4OZWA

Crystal structure of the periplasmic alginate lyase algl h202a mutant
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
335
structure length
334
Chain Sequence
ADLVPPPGYYAAVGERKGAGSCPAVPPPYTGSLVFTSKYEGSDSARATLNVKAEKTFRSQIKDITDMERGATKLVTQYMRSGRDGDLACALNWMSAWARAGALQSDDFNHTGKSMRKWALGSLSGAYMRLKFSSSRPLAAHAEQSREIEDWFARLGTQVVRDWSGLPLKKINNASYWAAWSVMSTAVVTNRRDLFDWAVSEFKVAANQVDEQGFLPNELKRRQRALAYHNYALPPLAMIAAFAQVNGVDLRQENHGALQRLAERVMKGVDDEETFEEKTGEDQDMTDLKVDNKYAWLEPYCALYRCEPKMLEAKKDREPFNSFRLGGEVTRVFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alginate lyase
publication title Crystal Structure of the periplasmic alginate lyase AlgL H202A mutant
rcsb
source organism Pseudomonas aeruginosa
molecule tags Lyase
total genus 141
structure length 334
sequence length 335
ec nomenclature ec 4.2.2.3: Mannuronate-specific alginate lyase.
pdb deposition date 2014-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05426 Alginate_lyase Alginate lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.100 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Chondroitin AC/alginate lyase 4ozwA00
1RWHA 1J0NA 4OK2A 1RW9A 1N7NA 2E24A 3E7JA 1OJOA 1OJPA 4MMHA 1N7RA 2WDAA 1QAZA 1HMWA 3NFVA 4MMIA 3VSNA 1LOHA 1N7OA 4F13A 2FUTA 1F9GA 1W3YA 3AFLA 1J0MA 2BRVX 1HM2A 2Q1FA 4F10A 1HMUA 1RWFA 1C82A 4E1YA 4OK4A 4OJZA 1LXMA 4OZWA 1N7PA 1CB8A 2BRWA 1EGUA 3VSMA 2BRPA 3E80A 3NNBA 1LXKA 1X1HA 1OJMA 5JMFA 1HV6A 1RWCA 1N7QA 3A0OA 1HN0A 2WCOA 4OZVA 1X1IA 1F1SA 1I8QA 1X1JA 2FUQA 5JMDA 1OJNA 1HM3A 4FNVA 2X03A 1RWAA 4NEIA 1RWGA 2E22A
chains in the Genus database with same CATH superfamily
3QWTA 3VXDA 3H3KA 1GAIA 1N7NA 1FT1B 5E2JA 3KQ4A 1SA5B 1L2AA 3DSVB 2ZIRB 5GW7A 2WY8A 1QQFA 3K7XA 2ZZRA 1FP3A 3Q79B 3OEDA 3M72A 4LNVA 3SDTA 1KZOB 2ONGA 3AFJA 1RWCA 2VN7A 1HXAA 5GY3A 1F9DA 4CJ1A 1MZCB 4WVAA 1O79A 4FJQA 3RENA 1JCRB 2AFAA 5MEHA 1TNUB 4GTOB 3HXBB 1SQCA 2E24A 3E7JA 3NFVA 1QAZA 2BEDB 2AHFA 3S4BA 3PZ1B 3AFLA 2DRRA 4KKIA 3ANJA 1NL4B 3C72B 4OZWA 1LXKA 1FO3A 1KRFA 1N7QA 3EU5B 3GZKA 5ILHA 2PN5A 2P0VA 4GTSB 2R2LB 2WIIB 1N4RB 2B4FA 1GXMA 4V1RA 5IK6A 3SFXB 2WYNA 3G6JB 5DHKA 2V8KA 3WUXA 3WKIA 4YDEB 1S64B 2H6FB 4GTPB 3WC3A 5ILIA 5FO9B 3S4DA 4GTTB 2BRWA 4J5TA 4CJ0A 1H13A 1H36A 1TNZB 4OZVA 3Q7AB 4GAXA 1D8DB 4EL8A 1WU5A 5CD2A 1JCSB 1KSCA 1C3DA 1K72A 2OKXA 4MMHA 1N20A 4MMIA 4TF4A 1V7VA 3Q78B 4D4CA 1L1YA 3W7XA 4ZH1A 1S63B 1UT9A 2V3PA 3M75A 3NNBA 1HV6A 2FUZA 2RGKA 3E32B 3Q7FB 2G0DA 1H12A 2JG0A 3M7EA 3RRSA 3G4FA 1LD7B 2EABA 1G6IA 1DOGA 5KKBA 1O1TB 4GL3A 4GTRB 4WVCA 2FBAA 3SQCA 3WKFA 4F13A 5M7YA 2GH4A 1H54A 3HXCB 4LNGB 5IL8A 1LD8B 5JMFA 3RSYA 5IL3A 5IKAA 3PYBA 3H2WA 1I8QA 1N22A 2BBCA 2J5CA 3N0GA 3KSLB 4AYQA 1N1ZA 1X9DA 1NI1B 3M01A 2GOXA 3E37B 3HXFB 1KWFA 3QFYA 2BB5A 2D8LA 1LTXB 3QT3A 4L6XA 1RWFA 5ILDA 2BB6A 4OK4A 4L0GA 3S9VA 3E80A 5FOBB 2GZ6A 1XW2A 3A0OA 5EATA 1SA4B 3KLSA 3QG0A 3ANKA 1GA2A 1V5CA 3SDUA 3Q73B 1FAEA 4ZRQA 3ANIA 3W7WA 3RX7A 1HMWA 1N7OA 3W7UA 3M7BA 3KSQB 5JPNB 1RQ5A 1QBQB 1IS9A 2XQWA 4BOJA 1HZFA 3M76A 1TN6B 4ONTA 4Q88A 3CIHA 1H39A 3WKHA 1N7PA 1CB8A 2WY7A 3M7CA 1DL2A 1JCQB 2FV0A 2EADA 2FUQA 1KSDA 4FNVA 4Z4JA 3M71A 4OK2A 3PZ2B 1TF4A 2RI9A 2H6GB 5AGDA 2F6DA 2I07B 1TNOB 1HM2A 2V3NA 3E73A 3P5RA 1IA7A 1HMUA 4BOKA 5C05A 4YCRA 2RI8A 1ULVA 3GT5A 3DSSB 4GTMB 3DPYB 4GTVB 3P2CA 4L9PB 4CE7A 5JMDA 5ILYA 1WU6A 3E6UA 3QRYA 4GTQB 1FT2B 3RX8A 3T33A 1RW9A 1FBWA 1HXCA 1OJOA 1UG9A 1KS8A 1X81B 1H3BA 1O6HA 3WIWA 4E1YA 4AYOA 4D94A 2XWJB 1O5MB 1G9JA 1HN0A 1DCEB 4KTRA 4Q2BA 3M74A 2X03A 4D4AA 3W7SA 4NEIA 3M78A 1RWGA 3D5RA 4QT9A 3PZ3B 2H6HB 1N9AB 1WU4A 4LIXA 1OJPA 3G4DA 1XWTA 3QPFA 1H3AA 4DI5A 5IM1A 4YDOB 1FPPB 4XUVA 4AYRA 2Q1FA 4DOEA 4TXTA 3GLYA 3VSMA 2F0YB 2JF4A 3Q75B 5CA3A 4KKJA 1N94B 1KKTA 2V8JA 3PZ4B 1X1IA 1QSJA 3ACSA 1KZPB 5GZKA 1N4PB 3SAEA 5ILKA 1XWQA 3ON6A 4V1SA 2DRQA 3LZ9A 4FXKB 5EAUA 1H14A 1N7RA 3M73A 1FMIA 2CQSA 3A3VA 2EACA 5CZLA 3QXFA 3M77A 1J0MA 2BRVX 1NXCA 2B39A 1GSZA 1CEMA 5ILZA 4AYPA 3WKGA 1FO2A 1KREA 1WZZA 2A8ZA 3D5SA 3E34B 1N4SB 1OJMA 3QFZA 3M00A 1HXGA 1W6JA 1H37A 3EZ8A 1G9GA 4ZRPA 2XWBB 1RWAA 3PMMA 3X17A 1CLCA 5DHIA 1TNBB 5M7IA 3H7LA 3E30B 3W7TA 3TF4A 3QDEA 5IKHA 3HXEB 2PMVA 2D5JA 1N1BA 1V5DA 3SFYB 2V8IA 2YIKA 1NC5A 1W6KA 4F10A 4KTPA 1EGUA 2WCOA 5ILJA 5JPMB 4MBGB 2XFGA 2ONHA 3PYAA 3OXUA 5IK0A 1FBOA 3VSNA 2CQTA 1D8EB 1GXNA 1O6RA 3DSTB 3K11A 1R76A 3EUVB 2Z07A 1LXMA 3P5PA 1UMPA 3EQAA 2DRSA 4ZG8A 1N21A 1TN7B 1LF9A 3D3IA 2DROA 5IK9A 1F9OA 1F1SA 1HX9A 3QXQA 3CU7A 4MU9A 4D4DA 4C1SA 3N0FA 1J0NA 2AHGA 3DRAB 2H6IB 3ACTA 4WVBA 4FXGB 2WDAA 1N23A 2SQCA 4WU0A 3SDRA 1GAHA 3QT9A 3HXDB 3WIRA 2A73B 3DSWB 2G02A 5DGQA 1IA6A 4OJZA 1H3CA 4EHMB 1KFGA 3W5NA 2ZBLA 2IEJB 1OJNA 2VN4A 3E33B 1V7XA 4FUSA 1O6QA 1AYXA 1RWHA 1GLMA 1N95B 4ZH5A 3S4CA 3DSXB 2FUTA 2QNOA 3QSPA 1TNYB 1GHQA 1G87A 2WINB 2ZISB 3SDVA 1C82A 3RJ3A 4LNBB 2BRPA 5FO7B 5FO8B 1FCEA 1LF6A 3M7LA 3DSUB 1X1JA 3EU8A 1HM3A 1TN8B 2FV1A 4JJJA 2E22A 2JJBA 2NVPA 1N24A 4Z4LA 3S4AA 2NOJA 1LOHA 1F9GA 3WIQA 1W3YA 1N4QB 1H35A 1AGMA 3RX5A 1GXOA 3W5MA 1O1RB 5EASA 1JS4A 3SDQA 1VD5A 1X1HA 4DODA 1O1SB 1V7WA 5DGRA 3M02A 4D4BA 4M76A 3VW5A 1HCUA 2EAEA 4RNQA
chains in the Genus database with same CATH topology
1RWHA 1J0NA 4OK2A 1RW9A 1N7NA 2E24A 3E7JA 1OJOA 1OJPA 4MMHA 1N7RA 2WDAA 1QAZA 1HMWA 3NFVA 4MMIA 3VSNA 1LOHA 1N7OA 4F13A 2FUTA 1F9GA 1W3YA 3AFLA 1J0MA 2BRVX 1HM2A 2Q1FA 4F10A 1HMUA 1RWFA 1C82A 4E1YA 4OK4A 4OJZA 1LXMA 4OZWA 1N7PA 1CB8A 2BRWA 1EGUA 3VSMA 2BRPA 3E80A 3NNBA 1LXKA 1X1HA 1OJMA 5JMFA 1HV6A 1RWCA 1N7QA 3A0OA 1HN0A 2WCOA 4OZVA 1X1IA 1F1SA 1I8QA 1X1JA 2FUQA 5JMDA 1OJNA 1HM3A 4FNVA 2X03A 1RWAA 4NEIA 1RWGA 2E22A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RWH A;  1J0N A;  4OK2 A;  1RW9 A;  1N7N A;  2E24 A;  3E7J A;  1OJO A;  1OJP A;  4MMH A;  1N7R A;  2WDA A;  1QAZ A;  1HMW A;  3NFV A;  4MMI A;  3VSN A;  1LOH A;  1N7O A;  4F13 A;  2FUT A;  1F9G A;  1W3Y A;  3AFL A;  1J0M A;  2BRV X;  1HM2 A;  2Q1F A;  4F10 A;  1HMU A;  1RWF A;  1C82 A;  4E1Y A;  4OK4 A;  4OJZ A;  1LXM A;  4OZW A;  1N7P A;  1CB8 A;  2BRW A;  1EGU A;  3VSM A;  2BRP A;  3E80 A;  3NNB A;  1LXK A;  1X1H A;  1OJM A;  5JMF A;  1HV6 A;  1RWC A;  1N7Q A;  3A0O A;  1HN0 A;  2WCO A;  4OZV A;  1X1I A;  1F1S A;  1I8Q A;  1X1J A;  2FUQ A;  5JMD A;  1OJN A;  1HM3 A;  4FNV A;  2X03 A;  1RWA A;  4NEI A;  1RWG A;  2E22 A; 
#chains in the Genus database with same CATH topology
 3QWT A;  3VXD A;  3H3K A;  1GAI A;  1N7N A;  1FT1 B;  5E2J A;  3KQ4 A;  1SA5 B;  1L2A A;  3DSV B;  2ZIR B;  5GW7 A;  2WY8 A;  1QQF A;  3K7X A;  2ZZR A;  1FP3 A;  3Q79 B;  3OED A;  3M72 A;  4LNV A;  3SDT A;  1KZO B;  2ONG A;  3AFJ A;  1RWC A;  2VN7 A;  1HXA A;  5GY3 A;  1F9D A;  4CJ1 A;  1MZC B;  4WVA A;  1O79 A;  4FJQ A;  3REN A;  1JCR B;  2AFA A;  5MEH A;  1TNU B;  4GTO B;  3HXB B;  1SQC A;  2E24 A;  3E7J A;  3NFV A;  1QAZ A;  2BED B;  2AHF A;  3S4B A;  3PZ1 B;  3AFL A;  2DRR A;  4KKI A;  3ANJ A;  1NL4 B;  3C72 B;  4OZW A;  1LXK A;  1FO3 A;  1KRF A;  1N7Q A;  3EU5 B;  3GZK A;  5ILH A;  2PN5 A;  2P0V A;  4GTS B;  2R2L B;  2WII B;  1N4R B;  2B4F A;  1GXM A;  4V1R A;  5IK6 A;  3SFX B;  2WYN A;  3G6J B;  5DHK A;  2V8K A;  3WUX A;  3WKI A;  4YDE B;  1S64 B;  2H6F B;  4GTP B;  3WC3 A;  5ILI A;  5FO9 B;  3S4D A;  4GTT B;  2BRW A;  4J5T A;  4CJ0 A;  1H13 A;  1H36 A;  1TNZ B;  4OZV A;  3Q7A B;  4GAX A;  1D8D B;  4EL8 A;  1WU5 A;  5CD2 A;  1JCS B;  1KSC A;  1C3D A;  1K72 A;  2OKX A;  4MMH A;  1N20 A;  4MMI A;  4TF4 A;  1V7V A;  3Q78 B;  4D4C A;  1L1Y A;  3W7X A;  4ZH1 A;  1S63 B;  1UT9 A;  2V3P A;  3M75 A;  3NNB A;  1HV6 A;  2FUZ A;  2RGK A;  3E32 B;  3Q7F B;  2G0D A;  1H12 A;  2JG0 A;  3M7E A;  3RRS A;  3G4F A;  1LD7 B;  2EAB A;  1G6I A;  1DOG A;  5KKB A;  1O1T B;  4GL3 A;  4GTR B;  4WVC A;  2FBA A;  3SQC A;  3WKF A;  4F13 A;  5M7Y A;  2GH4 A;  1H54 A;  3HXC B;  4LNG B;  5IL8 A;  1LD8 B;  5JMF A;  3RSY A;  5IL3 A;  5IKA A;  3PYB A;  3H2W A;  1I8Q A;  1N22 A;  2BBC A;  2J5C A;  3N0G A;  3KSL B;  4AYQ A;  1N1Z A;  1X9D A;  1NI1 B;  3M01 A;  2GOX A;  3E37 B;  3HXF B;  1KWF A;  3QFY A;  2BB5 A;  2D8L A;  1LTX B;  3QT3 A;  4L6X A;  1RWF A;  5ILD A;  2BB6 A;  4OK4 A;  4L0G A;  3S9V A;  3E80 A;  5FOB B;  2GZ6 A;  1XW2 A;  3A0O A;  5EAT A;  1SA4 B;  3KLS A;  3QG0 A;  3ANK A;  1GA2 A;  1V5C A;  3SDU A;  3Q73 B;  1FAE A;  4ZRQ A;  3ANI A;  3W7W A;  3RX7 A;  1HMW A;  1N7O A;  3W7U A;  3M7B A;  3KSQ B;  5JPN B;  1RQ5 A;  1QBQ B;  1IS9 A;  2XQW A;  4BOJ A;  1HZF A;  3M76 A;  1TN6 B;  4ONT A;  4Q88 A;  3CIH A;  1H39 A;  3WKH A;  1N7P A;  1CB8 A;  2WY7 A;  3M7C A;  1DL2 A;  1JCQ B;  2FV0 A;  2EAD A;  2FUQ A;  1KSD A;  4FNV A;  4Z4J A;  3M71 A;  4OK2 A;  3PZ2 B;  1TF4 A;  2RI9 A;  2H6G B;  5AGD A;  2F6D A;  2I07 B;  1TNO B;  1HM2 A;  2V3N A;  3E73 A;  3P5R A;  1IA7 A;  1HMU A;  4BOK A;  5C05 A;  4YCR A;  2RI8 A;  1ULV A;  3GT5 A;  3DSS B;  4GTM B;  3DPY B;  4GTV B;  3P2C A;  4L9P B;  4CE7 A;  5JMD A;  5ILY A;  1WU6 A;  3E6U A;  3QRY A;  4GTQ B;  1FT2 B;  3RX8 A;  3T33 A;  1RW9 A;  1FBW A;  1HXC A;  1OJO A;  1UG9 A;  1KS8 A;  1X81 B;  1H3B A;  1O6H A;  3WIW A;  4E1Y A;  4AYO A;  4D94 A;  2XWJ B;  1O5M B;  1G9J A;  1HN0 A;  1DCE B;  4KTR A;  4Q2B A;  3M74 A;  2X03 A;  4D4A A;  3W7S A;  4NEI A;  3M78 A;  1RWG A;  3D5R A;  4QT9 A;  3PZ3 B;  2H6H B;  1N9A B;  1WU4 A;  4LIX A;  1OJP A;  3G4D A;  1XWT A;  3QPF A;  1H3A A;  4DI5 A;  5IM1 A;  4YDO B;  1FPP B;  4XUV A;  4AYR A;  2Q1F A;  4DOE A;  4TXT A;  3GLY A;  3VSM A;  2F0Y B;  2JF4 A;  3Q75 B;  5CA3 A;  4KKJ A;  1N94 B;  1KKT A;  2V8J A;  3PZ4 B;  1X1I A;  1QSJ A;  3ACS A;  1KZP B;  5GZK A;  1N4P B;  3SAE A;  5ILK A;  1XWQ A;  3ON6 A;  4V1S A;  2DRQ A;  3LZ9 A;  4FXK B;  5EAU A;  1H14 A;  1N7R A;  3M73 A;  1FMI A;  2CQS A;  3A3V A;  2EAC A;  5CZL A;  3QXF A;  3M77 A;  1J0M A;  2BRV X;  1NXC A;  2B39 A;  1GSZ A;  1CEM A;  5ILZ A;  4AYP A;  3WKG A;  1FO2 A;  1KRE A;  1WZZ A;  2A8Z A;  3D5S A;  3E34 B;  1N4S B;  1OJM A;  3QFZ A;  3M00 A;  1HXG A;  1W6J A;  1H37 A;  3EZ8 A;  1G9G A;  4ZRP A;  2XWB B;  1RWA A;  3PMM A;  3X17 A;  1CLC A;  5DHI A;  1TNB B;  5M7I A;  3H7L A;  3E30 B;  3W7T A;  3TF4 A;  3QDE A;  5IKH A;  3HXE B;  2PMV A;  2D5J A;  1N1B A;  1V5D A;  3SFY B;  2V8I A;  2YIK A;  1NC5 A;  1W6K A;  4F10 A;  4KTP A;  1EGU A;  2WCO A;  5ILJ A;  5JPM B;  4MBG B;  2XFG A;  2ONH A;  3PYA A;  3OXU A;  5IK0 A;  1FBO A;  3VSN A;  2CQT A;  1D8E B;  1GXN A;  1O6R A;  3DST B;  3K11 A;  1R76 A;  3EUV B;  2Z07 A;  1LXM A;  3P5P A;  1UMP A;  3EQA A;  2DRS A;  4ZG8 A;  1N21 A;  1TN7 B;  1LF9 A;  3D3I A;  2DRO A;  5IK9 A;  1F9O A;  1F1S A;  1HX9 A;  3QXQ A;  3CU7 A;  4MU9 A;  4D4D A;  4C1S A;  3N0F A;  1J0N A;  2AHG A;  3DRA B;  2H6I B;  3ACT A;  4WVB A;  4FXG B;  2WDA A;  1N23 A;  2SQC A;  4WU0 A;  3SDR A;  1GAH A;  3QT9 A;  3HXD B;  3WIR A;  2A73 B;  3DSW B;  2G02 A;  5DGQ A;  1IA6 A;  4OJZ A;  1H3C A;  4EHM B;  1KFG A;  3W5N A;  2ZBL A;  2IEJ B;  1OJN A;  2VN4 A;  3E33 B;  1V7X A;  4FUS A;  1O6Q A;  1AYX A;  1RWH A;  1GLM A;  1N95 B;  4ZH5 A;  3S4C A;  3DSX B;  2FUT A;  2QNO A;  3QSP A;  1TNY B;  1GHQ A;  1G87 A;  2WIN B;  2ZIS B;  3SDV A;  1C82 A;  3RJ3 A;  4LNB B;  2BRP A;  5FO7 B;  5FO8 B;  1FCE A;  1LF6 A;  3M7L A;  3DSU B;  1X1J A;  3EU8 A;  1HM3 A;  1TN8 B;  2FV1 A;  4JJJ A;  2E22 A;  2JJB A;  2NVP A;  1N24 A;  4Z4L A;  3S4A A;  2NOJ A;  1LOH A;  1F9G A;  3WIQ A;  1W3Y A;  1N4Q B;  1H35 A;  1AGM A;  3RX5 A;  1GXO A;  3W5M A;  1O1R B;  5EAS A;  1JS4 A;  3SDQ A;  1VD5 A;  1X1H A;  4DOD A;  1O1S B;  1V7W A;  5DGR A;  3M02 A;  4D4B A;  4M76 A;  3VW5 A;  1HCU A;  2EAE A;  4RNQ A; 
#chains in the Genus database with same CATH homology
 1RWH A;  1J0N A;  4OK2 A;  1RW9 A;  1N7N A;  2E24 A;  3E7J A;  1OJO A;  1OJP A;  4MMH A;  1N7R A;  2WDA A;  1QAZ A;  1HMW A;  3NFV A;  4MMI A;  3VSN A;  1LOH A;  1N7O A;  4F13 A;  2FUT A;  1F9G A;  1W3Y A;  3AFL A;  1J0M A;  2BRV X;  1HM2 A;  2Q1F A;  4F10 A;  1HMU A;  1RWF A;  1C82 A;  4E1Y A;  4OK4 A;  4OJZ A;  1LXM A;  4OZW A;  1N7P A;  1CB8 A;  2BRW A;  1EGU A;  3VSM A;  2BRP A;  3E80 A;  3NNB A;  1LXK A;  1X1H A;  1OJM A;  5JMF A;  1HV6 A;  1RWC A;  1N7Q A;  3A0O A;  1HN0 A;  2WCO A;  4OZV A;  1X1I A;  1F1S A;  1I8Q A;  1X1J A;  2FUQ A;  5JMD A;  1OJN A;  1HM3 A;  4FNV A;  2X03 A;  1RWA A;  4NEI A;  1RWG A;  2E22 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...