TV6A 1YJRA 2CWKA 4LF4F 1N5SA 1KWMA 2LVWA 2R7QA 1U4BA 1DY3A 2JC0A 2NYIA 4O0NA 5DDOC 2HZAA 3IMQJ 3VV2B 3E51A 3C19A 4O4GB 3FDSA 3PO5A 1Q0NA 1KEKA 4GKJJ 4QWCA 5HP1B 2K8GA 5CCLA 2L9WA 4P71A 2G0JA 1KKHA 3DC2A 3A8KA 1ZA2B 4ZHRA 3TZWA 2WW4A 2PI5A 4RUBA 2ZWOA 4CLFA 1Y11A 4KFBB 4KPYA 3TARA 1QLNA 4TLRA 4B3TJ 1RLCL 2IMOA 1N32F 5CHCB 3N79A 1FNXH 2VIHA 4RPFA 3V81A 4RR5A 4CM2A 4UUXA 2DGSA 3DRSA 4ES2A 2E7WA 4O3NA 2LMIA 4ED3A 4DLEA 2DR5A 3Q8QB 4K4WA 4DR5F 4UW2A 3RBDA 3MMCA 1XTZA 2XEXA 1URRA 1W25A 2AYMA 2UUWA 3OHAA 3KLHA 3PG9A 4Z7YA 3G6YA 3V4IA 3VAFA 3NS7B 1B64A 3D5MA 4B3RJ 4WZMA 5IM0B 1RA6A 3EX7B 4FXWA 4DR3J 3D54A 4E2FB 3QIDA 3MR5A 3M9MB 1JB0C 4OV6A 3RAMA 4HTJA 2VJUA 5IXUA 3GP9A 4ZPVR 2DO4A 3TX0A 2HFOA 2PDAA 3PW2A 1HYSA 1BQMB 1N5VA 1F5BA 1N36J 2Y8WA 2LQBA 3G6XA 5L1KA 1S1VB 2DNNA 3PO4A 3MWBA 4JV0A 2XQCA 5F9NA 4YUDA 4DLGA 1RK8A 2DPIA 4RNMA 1J2VA 4DFJA 2MPUA 1OSDA 2DH9A 1OY8A 3FMWA 1WEZA 3TEGA 3OLAA 2AIRB 4Q5VA 3BQ1A 3BF4A 2PA3A 2XSJB 4WWSA 4A8XA 1U25A 2FB0A 4K4TA 5J1EA 1KHVA 1XIQA 5L1LA 3SDEB 4X4PA 2MEWA 1PILA 5J1NA 3RGIA 3M8ZA 3SCJE 4K4YA 1TELA 1F2GA 2FVRA 2AZ1A 2UUTA 4OYIA 3FVYA 2QSWA 4DL5A 2WW8A 1REVB 3KUGA 1D1UA 1H3DA 1GX5A 2DGXA 3DLHA 1UL3A 1Y5NB 4RW7A 5D4PA 2BR0A 3I4HX 2RQ4A 1EIYB 3GG0A 4ZLPA 5GAHU 2OPQA 3AA9A 4KGVB 2J7KA 1UFKA 3OUYA 5HMZA 3CCLS 1MWYA 2F9JA 3JAMY 1ZPVA 5AXMA 2W7PA 4LREA 1V3SA 3HVTB 1G3OA 1V3RA 4U67Q 2V5HG 1NK0A 4X65F 3HT3A 2VDIA 4F3QA 4DQSA 3ONQA 3MM8A 2IAJB 2QZ8A 5KFPA 2NZCA 1NZ8A 1HFEL 4C11A 4LF7F 3MOJB 1JJ2R 3KK1B 2LKZA 1SV5A 2AEFA 5DQIA 2V2QA 4RUCA 1CC7A 2GJIA 1S0MA 3IWNC 2H48B 1PKUA 2ALYB 3R7BB 1NMEB 1HNZJ 2QL7B 2V0NA 2CAJA 3FBFA 1Y9OA 1PJ5A 2M8HA 2WOMA 3SMZA 3C6UA 3K5LA 3J7AN 4AE5A 2MLYA 4LSNB 1J27A 2CPFA 3N0VA 3PEHA 1EHWA 4LRDA 4ZVPB 1S1WB 5T41A 1EETB 4QQBA 1ZZNA 1U6FA 4JI3J 1N33J 2OPPA 5DDRC 2HHHJ 3QRRA 2XLJA 1FE0A 1VBKA 2E9ZA 4ZVFA 1DJ0A 3HHDA 4MMOA 3HZGA 2MQOA 1U0HB 3W7BA 5HP1A 2W01A 3MMCB 3BREA 3VTIA 2W1BA 1U48A 2QL5B 2E1AA 3MEGB 3NP5A 4ID5B 2XLKA 2KJWA 1HD0A 2IFXA 3I6PA 3NCPA 2HQGA 2YX1A 4ID8A 3TVKA 4TU9A 4NXMF 3SEOA 3W8PA 4I7FB 3MMAB 3H98A 4IRDA 1MMLA 2DXFA 3I56S 2JHEA 2EFVA 1F1BB 1SQEA 2VICA 1R8AA 2WVEA 2FIUA 1ZA1B 2ZC3A 2CRLA 5HANA 5BJRA 2F8EX 3ISZA 4IO9Q 1Z2ZA 2DHAA 4RJVA 1HWIA 2HNYB 2I5JB 3KDNA 1RTIA 4UTGA 2XYHB 1NM2A 1HQEA 2C3PA 2LEAA 1OQ3A 1UFLA 3PEJA 3OVSA 8RUCA 1FVQA 1HI1A 1HW8A 1CJTB 1S9EB 1Q5YA 1JLEA 2CJAA 2VFRA 3M6VA 3PHTA 3OBIA 4WIQA 2JVRA 3HVRA 4DFKA 1FNMA 4ZJLA 1C4AA 1RCXB 3SCLE 5L46A 1QAJA 1SI9A 4K4SA 1IR1A 5CZXA 3R7NB 2LCWA 2ZD1A 3O1LA 4Y28C 1YLXA 3OL6A 4DS5A 3MMBA 4ILMA 4EWTA 5IWAJ 3PR4A 2K1RB 2G1HA 4WU3A 3VGVA 5A2QU 2JEGA 5DM6Q 2DNHA 4ILLA 2V8GA 1RWOB 3C66A 4RUHA 1YK9A 1CJKA 4OJ3A 1WTBA 3WBZA 5CH7B 3DYAB 4ER8A 1REVA 1HNZF 3MAAB 3QPIA 4FPRA 2JRSA 1KQGB 5A0YA 1Z2LA 5IQ6A 2VG7A 2JOQA 4ZPDA 3OR2B 5IZHA 3AJ2A 2DHGA 2WONB 4LF7J 2DH8A 2XYPB 1SH2A 1YRTA 1LWFA 2WB1D 3FZ2A 4IOBA 3SBMA 4DU7A 4MT1A 1U45A 4WXOA 4Z7CA 3DXBA 5HATA 2UUCJ 1DQAA 3AD8C 4NE9C 4ZVGA 2VQEJ 2R2RA 5HN0A 5KFOA 1LK5A 2EKYA 2W4PA 3GONA 1YSJA 1J5OB 2IM0A 2UVUA 1OYDA 2MQNA 4W90B 4ZS6A 2W9AA 4ZCIA 3UDEA 3JAMU 5CYQA 1HLWA 1T11A 1IKXB 1DTQB 1TP7A 1NSQA 3L3CA 1DQ9A 1PJ7A 4DV4F 2B5JB 1N5TA 2JX2A 1JKHB 1RWUA 4W4MA 1FF2A 1M1HA 2GGPB 2PO4A 2G2ZA 2BJ9A 3D7SB 4UOFA 5KFEA 5AJ3F 2HVDA 1VHIA 4OYWA 4GC7A 1RHUB 4NLRA 4ED2A 4FKXA 4LFBJ 3MZIA 5FJ4A 1RWNB 1UZHA 2B3TB 4ZPCA 9ATCB 4J9SA 3BSOA 2HG4A 3FKBA 1S1XA 4M5DB 2Z4PA 4RW4B 3M8SA 2UVVA 1QTMA 3NGSA 3DMJB 1LQ9A 2HIQA 4DQQA 4K4VA 2EBGA 2N7YA 2LXUA 4KQZA 2LXFA 5B08A 3V4IB 4C8NA 1FNOA 1LW0A 2B6AB 4DX7A 2HAIA 3K5OA 5IOLA 4ZCLA 2HHPA 3VCDA 2DHHA 2HQCA 3MEGA 3MEEB 4ID5A 2OPSB 3HXMA 4YB7A 3CJ5A 4X84A 4IOCQ 2P8IA 4DPYA 5EWGA 2HHUA 1QSLA 1OSCA 2QL9B 4NCBA 1Y10A 1NUEA 4JI1F 3NCRA 1QAXA 3QYYA 5H9EJ 2X1BA 1N0VC 2K7JA 4HVZA 3M8RA 2DRDA 4F4YA 1NB7A 3D28A 3NOGA 2PMZD 3BEGB 2KZZA 3T3FA 2V4JA 3HDSA 5HVGA 2RKIB 3CCES 2CYYA 1RDRA 2N4CA 1X9WA 3GFZA 3MGJA 3QAUA 1RTIB 1V5VA 1VLOA 1S72S 2UUAF 4RLEA 2IYIA 4Y2MA 5LXRA 1Q7LB 1SH0A 3QWUA 3QGGA 5D4NA 2HHQA 5DG8A 1NCLA 4NL5A 3M8PA 1IBMF 1KSPA 1PIEA 2HLUA 1Q82T 4RKUC 1Q8BA 1R27B 1RT6A 4OYZA 4ZVTB 3RB0A 3D6FB 1TL1A 4PXDA 3UCUP 1FWPA 2FHJD 3MEDA 3TUJC 3HI9A 3Q89A 3M6XA 3MPYA 1TL4A 2BKNA 4NZ0A 5ETVA 3UDVA 3ZTSA 4DV0F 1LKZA 4FS2A 4I6WA 3KLVA 5J2QA 4PUOA 1F9HA 2QFJA 1MG7A 4KGXB 3CSKA 4G6VB 1FEEA 1RWPB 1U6ZA 5C5JA 2XCAA 4EEYA 1R8CA 2UVRA 1NK4A 1F0XA 4J9QA 4PAAA 1RACB 2OMLA 1JLEB 4WTOB 4X4RA 1TKXB 2OPQB 2QLFB 2Y9HA 1TR0A 1VJQA 1ZAXA 1SCJB 2P9GA 4LSLB 3M2VB 5KFKA 3SIPB 1JLFB 1FEHA 1ACMB 2JFKA 2YPYA 4UF4A 4YN3B 1UPPA 3EDQB 5C2GA 1RT1B 2EFQA 3W63A 1G4CA 3C3LA 4J5OA 1NSKL 1B4SA 2PC6A 3DYAA 4GVLA 5ETTA 2MZSA 3A4TA 3W5ZA 4YR2A 3GV7B 2H5JB 4PCQA 1TZ0A 4RW6B 5I4MA 5MAOA 2VG7B 3MD1A 2APOA 4AXIA 2XMWA 3MM7A 2FJDB 1VJWA 2NREA 5DQGA 1AW0A 3FJ2A 1XMQJ 2KRBA 5EX3A 4OLOA 3PX6A 2O5DA 1B0TA 1S59A 3BBBA 4DV5F 2XS7A 4M5IA 1H2UX 3NRBA 4KHRA 3BGRB 3SQOP 3TA2A 1VFJA 4CLUA 4ED0A 1Q86T 4M5KA 3IS9A 3GR0A 2R2SA 4IUFA 1XMQF 1NRKA 4KYZA 4HACB 2XMUA 1HKAA 4U7UK 1KVIA 2LEPA 4CLLA 1FRLA 2VFUA 3QSIA 3RR7A 1UVMA 2M52A 4MIBA 5K8MA 1X5OA 2YWKA 1U6BA 1Q8LA 2XSJA 1XQIA 3HHLD 3RBZA 4DSFA 2UP1A 4ZPBA 4YS2A 1U1PA 2K7KA 3MD3A 1YHQS 3EGVA 2R2UA 4LF5J 2CJBA 1MMDA 3PJWA 1JXEA 3AJ1A 3BR8A 3I31A 2WZ1A 4O3PA 3DDIA 3MPWA 3QIPA 2GHVC 1WORA 4NA3A 5C42A 3OVAA 1WC3A 1RT3B 1RT7B 1S79A 3WZ0A 4FXDA 5KT3A 4LQ9A 4HHHA 4Y2AA 2W9BB 2Y1JA 4DR6J 2UVWA 4NLGA 2RKIA 1BGXT 2I0XA 1FRHA 5U47A 3UN2A 3CDBA 1A0OB 2DCLA 3MFHA 3LP0A 2VU5A 4ZP9A 1RHKB 3CMQA 3Q22A 4DV3J 3CJKB 2X3DA 3M8QB 4C0OC 2ZZNA 2AHOB 4A8OA 2IRUA 2VUGA 3UD3P 4LVNP 3V81B 3THVA 1RTDA 3N01A 1PAUB 1HBOB 4DPXA 2GVDB 2ZC4A 4XPEA 1R8HA 3IR6B 3TOQA 1PYOB 4NI2A 3ZO7A 1HBMA 2ZBPA 4LR8A 4B9SA 4C8LA 3MPVA 3EVWA 3KFWX 2ZEJA 1B99A 2NXUA 2V2ZA 2V67A 4URQU 3MM9A 5L39A 1S77D 3ULHA 1NLKL 2RS2A 2MTLA 4NLPA 3PIPQ 4L76A 3VZIA 4EYHB 1HQUB 1FTRA 4OZ1A 3H4BA 2XY6A 2ASDA 4LFCF 1JJHA 4JV5F 5A2QY 2AZ3A 1GMWA 2FHOB 2AJFE 4WK1A 3VGTA 5IT4A 4ECYA 2UXDJ 2Y1RI 4DR2F 3RAQA 2X51A 1JWWA 4IO1A 1NKCA 1P9YA 5KFSA 3LP1A 4FNHA 3ZZZA 3U02A 4ZK7M 2YX7A 4LF2A 3AT1B 3KK1A 4Q45A 4OZ0A 1H98A 2J6UA 4F0MA 4ANDA 4ZN3A 2DNPA 2W7OA 5J2QB 4PUOB 3D1HA 5M2UA 1X9SA 1FKPA 1RAOA 2R7XA 4TU7A 2MDAA 2ZWPA 4QIEA 3U1NA 1GX6A 3MHYA 4O3RA 1MWZA 1SVDA 2DK2A 1IM4A 2CJXB 4PG7A 4S0MA 4TY8A 5KFWA 5GAHI 1BQNB 2AEMA 2CVIA 3KHLA 4JI8J 2MZJA 4OYPA 2NLWA 4ED4A 5I3UB 1TKTA 2K3IA 2AEJA 2FC9A 3PJ9A 1PYTA 3D1QA 1DRZA 1RUSA 3BKUA 1S6QA 5ETLA 4C6AA 1L3VA 3KLGA 1HQEB 4CLKA 1O51A 2FYXA 2VKRA 4OIXA 2X1GA 5BYQA 3H42A 3NMRA 3OJSA 2YNFB 1RKJA 2ZNZA 5ITHA 3R7SB 2R2TA 2FZKB 3VAIA 2R8JA 3HD2A 1P9QC 2KYXA 3DOMB 2QV6A 2V8HA 2IBOA 4CQ1A 3E01B 1C1BB 2YNIA 5E5NA 4EBCA 3CCZA 2BE2B 3JSMA 3M1VA 1PBUA 1TQLA 3UW1A 3Q8RB 1VQYA 3W3SA 1S7HA 2N82B 4HHJA 3BM7A 2ZJQQ 2I5JA 1VGYA 4K5SA 3HD1A 3TX8A 3FQLA 3QIPB 1L3TA 3LA0A 1VQ7S 1N36F 1VBZA 3RRKA 2E5HA 3VAKA 3CD0A 1FDNA 1T9VA 1WEXA 1WI6A 3LO3A 4WFYA 3IS9B 1JLQA 1YBTA 3CCSS 2QFIA 3Q86A 1N5YB 1F5AA 2GO9A 1WOSA 1X31C 2IHR1 1X4FA 2MKJA 2B9YA 4CH7A 4DMZA 1X8DA 1WKKA 4DN0A 4NASA 2QLXA 3HVTA 3DU5A 2DNGA 4KV8B 3M8QA 4MK8A 4DL6A 2DR8A 4J9UE 1WHXA 1AUSL 2E1PA 1WJ9A 2E5LJ 2KT5A 2L48A 1QAYA 2YWHA 1YKWA 3IAS9 2HNZB 4YY3F 3LPEA 2XO6A 3MAQA 2VODA 3I0RA 5H9FK 4AQYF 3JTPA 1KFDA 3ZNJ1 3J80U 1LWEA 1RSCA 3LF0A 1RAGB 2ZKUA 1XC9A 4ZIVA 1U1LA 4LR7A 5KFMA 2MSSA 3BGFA 2HKEA 4WE1A 3GQCA 3GV5B 3KJQB 1WTFA 2XYGB 1X0FA 3IRXA 4KY3A 1IKVB 2ZE2A 4P2FA 2HFVA 4ANCA 3L7PA 1UKUA 4B3RF 2WOMB 3ET6B 1PO6A 1FFGB 5GVQA 5E41A 2H5EA 2G1DA 5KT4A 1NK5A 4R25A 3RJMB 5L8RC 2WSFC 1S48A 1QM9A 2BANB 1TKXA 2HK3A 1UAWA 2OEJA 2X7IA 4ITSA 3M32B 2AU0A 1NJIT 1J5EF 1QJHA 2AYBA 1MLAA 3BBFA 2E9RX 3G6VA 1NK8A 2NSBA 1RYRA 1I5OB 2KZMA 3TA1A 1QAIA 3HX9A 2PD1A 2R8KA 2MZTA 3G6ES 2V8PA 3W64A 3KLFA 2MQ8A 3ZFVA 1YX2A 4RW8A 4RWXA 3O8WA 4B9LA 4F3MA 5KG5A 2GAHC 3QO9B 4Y2CA 4LBPA 3D0HE 2RDJA 2DGTA 4U7CA 2MKIA 4DUZF 3LAKA 2JFDA 6FD1A 3VQTA 4RW6A 4NOHA 2CQ4A 3ZXWA 4IOAQ 2DNRA 3HM9A 4HKQA 3C14A 1ZM2A 3KK3B 2MY8A 4L75A 2LLZA 3BJYA 2LYVA 1RXOB 2RB7A 3GCWP 2IVFB 2IMWP 3DLBA 2JJ4D 3PW4A 3I5AA 1BUXA 2A0FB 4F4AA 4YHHF 3HHEA 4U95A 3C15B 3HT0A 2QN6B 3PYEA 3SI8A 2E9TA 2ZDOA 3HK2A 2AJQA 3QRQA 4L6V3 1KDNA 1C1CA 3PYGA 4B9UA 4OYXA 3BGLA 3I9V9 3VHQA 4CO4A 1O5JA 2OELA 2I8EA 1FRJA 1TUGB 3EVOA 2HGLA 2B56A 2ZVSA 4J9VA 4AL6A 4P73A 4KIAA 2R9LA 2CQDA 1VISA 1LWFB 2ZOFA 3DOMA 3PDNA 4NA1A 4CH1A 2N4DA 4A8QA 2BZ2A 4EBEA 3RW6A 4YB6A 3M2RB 1MNEA 1SC3B 3CWJA 3HULA 5HMXA 2DNKA 1WWHA 2DEJA 2MZQA 3THPA 1UWBA 2DNYA 4ZDNA 3I96A 3NWRA 2HWIA 2KO1A 5HLFA 5KOWA 3A8JA 3KJVA 1S97A 1OS5A 2H54B 2EG1A 2IVYA 4KSEB 4I6AA 1KQFB 3G96A 2B43A 4IKAA 5KFZA 1D0EA 4D3HA 2HMIB 2YXLA 2W9BA 2GNKA 2PEBA 3TR5A 4URSA 1Q16B 1YIJS 5F8GA 4X4OA 1B0PA 1UVNA 5HVFA 4RL1A 4QOTA 4CH0S 2B7CB 4ZJOA 3TAMA 1QUVA 1N6QA 3UPFA 2PSZA 3PFOA 2CFXA 3VQSA 3BDEA 2OH2A 5DS7A 3DGPB 3TAPA 2QIFA 2XMAA 3W2WB 2EXUA 3TUIC 2DISA 1D3WA 4CM0A 2OSQA 2LECA 1CULB 4F4WA 1RISA 1M1GA 3R6LB 3PVXA 4Q8FA 4BLGA 4DL0C 3I87A 4V19X 2GMLA 4TYBA 1JLBB 3MMJA 1T05B 1TVRA 3FBEA 4TNOA 4KHMA 5CD4A 3VAMA 1VIXA 3OL7A 3NS5A 3J7A1 1FRKA 4K2XA 2E7XA 1U49A 2VQFJ 2NR0A 1WC5A 2C3YA 3DXSX 1F3VA 4R0EA 4DV5J 2LA4A 4WTYA 2KTQA 1IKWB 4ES3A 1S7IA 1CBKA 5B0AA 3OJUA 3T1HF 5ETPA 3QGPA 1V5IB 4OZLA 4DZDA 2V50A 4ECWA 1BC6A 1N0UA 3GSIA 2EFNA 1B0VA 2KJVA 3R5DA 3T19A 3MUTP 3Q2SC 4FF4A 4H4OB 1NH8A 5F0WA 5J2MB 3J7ZT 5HQMA 1RT1A 2ATCB 3RBEA 4JI0F 2GX8A 3HSJA 3KNAA 4QW9A 1HBUB 4DPWA 2DD8S 4DV1J 1XK8A 1KFSA 2J0QD 3P5TL 4P75A 1I6JA 4B3SF 1JX4A 1TUVA 3AY0A 2CQPA 5KFCA 1NPKA 1UWAA 2KXNB 4DQPA 4Q43A 1D9AA 2VG6B 5FLXY 3CC2S 5DM7Q 1ZOTA 2VKZG 2BKOA 2HBYB 2MHEA 2VPXB 2XULA 3QLHB 1QY7A 3QT5A 4J9OA 1F9FA 1RWWB 1ZBTA 2ROEA 1CJKB 2DGWA 2KL8A 2MLZA 2QC3A 3DLKB 3IXQA 4UUWA 4MJKA 4OYBA 1WSVA 4YMEA 4DFMA 4G1QA 3V5RA 3OVBA 4NZ7A 1KD1T 4GKKF 3B54A 4ELTA 4PWDA 1K44A 3MCMA 3D3BJ 2KFZA 1S6PA 3JS9A 3DGVA 4Q44A 2CVEA 4JI2F 2YPZA 1HNWJ 2V9WA 1RU1A 1MROA 1TL5A 3T1YJ 1X7VA 2KHDA 4A46A 2FVSA 1SIZA 2A3JA 1RBOB 4X4UA 4LFCJ 1AROP 1HW9A 4LQ3A 4P6QA 2OD4A 2IVMA 4N41A 1BQXA 3M2VA 2D3UA 2QLWA 1NDCA 3MTKA 5HROB 1FE4A 5ETMA 3KDOA 2G4BA 1KP6A 1C0UA 4WXWA 3MM5B 3AJDA 3JB9k 1APSA 1HI8A 4N77A 2XHWA 4A8WA 3AD9C 1OPIA 2WB4A 3GU0A 4N8NA 3MMAA 4GMKA 4F0HA 4DUZJ 3EZUA 1OIAA 5HL7Q 4OHYA 1EETA 3G2XA 4RO0A 1CPZA 1LXNA 4F50A 2RRAA 2M2BA 4IG0A 3A3OB 3HZEA 4ERDA 1CJVB 1SC1B 3ENVA 1JLCA 3PV8A 3A3NB 7FD1A 1F5CA 2YWGA 1U0HA 4Y65A 4ZMMA 3HJFA 2MQMA 3HO1A 3BH7B 1X5PA 2Z2YB 4MFBB 1BXNA 3W66A 2AMCB 1PC4A 1FDDA 2KT3A 4YDDB 4Y2IA 3QSYB 3QAEA 2RUGA 1FDAA 2CQIA 2C2OB 1S1UB 3DLGA 4HHUA 4UZBA 3V6DA 4M63A 3SSQA 2K3KA 5EGYA 3P6YC 2CG4A 5ETKA 3D6HB 3WDOA 5BR8J 2F63A 5J2PB 3N28A 3WIUA 3ET6A 4J9NA 3UCZP 3K58A 5IC4B 4KJIA 1DARA 3LGNA 4PRFA 1O8BA 3TAQA 1CS4A 1F3FA 2PEHA 4OV1A 4C48A 1L3SA 3RRGA 3ZTOA 1XR5A 2CPHA 4PWUA 5A8RA 3R6GB 2AWZA 2O01C 2OPRB 1REGX 2DNOA 5H1SV 2HEKA 3PFEA 1HNVA 4K5RA 5HJYA 3BSNA 4AD6A 3C6TA 1FXLA 4QPTA 2VG5A 3KG1A 4ZP6A 1WG5A 2NXNA 5F8IA 2W9CB 2P9CA 4BDPA 1AYEA 3MEDB 2UU9F 3DI6B 1B70B 1U1OA 4K4XA 1I1GA 4NEYA 2RD5C 2VZ9A 3IGNA 4J90A 1A6LA 4KO0A 4F04B 1VBXA 3RYLA 4LBHA 1F9EB 3CDEA 1SPBP 2HS0A 4O44B 4QBUA 1NH7A 4HT5A 5DLGA 4HEA9 3CO0P 2UU9J 1RU2A 2UXBJ 3OT9A 4H4OA 5J2MA 3FBCA 4OYOA 4P74A 3OD2A 1S6PB 4IH7A 1S99A 1WDTA 3NBPA 4CNYA 3UQSA 2XM3A 3OTOF 3JQMA 4TQSA 3FSXA 5B7WA 1PBAA 2XY7A 3HHNB 4JI7J 3O5TB 3LGMA 2P6SA 4WPAA 2C22A 4KT0C 4RX6A 1JNRB 4PWWA 1C1BA 4QU7A 4NYPA 3RRHA 4LRAA 1X4HA 2ZH3A 1HI0P 4GVBA 1YBUA 2HQ3A 1NDPA 1GTHA 3LTOA 3SFGA 4A8MP 5EX0A 1UMJA 1FXRA 2BXJA 2ZH5A 5KFIA 3IG1A 3FGVA 4HYKA 2ZH4A 1OYEA 3FCWA 2V34A 5M2RA 3VWSA 1RADB 5GAEI 1J5EJ 4CTAB 1PAEX 3NNHA 4DR6F 4B17A 2OFHX 1WACA 3G8SA 1NKEA 1Y5IB 2VBWA 3IA0A 3KK2B 2IC3A 2CQ2A 1N5YA 5E3AA 4C8KA 2FVCA 3CD5A 2M70A 1QD1A 1EX8A 1FX2A 4JI4J 1KNZA 2XWYA 4CO5A 1XN9A 3M6WA 2J76E 2O66A 4USHA 5DG9A 2OJ3A 2ZZMA 3KG0A 2ZH1A 5CYMA 5KFQA 4B9NA 4O0IA 4FF1A 1IR2A 1HHQA 3BS9A 3MCNA 2M0GB 2XG8A 4PQAA 1UJ5A 4IYQA 4GKKJ 1WHVA 2J7UA 4EYIB 3TI0A 2BBEA 3VR1A 1EP4A 3ILLA 4NLQA 2FJWA 3KMQA 4XDCA 2W8KA 1XNRF 3P49B 5C24A 3HSGA 3R1HA 5HROA 1RTZA 1T9XA 2KXFA 1HMVA 1GMWD 2IDLA 3PRDA 3MEEA 4ALZA 3Q83A 1RAJA 4M5HA 3AD7C 2QA1A 3FRYA 1DTTB 1IKYB 4WFAQ 2W2QP 5C42B 4LFAF 4P2MA 3NMAA 1RE1B 4LFAJ 5CQGA 5J1PA 1SJ3P 3UR3C 5IT9U 3EPGA 1X60A 2A1BA 1TL3A 3NGKA 5E33A 1MW7A 3KLIB 3S1TA 2AJ0A 1URNA 1EAYC 1KLMA 4DHVA 2CZ9A 4LR9A 2R7RA 5DETA 3SV4A 4PXEA 1R89A 3K57A 4CYUA 2N3LA 1RYSA 4JI6F 2OPRA 4ZLLA 2F4VF 3KTQA 5LJ3Y 3RU0A 1LW2A 4YQWA 4YR0A 1Q8IA 5AXKA 3D1OA 5BXIA 3R5BA 3KXDA 5G0RA 5A8WA 1R6YA 3C8YA 1H0HB 4ICLA 3K2YA 2Y0BB 1G6BA 2VJVA 1QUPA 1ZAWA 2YNIB 2B7BB 1KONA 1IBKF 1IBKJ 3C14B 3KK3A 1T9TA 5DDQC 3SSSA 4WP3A 4ZPWR 1RHRB 2AYEA 1H7WA 2DIVA 2GHPA 3BN4A 5KFHA 1VQMS 4ZKAA 2HBZB 2JZ5A 4M5NA 3K5NA 2B4UA 3D6TB 4JUZA 3G8QA 4HR2A 4F2RA 2V4RA 3NG8A 5E2QA 2VA3A 3TRGA 3PRBA 1PCAA 4DZ6A 1NPPA 1U24A 2GS8A 2U1AA 3KKFA 3PR5B 5LMUJ 1FTCA 4LSLA 2AYGA 2R7TA 2BW7A 1V3ZA 3BYRA 3HF5A 2CNLB 3TJ9A 2AGOA 1YJ9S 3UCGA 3TAMB 1HBNB 4BHQA 4KV8A 1S6UA 4DU8A 1QE1B 3GMGA 2A18A 4CO1A 2OGUA 3H8YA 4MKBA 4DOZA 4EUVA 4JV1A 1QSYA 2ILYA 3KHRA 4LF8F 3QMQA 3HKWA 3CCWA 2RQKA 5HSPA 1JJCB 3I55S 2AJ2A 2M9KA 3IO1A 4ZP7A 1N33F 2HHVA 3CJQA 3H5XA 5FIIA 1IQZA 4MK7A 4MIWA 5GAEU 5B0EA 2H4WB 3GFYA 4HI2A 2HS4A 1FKOB 4C3MA 2UXDF 2HW3A 3ZZPA 4LF9F 4IG3B 2X1FA 2FJAB 1IJEB 4N7TA 2CZ4A 4QWDA 3OSPA 2OMOA 2DY1A 3JTNA 4XK8C 1VQ8S 1RT4A 3DOLA 1WOPA 4K4UA 1Q53A 3AOAA 4QWBA 3VGSA 3H20A 1JXVA 1YJVA 1VK8A 3FFIA 1QVFR 1HWKA 1E6YB 2YKNA 1JLCB 2NPIA 3SQGA 5DZ6A 5KFJA 3EGNA 3D66A 5ETQA 5THWA 2YNFA 1FRMA 2RSQA 5LMNJ 4EGLA 4E0DA 1RWVB 2DR9A 4LT6A 5F8NA 3C15A 3N9UC 1VRQC 1YRUA 4E8UA 1IR0A 2COLA 4QIGA 1FJCA 2HFUA 1OO0B 1KRPA 3FZBA 4NCGB 4CLZA 4ECQA 3GFXA 4CRJA 3OL8A 3W5YA 4P52A 2Y0SD 3C16A 2XMJA 1LV5A 4CCHA 3MR7A 3UDLA 5EN1A 2AJ4A 5FDLB 1S1WA 1VQ5S 2V69A 1RABB 3ENWA 3HHLA 1KVKA 1OY9A 1Y7PA 2EVZA 1NSPA 4FF2A 2G0CA 3PNIA 2OTLS 5K8NA 5AE1A 2CJQA 1XR6A 1DAXA 1NXIA 1X4EA 2VL1A 3OTBA 2KDOA 4MKAA 1AFJA 4TKTA 2VONA 4JI3F 1NO8A 2LDYA 2VC0A 3W9JA 3JQKA 4H4MA 1RB0A 1S1XB 4RW4A 5LOQA 1S76D 4NCAA 4JI0J 3QLHA 2NSCA 1TKZA 2XO7A 1FFWB 1RAHB 2W2OP 4C4WA 2MZRA 3IP0A 1M5KC 3DLKA 1WHWA 1RHMB 2FGOA 2OO4A 3M2RA 4CLWA 5JVHQ 4W92B 3NAHA 3TEHB 1W7WA 2FJBB 2Y1LB 2YQ0A 1T7PA 2Q43A 2BW2A 4KHPF 3NAIA 3MM9B 2B8PA 2OKQA 5I42B 4F4ZA 3LH2S 1TKDA 4BWJA 1FRIA 1YQHA 4WFBQ 1N54B 5FD1A 4RBUA 4WFZA 4YP3A 2HQDA 2FLNA 3DRRA 3ICLA 3ZTQA 2DO0A 3UE2A 3R9LA 1P1LA 4CYUB 1GEHA 2CPEA 2XHCA 3UVJA 3AA8A 3F73A 2E44A 2XMTA 2WVFA 4FZVA 4LF1A 3A8EA 5I3UA 2XBPA 3R27A 4XAKA 1HPZA 2ZJPQ 2YWFA 1YJWS 1QE1A 2BX6A 1HWUA 2DEIA 4OHWA 5HBMA 3KWMA 3GILA 5F41A 3J7YI 4DR3F 4V19J 3RB4A 3M8PB 2RU9A 4IFYA 2W4DA 4DX5A 1U09A 2CUYA 2BMBA 2PFDA 1GQEA 1FWLA 1TL1B 1UEUA 3TVYA 3V6DB 4WKRA 3I0SA 2MQLA 2VH7A 4HDHA 2E1MC 2NXEA 3T9ZA 3VALA 4YOEA 1FK9B 1SQGA 1CJVA 2XI2A 3JSMB 1S1TB 5C25A 4QYRA 4X4TA 3OW2R 2KFNA 1SH3A 1S4FA 4C8OA 4X4SA 1TK0A 2GVZB 3H59A 1P1TA 3NY0A 2CA9A 5CYMB 1HNXF 1HNXJ 4Q0BA 5C7PA 5FLXU 2KU7A 1C1CB 3EGWB 5L9XA 3DOKB 2WBRA 2ZJRQ 5AXNA 1T8EA 3CCTA 1RTHB 1IBLF 2HZCA 2MMYA 4OLPA 4K0KJ 3SCIE 1S1UA 2XZDB 3CJ3A 3G86A 3D0GE 3SYZA 1IBMJ 2YWWA 2VF3A 5KFAA 2YH1A 2ZNYA 2QEXS 4OJ1A 1T3NA 2FQQB 2D74B 1BQMA 3CCQS 4KO0B 4KHPJ 3OXLA 2VQFF 3IFEA 3CMAS 3B82A 5HLFB 1UA0A 1TFWA 4HH0A 3EE3A 1VBYA 1QVGR 5IFMA 3AODA 2L9DA 5SUHA 2WHOA 2BKPA 2IJNA 3M05A 4HDGA 3UNYA 4RNOA 4FPIA 1TAQA 3MUMP 1VDHA 2LQJA 2D7SA 3HVWA 2UUAJ 1K73T 2R8IA 2KVQE 3MM5A 4ZHRB 3D68A 3FSIA 1XERA 3AB4B 4JI8F 2GQ2A 3CT9A 1XR7A 1KR4A 4I2PB 4PXBA 4ZLNA 1H38A 2FLPA 4A8YA 2JEFA 2D9OA 2HBQB 1YZ6A 4K4ZA 4ZOSA 3VVUA 4KC5A 1IWAA 2CPJA 3A3PB 3GJQB 2EFGA 2RAQA 2IM3A 2XMMA 2POKA 3DRSB 3GJRB 5E3QA 4F8RA 4NZ6A 3MM8B 5B0GA 5KG6A 2VPZB 3OFEA 1CSJA 2BA9A 2BDPA 2Z0GA 1FKAF 1CG2A 2J7WA 4RUAA 3QJLA 4DV2J 1C0TB 1NJYA 1EQMA 2FGCA 3NBPB 3FEZA 3L9ZA 3W1YC 4OX7A 4F4KA 3QO9A 2RT3A 4ZVEA 3LUYA 3DLEA 4RW9A 4ZVQB 3PRVA 1EJ7L 3TVZA 3VGUA 5HVHA 3MR2A 1SKRA 4F2SA 3M2UB 4DCPB 4EU0A 3CPWR 2JLFA 2VFVA 4DV2F 1Q95G 4A4JA 2W2MP 5KFXA 3EVMA 3M32A 3JYTB 3GE9A 5MLCV 4AL7A 4UT4A 1SIWB 2NXCA 3N6NA 2DPJA 2UUCF 1HBNA 1FXDA 1S49A 2HRTA 3ILIA 3OR1B 5K8PA 4CLYA 4TXSA 3CCUS 4OI4A 3TANA 2ATLA 4JV5J 4X62F 4QW8A 4PR6A 1WF2A 1RBAA 4LBIA 5LSOA 2E5GA 2GCFA 5LJ5Y 3CE8A 4CNZA 1SB6A 3G87A 3EGZA 1JQGA 1HNIB 4RWWA 1BY9A 2ASYA 2RQMA 3TW0A 2J8AA 1VQKS 1VOMA 2HFZA 3BO2A 2Z8QA 1JMTA 3D2WA 1NDKA 2GVZA 4USMA 5DO2A 4BCAA 1QSSA 1S4EA 5C2CA 1Q5VA 1HMVB 4DF8A 2DJWA 2HHTA 2AF6A 2OD6A 3T6JA 4FVMA 3B6BA 2GQCA 2WRMA 2I2YA 2OLWA 1Y3JA 4L73A 1H7XA 3I9ZA 3MECB 1DTTA 2ZITA 3NOCA 2D3O1 1NSAA 1U7LA 3IR7B 5B09A 1XWLA 1VCTA 2FVQA 2HYIB 4USJC 2BJDA 1H6KX 2HPUA 1RAIB 3POTA 2K1RA 4GC6A 4U8VA 2JEJA 1RT2A 1NK9A 3EICA 1U26A 2C3MA 4MIAA 1RLDA
chains in the Genus database with same CATH topology
2EI5A 2DTJA 3X3UA 3Q0AA 4DL3A 1ZM9A 3DRYA 5BR8F 3F41A 1UEVA 3LW5C 3MDFA 4B9SA 4OI0A 5FDLA 4MTPA 2ZFHA 2PT0A 4I67A 4EBDA 3RB6A 2HGMA 1HL6A 4ECXA 1O0PA 2KN4A 4KBIA 2R8HA 1VLYA 4ATNA 2DVIA 2JDJA 1ZTWA 1FJGF 5KG1A 1VMBA 4I2QB 4AFFA 4ETZA 3UWTA 2DHSA 1S6QB 3I32A 4DSJA 5KFDA 4QIFA 2MKSA 3BSAA 3V6KA 3LAMA 4OI3A 3UNGC 4FYDA 1RT5A 1NZAA 4HL9A 1DTQA 1IKXA 1SJ1A 4WK3A 1T02A 1SV5B 4KB7A 3CEDA 1OPZA 3OXFA 2O67A 1C0TA 4JI7F 2VG6A 2J6SA 2IBKA 3NNAA 5L38A 4IG3A 3OTEA 1Z4UA 4TLQA 2AJ1A 4ED7A 3Q2TC 1B7FA 5T7LA 1Q79A 2E1RA 2O1PA 2UZAA 1ZYQA 2FC8A 2SXLA 5DRKA 3GYXB 2NQPA 1PC5A 2L3MA 2HHXA 1JLAB 3ZZ0A 4RNHA 1G1XA 3C6TB 5L1JA 4BC7A 2QA4S 4QR1A 3VAJA 4NXNF 1RTJB 2G9OA 1UA1A 4HI1A 5K14A 4KR0B 3CJ2A 2HLTA 4LIRA 1MU2A 3RTVA 3OSNA 1Q78A 1VC6A 5GAGI 3L7OA 2XLIA 2HVHA 2MJUA 3G9CA 1ELOA 3H25A 4IDKA 2E29A 3VAHA 1NNDA 3IAM9 4D3GA 3QGHA 2QA4G 1M90T 3GIIA 4MAKA 1R31A 1XNQF 5LMNF 3HLUA 2CQCA 2F40A 4UQTA 6FDRA 3MMBB 3LANA 2BM0A 2J9DA 3HKZD 4YB1P 2CPZA 1G7CB 2MHNA 3R5AA 1NJXA 3CCJS 2Y1IA 2GO8A 1S10A 3KK2A 4GKJF 4Y34A 3PX0A 2AP6A 4IRKA 5CZVA 4C98A 2ZHAA 3K0JA 2UUBF 5F3TA 1JK9B 3GYNA 2I38A 2YNHB 2MQPA 4OI1A 2MJNA 4DWIA 1U1RA 2C2EA 3LWMA 3DNCA 3MEKA 4FN5A 4WCEQ 2XC9A 4WF9Q 4IH6A 4I69A 1OWXA 3K5MA 5KFTA 3CIZA 2EFPA 4G1PA 3H40A 2QE5A 2EC0A 1HHSA 3JSBA 3ISNC 2HNDA 3N5BA 1KLNA 1J5OA 2VA2A 2ZOMA 3AAWB 4JI4F 4OL8A 4N5SA 1HNVB 3US5A 3T6BA 1SL0A 1GXUA 2B6AA 2J0WA 4LVOP 4N47A 2NZ4A 3DM2A 2ZHOA 3M9NB 4DUYF 1Y3KA 1FT8A 4A48A 4DL7A 4MKYA 1LWCA 3H5YA 1L3KA 2FD2A 2MKCA 3O2IA 3KLIA 4IRCA 4UY85 2FJVA 3HMJG 1HPZB 5E3RA 1JLFA 4QWAA 3Q8PB 1T3OA 3HHLB 3VAGA 5K8OA 5LXYA 1VRUB 4OHXA 4C97A 3EXCX 1YI2S 4B3OB 1V9OA 2GIRA 3LWLA 3NWGA 4OZ5A 3TP2A 4ILRA 4QWEA 4AUKA 2XMVA 1HA1A 3LOUA 4CO0A 1X4GA 1RTJA 4I6YA 4B02A 4FXVA 3G71S 5F9LA 2E5IA 1K8AT 1H2TZ 4NLYA 3PJXA 5KFVA 2CPYA 1X4AA 2ZDPA 4CT8A 2P6TA 4ZCMA 3PIOQ 4NLDA 2F8HA 5G4DA 4M94A 1JIHA 1UVJA 2CPXA 1M5SA 4YR3A 1ZTTA 3E3XA 1XMBA 3OFFA 1ZETA 4I2PA 1CEZA 2AGQA 2J0SD 3GB0A 4L3NA 2MYFA 4FP9A 1WELA 3JSYA 2GC8A 1JJ4A 2VASA 3T5JA 4DR7F 4QU6A 1HBOA 2DNQA 3N4WA 3SFUA 2MGZA 3CF5Q 2HGNA 4F4XA 2L9NA 2HWTA 1X4DA 1FKOA 2F7VA 2FJEB 3CDWA 1SKSA 1JKHA 1Y00A 5T14A 2HHSA 1IKYA 3EZ5A 3DN9A 1LXJA 1DLOA 4OHZA 1X0PA 4B9VA 1WEYA 3K7RA 3I5CA 2FTRA 1RGVA 2OPPB 4G1QB 4QJVA 3GIJA 4K50A 3J80Y 4M1KA 4PWDB 5A6WA 5JUMA 1NJWA 3VZHA 2DGUA 3CGIA 3FNNA 2HRUA 4DSIA 1KVJA 4DQIA 2XMKA 4B3TF 1TV6B 3NCQA 5D4NA 4N8OA 2BUNA 1RP5A 4HH1A 2LQ5A 2FHMA 2GGPA 5IQQA 2QMXA 2AQ4A 2RDIA 1DHMA 2XSFA 4H4KC 2BACA 4KKOB 2J5AA 4O4GA 2DBBA 2QO3A 5DQHA 5CYJA 3JTOA 3GV8B 1SL2A 2RRNA 3U27A 3MM6B 1WD6A 2R7UA 4J9RA 4JV2A 1DZ5A 4U6PA 1AXQA 1FA0A 4WYLA 3JYTA 1AUDA 3W2VA 1TKTB 5GADI 1RJJA 1GNKA 5AE3A 3LP1B 3OLBA 3CXCR 5LSLA 2FY1A 3E2EA 3DLJA 5GADU 3P3DA 5AXLA 1WG1A 2YNGA 2U2FA 1TFYA 4KTQA 1OQ6A 4USIA 1R0AA 2XGPA 4I1TA 2DGQA 2I9SA 4NRTA 5KFRA 4FF3A 1S0OA 2LU1A 3IWXA 3Q23A 3FMBA 4C8ZA 5KT6A 2WK4A 5I3QA 3PW5A 1YTYA 1VQ4S 3O44A 4MFBA 2PA8D 1RI7A 5M2PA 4C9DA 4ZCKA 2CQGA 3I5BA 3FRZA 3L95X 3DDKA 4TN2A 4JYAF 5K9FA 4DR1F 3OFGA 2MKHA 2RF2A 3KLEB 2PI4A 1JLQB 2BJEA 5JVGQ 1MSWD 3K8VA 4WU2A 4TQRA 4Q8EA 1HYSB 4PKDB 1FO1A 1S1VA 2DRBA 3AB2B 3UDCA 3B78A 1S9GB 4XO0A 5CXTA 4YEAA 3SQGB 2EPIA 3WX4A 2FLLA 3I0RB 5CCMA 2PMHA 2AV5A 4DV1F 2GFFA 2MGZB 3BN7A 4QIWD 4CI0B 4LUBA 3AH6A 5A8KA 3OHBA 1IKVA 2ABYA 2GV1A 2ZE2B 2KB2A 2F1FA 3PX4A 1S1TA 5C25B 3BGUA 1H2VZ 4BC9A 4OFZA 1C2PA 2AD9A 2YNHA 3DFEA 3TYTA 3MFIA 4ELUA 2V94A 4M5DA 3H2UB 3WC0A 3Q8SB 1NK7A 1I94F 4LFBF 3DMJA 5D8HB 1RTHA 1T95A 5KG2A 2W7AA 1RQ0A 2EWHA 1U1QA 2KG1A 3T1YF 2ZH2A 4X2BA 2VFTA 3KLFB 3R5CA 1FKPB 4KAIA 3QGIA 2M7SA 2PN6A 1MU2B 4OX9F 4KKOA 4F26A 4OQJA 1FRXA 3BB5A 1N52B 1BQNA 4RZRA 2AX0A 5AE2A 4PG6A 1FESA 1UP1A 3M1VB 3TUZC 2LA6A 1S0NA 3ZZTA 2NUHA 1UW4A 3H5UA 4KE5A 2JSXA 3HFKA 4Z2XA 2DCUB 3DRRB 2YNGB 3CCMS 1CLFA 5KFLA 1CQMA 2XGQA 4IR9A 4H4MB 7FDRA 5SZTA 4NWBA 2XNQA 2ZOGA 4ELVA 1R0AB 3O3LA 3GSDA 3M30A 4P7VA 2A2CA 3B8HA 4C2MA 1YJNS 4QR0A 2BV3A 2DNLA 3IRWP 2RMLA 2NUUG 2E1CA 3G4SS 5KG3A 5J2PA 4N56A 4DQRA 1DFDA 1TK5A 1E6VB 2WSCC 4R8UA 4JBCA 4DG1A 2N3OA 4EO6A 3SSRA 2BRLA 4K59A 4I56A 4NLOA 4WE1B 2M8DB 3S01A 3NL0A 1VK3A 2IRXA 2XY5A 2KT2A 4JOUA 1LFPA 4FNIA 5IT9Y 4GO5X 2DIUA 4YFUA 1U1KA 3PY8A 1FERA 1KN6A 4OMFG 4KGMA 1U1MA 4Q0BB 2OP5A 2HNDB 5E7OB 4EZ9A 2J9DE 1LFWA 3DOKA 1WHYA 3FEYB 4ECZA 2HNZA 1SJQA 1KOHA 4HT7A 4X4NA 1HQUA 4EFAC 2OIHA 4ED6A 5G0RB 1CQNA 2PIIA 4WKYA 2D1CA 1JLGA 2C2RA 1ZM4A 5A8KB 2HRYA 3GIKA 5HO4A 5K14B 4Y2KA 3WC2A 4XDDA 4CO2A 2KM8C 4PQUB 4C3LA 3L09A 4X4VA 4J9MA 1ROFA 1D9FA 2HVIA 3UI3A 4RU2A 2YH0A 2FHKA 3FQKA 2NPFA 3X1LB 2X3GA 4Q2MA 4U9RA 3T5LA 1JLAA 2RNEA 2VODA 2VPWB 3DRPA 4YB5A 1NAQA 2P9EA 3OR2A 5KFGA 1YITS 3BQ0A 4TYAA 2VFSA 4IDKB 3AHPA 2HQIA 4XPCA 1SXLA 3CO9A 2YKPA 1BLUA 4RW8B 2VC1A 2MQQA 2YKQA 4IQXA 4I64A 2R7WA 1UFWA 4DF4A 2CKWA 1YJTA 3RB3A 5K5MA 4CIOA 2DH7A 2RS8A 1N5QA 2J0XA 1M5OC 1YVFA 4TY9A 1GXLA 2MXYA 2WTFA 5EWEA 5JJBA 1VS3A 1ZM3A 3OFHA 1NKBA 5F3ZA 3EYZA 2CJKA 2OTJS 1Q1KA 2BRKA 1KOOA 1N34F 2XNRA 2HHHF 2J6TA 3F44A 2D9PA 2RRBA 3PKYA 1D9DA 3DLEB 1VHFA 4UY8T 3EPIA 5J2NA 3CCRS 4OZJA 3KNGA 4H4KA 3MR3A 5D3GB 4IFVB 3RAXA 1C4CA 4OI2A 4IR1A 3AQPA 2XWXA 2ZUGA 3OR1A 2IRYA 4XIUA 4WFXA 2YKMA 2FLOA 3DGPA 1YG0A 2MSTA 1P6TA 3RZAA 2N7CA 1E6VA 4MYUA 2C42A 2G13A 1CVJA 1FHTA 4NCGA 1W2BR 4F3OA 5LMUF 2QRRA 5DDPC 1SL1A 2YY3A 1P8GA 5ADZA 2ADBA 1XBWA 2VB6A 3M2UA 5KG7A 4RBTA 3DLLQ 4M95A 4ZPAA 2CPIA 4HLBA 1GTEA 2P5VA 3PHEA 4DPOA 2V4JB 1HD1A 3CD6S 1JWWA 2VQEF 3PZPA 1N6QB 4UQGA 2EK6A 2OSRA 5D78A 2BVZA 1JXLA 2WSEC 1LK7A 1VRUA 4J9PA 1VI7A 2RILA 3IGVA 1D8YA 4A8FA 4KFBA 3MECA 4ETXA 4UOCA 1TVRB 5IM0A 3DRXA 5D4OA 2Q3PA 3ENQA 4ECSA 2EBEA 5F8HA 4FBUA 4NLSA 1TK8A 4QR2A 4CZCA 1UVIA 2HWHA 4PQUA 4QYZJ 5HQ8A 3JSRA 3R1LA 1UETA 3GR1A 2V8VA 1U8SA 3QZ7A 3BO3A 1GH8A 1SJFA 3HHLC 5KT5A 1R8PA 3MCSA 2BYCA 3Q24A 1DQ8A 2ASLA 5E3CA 1K1QA 3E01A 4ED1A 2VBYA 2GHWA 1VRTB 3TNVA 3FSYA 4QIVA 3ISND 3CVKA 4QCLA 2B4VA 2LQ9A 4J9KA 2YKOA 1KHWA 2VV5A 4IFYB 2LDIA 2XCAA 4A8SA 1WI8A 1M5HA 2YVSA 4DV6F 1N48A 5KT7A 3J81Y 2C3OA 4WJBA 2YKNB 3ETOA 1FJEB 2CQBA 1FD8A 3D0IE 1FK9A 3MM7B 3EXYA 1RKIA 1HHTP 3T5KA 4ES1A 1MROB 2R7VA 5J2NB 1X4BA 3OQ2A 4OI6A 4QZVB 3P96A 3CC7S 4R5PB 4N41A 3BGRA 2LU2A 3UFCX 4RNFA 3LALA 3M30B 2B0GA 4O44A 3MI7X 2AW0A 3BSCA 4JI5F 4AXJA 1XEZA 2CQHA 2YKMB 2UV8G 1N8RT 1BD6A 1M5PC 4FBTA 2M4MA 3IRXB 1KQSR 3MXHP 1JNZB 3H2LA 4QPXA 4R8UB 4X64F 1WF1A 2YX4A 4NLXA 2XZWA 4ED5A 5KG4A 3DHWC 4MK9A 1P27B 1DLOB 1IQTA 1M0SA 2F3JA 4OHVA 2ZH6A 1U2FA 4BWMA 2KHCA 2QT7A 2L41A 2JWNA 2KVIA 3CDUA 4BS2A 2JEIA 3CDAA 4EO8A 3S8SA 5KT2A 2XS2A 2V4QA 1RT6B 3K8WA 2B51A 4C8MA 2W24A 3N5FA 2ROPA 2WBMA 3CJKA 4C3KA 4NYZA 1X9MA 3PM9A 3S6EA 2GIQA 1KQKA 3H4DA 4P2SA 3LP2A 2ZH9A 1RTDB 2HHWA 3DLGB 2KM8B 4AL5A 3MAHA 1Y4ZB 2KFYA 4WZQA 2Q6BA 1HBMB 3KYLA 3CCVS 5H9FJ 2I1RA 2D3OR 4DEZA 4PPDA 1R3NA 5B0BA 2QMWA 4B3MF 4WIIA 2C3UA 3KJVB 5B0DA 5C24B 1VQ6S 1FCAA 3FEXB 2HMIA 2DNMA 2RH3A 3DU6A 2EW9A 1S9EA 4YDXA 4OX6A 5B0FA 3NNCA 3TQ1A 2L08A 4Q7AA 2PGCA 4FS1A 3GWCA 4DN9A 4NYOA 3HVAA 2HFNA 2JH3A 1IUJA 1S9GA 3PW0A 1UWBB 3I4PA 2CQ0A 2V2KA 3V4MA 1CC8A 4RNNA 1T03B 3LQVA 5KFYA 2HS3A 4NPOA 4O4RA 5KFNA 2VD3A 3KMSA 3RR8A 2DT9A 2RF2B 3O6QA 3KLEA 2ACYA 5JXSA 2HVZA 1TAUA 2EG2A 3HPOA 1FDBA 4DS4A 2Q1LA 2ZBIA 3KLGB 1VC0A 4EZ6A 2V9KA 1U1NA 2YWEA 1UJ6A 4IFVA 2GMJA 3SZ2A 2LEBA 2ILZA 3UD4P 5F8MA 5D6GA 4G1IA 1VC5A 1T94A 1HNWF 1HWJA 2K2PA 3BZQA 1SJRA 3DM2B 2B5JA 4A47A 1VQLS 4N76A 1LWCB 2QSFA 4R0JA 1ZZFA 5HMWA 4K0KF 3W2VB 3RW7A 1SC6A 1V6HA 4DBQA 2OFGX 3OXGA 2R4FA 2R8GA 3M6UA 1N88A 2E5JA 4ZPTR 4Y3CA 5F8LA 3OV7A 2ZKTA 2EK1A 1NHUA 1TL3B 5KFFA 1W2IA 4O23A 1HBUA 3U7JA 1EP4B 4B3OA 1U47A 1Q81T 1LW0B 3THTA 2W9CA 2DNZA 1KC8T 2R7OA 5A6PA 1K0TA 3GG1A 2W8LA 4DX8H 4DFPA 2FPHX 4DV7F 1YRXA 4F67A 2CDQA 4PG5A 2V8DA 3CJ4A 4HTIA 5IWAF 3NKYA 3FFIB 3PACA 2KI2A 3B4MA 5A8RB 4LJMA 2IM1A 2BQRA 2XCPA 4DG1B 2W4CA 4DL4A 1NJZA 4NA2A 1VQSA 3CULA 4LMZA 2OPSA 4NLTA<