4OZYA

Crystal structure of the periplasmic alginate epimerase algg t265n mutant
Total Genus 169
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
169
sequence length
423
structure length
420
Chain Sequence
EMAKPVLPDLSGYTTEAALKKIARNKPGKITVARMMEETGLKEFIGGDNKMAEWVVRQKGIPQAIMISDGYVNLQDLVKKVPKQFLSEVSPGVYVARLPILVKETGIFEIDSKTKELRLSQEGSFIVSEGKMLITNTSVNAWSETRNGLAAYRTPDEFRPFVLTWGGSQTWIAKTKMASMGYNQSSYGVSISQYNPNTAKVLKRGEPTGWIIDSEFADMWYGFYCYETRDFVVKGNTYRDNIVYGIDPHDRSHGLIIAENDVYGTKKKHGIIISREVDNSFIFRNSHNNKLSGVVLDRNSVGNIVAYNEIYQNHTDGITLYESGNNLLWGNRVIANRRHGIRVRNSVNIKLYENVAMANGLMGVYGHIKDLNDTDRDIELDPFDAQVSLIMVGGELSSNGSGPLSIDSPLSVELYRVSML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Poly(beta-D-mannuronate) C5 epimerase
publication title Crystal Structure of the periplasmic alginate epimerase AlgG T265N mutant
rcsb
source organism Pseudomonas syringae pv. tomato
molecule tags Isomerase
total genus 169
structure length 420
sequence length 423
ec nomenclature ec 5.1.3.37: Mannuronan 5-epimerase.
pdb deposition date 2014-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13229 Beta_helix Right handed beta helix region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4ozyA00
3B8YA 3B90A 4U49A 1O8DA 3B4NA 4OJ5A 4XM3A 4MXNA 1O8HA 2NZMA 3GRHA 2O1DA 3VSUA 4YZ0A 1DBOA 1GQ8A 2O0VA 1O88A 4YZAA 2X85A 2X6YA 4XLEA 1DBGA 4XKWA 2EWEA 1JTAA 1K5CA 1X0CA 2ODLA 2NT6A 1VBLA 4XLCA 3GQ8A 1BN8A 1O8MA 1H80A 1CZFA 1OFLA 4XLAA 1O8FA 3WWGA 1IB4A 4W8RA 1KTWA 4OZZA 2UVFA 2O17A 2O0WA 2QX3A 4XR6A 4XOTA 3GQAA 3KRGA 1KCDA 4YZQA 1OGMX 4PMHA 5C1EA 3ZSCA 1OGOX 4I84A 2O04A 2PYGA 4NK6A 1IA5A 1EE6A 1QJVA 3VMWA 3SUCA 4XKVA 3ZPPA 3VMVA 1JRGA 4W8QA 4OJLA 1QCXA 2NTPA 2PYHA 1RWRA 3GQ9A 3T9GA 1NHCA 4XOPA 3UW0A 1O8EA 4OJPA 2VBMA 1O8IA 1PLUA 2NSTA 5AMVA 2VJJA 4XORA 2PECA 4XN0A 3VSTA 2INVA 1IDKA 1PXZA 4XQFA 1PE9A 4W8SA 2X6XA 3GQ7A 4OJOA 1XG2A 4XN3A 4YZXA 2NTBA 2UVEA 5C1CA 4EW9A 1O8LA 1WMRA 2QXZA 4OZYA 2QY1A 1OOCA 2BSPA 2NSPA 3FY3A 3EQNA 3JURA 4U4BA 4HWVA 4OJ6A 1HG8A 2NTQA 3EQOA 4XL9A 2X6WA 4MR0A 4Z03A 3VSVA 4XMYA 4C2LA 1KCCA 1O8KA 1BHEA 1RMGA 2VJIA 4XONA 1AIRA 1RU4A 4XNFA 4NK8A 2INUA 2NT9A 4Z05A 2Z8GA 1O8JA 2VBEA 2IQ7A 1IDJA 2VBKA 4Z06A 1OFMA 1O8GA 4XLFA 4YEJA 4URRA 4W8TA 4AVZA 4XLHA 2X3HA 3LMWA 4YELA
chains in the Genus database with same CATH superfamily
3B8YA 3N6ZA 3B90A 3AK5A 2BM6A 4U49A 1O8DA 3B4NA 2VFQA 4OJ5A 1CLWA 4XM3A 4MXNA 1O8HA 2NZMA 2J8KA 3GRHA 2O1DA 3VSUA 4YZ0A 1HF2A 1DBOA 1GQ8A 2O0VA 4XL9A 3SZEA 1O88A 4YZAA 2X85A 1OFDA 1OFEA 3SY2A 2VFMA 2X6YA 2YUHA 4XLEA 1DABA 3BH6B 3VSVA 1DBGA 4XKWA 2EWEA 3LJYA 1TYWA 1TYXA 1JTAA 3NB2A 1K5CA 1X0CA 2ODLA 2G0YA 4U4BA 1L1IA 2XTYA 2NT6A 3NAWA 1VBLA 4XLCA 4YELA 4YDTA 4YFOA 3GQ8A 2BM4A 1LLWA 1O8MA 1BN8A 1H80A 1CZFA 1OFLA 4XLAA 1O8FA 3WWGA 1IB4A 4W8RA 1KTWA 2BM5A 3N90A 2IOUG 4OZZA 2UVFA 1QRCA 2O17A 2B0RA 2O0WA 2XC1A 2QX3A 2VFOA 1LM1A 2QZAA 3SYJA 5JMCB 4XR6A 4XOTA 3GQAA 3KRGA 1KCDA 4YZQA 1OGMX 3JX8A 1QRBA 4PMHA 5C1EA 3ZSCA 2XT2A 1OGOX 4I84A 4YCQA 2O04A 2PYGA 4NK6A 4OM9A 1IA5A 1EE6A 1QJVA 2XTXA 4OPWA 3VMWA 1WXRA 3SUCA 3PETA 4XKVA 3ZPPA 3VMVA 1JRGA 4W8QA 4OJLA 3TH0A 3PSSA 1QCXA 3PSZA 2NTPA 2PYHA 1RWRA 3GQ9A 3T9GA 1NHCA 1TYUA 4XOPA 3UW0A 1O8EA 2BX6A 2W7ZA 4OJPA 1QQ1A 2VBMA 1O8IA 1PLUA 2NSTA 5AMVA 2VJJA 4XORA 3DU1X 2PECA 2VFPA 2J8IA 4XN0A 1QA3A 3VSTA 2INVA 1IDKA 1PXZA 4XQFA 1PE9A 4W8SA 1KQ5A 2X6XA 3GQ7A 4OJOA 5JLVC 1TYVA 2F3LA 1XG2A 4XN3A 3P4GA 4YZXA 2NTBA 2VFNA 1QA1A 2UVEA 3ML3A 5C1CA 2XTWA 4EW9A 1O8LA 2XT4A 3SQVA 1WMRA 2QXZA 4OZYA 1TSPA 2QY1A 4JRAC 1OOCA 2BSPA 2NSPA 1K4ZA 3EQNA 3FY3A 3JURA 1K8FA 4HWVA 1HG8A 2NTQA 3EQOA 4OJ6A 2X6WA 4MR0A 4YC5A 4Z03A 4XMYA 5DNSA 4C2LA 1KCCA 2O6WA 1O8KA 1BHEA 1RMGA 2VJIA 4XONA 3LYCA 2BM7A 1AIRA 1RU4A 4V02C 1EA0A 4XNFA 4KH3A 4NK8A 2INUA 2NT9A 4YEIA 4Z05A 2Z8GA 3H09A 1O8JA 2VBEA 2IQ7A 1IDJA 1LLZA 2QYUA 2VBKA 4Z06A 1OFMA 1O8GA 4XLFA 4YEJA 4URRA 4W8TA 3BH7B 4AVZA 1QA2A 4XLHA 3RIQA 2X3HA 1EZGA 3LMWA 2V5IA
chains in the Genus database with same CATH topology
3B8YA 3B90A 4U49A 1O8DA 3B4NA 4OJ5A 4XM3A 4MXNA 1O8HA 2NZMA 3GRHA 2O1DA 3VSUA 4YZ0A 1DBOA 1GQ8A 2O0VA 1O88A 4YZAA 2X85A 2X6YA 4XLEA 1DBGA 4XKWA 2EWEA 1JTAA 1K5CA 1X0CA 2ODLA 2NT6A 1VBLA 4XLCA 3GQ8A 1BN8A 1O8MA 1H80A 1CZFA 1OFLA 4XLAA 1O8FA 3WWGA 1IB4A 4W8RA 1KTWA 4OZZA 2UVFA 2O17A 2O0WA 2QX3A 4XR6A 4XOTA 3GQAA 3KRGA 1KCDA 4YZQA 1OGMX 4PMHA 5C1EA 3ZSCA 1OGOX 4I84A 2O04A 2PYGA 4NK6A 1IA5A 1EE6A 1QJVA 3VMWA 3SUCA 4XKVA 3ZPPA 3VMVA 1JRGA 4W8QA 4OJLA 1QCXA 2NTPA 2PYHA 1RWRA 3GQ9A 3T9GA 1NHCA 4XOPA 3UW0A 1O8EA 4OJPA 2VBMA 1O8IA 1PLUA 2NSTA 5AMVA 2VJJA 4XORA 2PECA 4XN0A 3VSTA 2INVA 1IDKA 1PXZA 4XQFA 1PE9A 4W8SA 2X6XA 3GQ7A 4OJOA 1XG2A 4XN3A 4YZXA 2NTBA 2UVEA 5C1CA 4EW9A 1O8LA 1WMRA 2QXZA 4OZYA 2QY1A 1OOCA 2BSPA 2NSPA 3FY3A 3EQNA 3JURA 4U4BA 4HWVA 4OJ6A 1HG8A 2NTQA 3EQOA 4XL9A 2X6WA 4MR0A 4Z03A 3VSVA 4XMYA 4C2LA 1KCCA 1O8KA 1BHEA 1RMGA 2VJIA 4XONA 1AIRA 1RU4A 4XNFA 4NK8A 2INUA 2NT9A 4Z05A 2Z8GA 1O8JA 2VBEA 2IQ7A 1IDJA 2VBKA 4Z06A 1OFMA 1O8GA 4XLFA 4YEJA 4URRA 4W8TA 4AVZA 4XLHA 2X3HA 3LMWA 4YELA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B8Y A;  3B90 A;  4U49 A;  1O8D A;  3B4N A;  4OJ5 A;  4XM3 A;  4MXN A;  1O8H A;  2NZM A;  3GRH A;  2O1D A;  3VSU A;  4YZ0 A;  1DBO A;  1GQ8 A;  2O0V A;  1O88 A;  4YZA A;  2X85 A;  2X6Y A;  4XLE A;  1DBG A;  4XKW A;  2EWE A;  1JTA A;  1K5C A;  1X0C A;  2ODL A;  2NT6 A;  1VBL A;  4XLC A;  3GQ8 A;  1BN8 A;  1O8M A;  1H80 A;  1CZF A;  1OFL A;  4XLA A;  1O8F A;  3WWG A;  1IB4 A;  4W8R A;  1KTW A;  4OZZ A;  2UVF A;  2O17 A;  2O0W A;  2QX3 A;  4XR6 A;  4XOT A;  3GQA A;  3KRG A;  1KCD A;  4YZQ A;  1OGM X;  4PMH A;  5C1E A;  3ZSC A;  1OGO X;  4I84 A;  2O04 A;  2PYG A;  4NK6 A;  1IA5 A;  1EE6 A;  1QJV A;  3VMW A;  3SUC A;  4XKV A;  3ZPP A;  3VMV A;  1JRG A;  4W8Q A;  4OJL A;  1QCX A;  2NTP A;  2PYH A;  1RWR A;  3GQ9 A;  3T9G A;  1NHC A;  4XOP A;  3UW0 A;  1O8E A;  4OJP A;  2VBM A;  1O8I A;  1PLU A;  2NST A;  5AMV A;  2VJJ A;  4XOR A;  2PEC A;  4XN0 A;  3VST A;  2INV A;  1IDK A;  1PXZ A;  4XQF A;  1PE9 A;  4W8S A;  2X6X A;  3GQ7 A;  4OJO A;  1XG2 A;  4XN3 A;  4YZX A;  2NTB A;  2UVE A;  5C1C A;  4EW9 A;  1O8L A;  1WMR A;  2QXZ A;  4OZY A;  2QY1 A;  1OOC A;  2BSP A;  2NSP A;  3FY3 A;  3EQN A;  3JUR A;  4U4B A;  4HWV A;  4OJ6 A;  1HG8 A;  2NTQ A;  3EQO A;  4XL9 A;  2X6W A;  4MR0 A;  4Z03 A;  3VSV A;  4XMY A;  4C2L A;  1KCC A;  1O8K A;  1BHE A;  1RMG A;  2VJI A;  4XON A;  1AIR A;  1RU4 A;  4XNF A;  4NK8 A;  2INU A;  2NT9 A;  4Z05 A;  2Z8G A;  1O8J A;  2VBE A;  2IQ7 A;  1IDJ A;  2VBK A;  4Z06 A;  1OFM A;  1O8G A;  4XLF A;  4YEJ A;  4URR A;  4W8T A;  4AVZ A;  4XLH A;  2X3H A;  3LMW A;  4YEL A; 
#chains in the Genus database with same CATH topology
 3B8Y A;  3N6Z A;  3B90 A;  3AK5 A;  2BM6 A;  4U49 A;  1O8D A;  3B4N A;  2VFQ A;  4OJ5 A;  1CLW A;  4XM3 A;  4MXN A;  1O8H A;  2NZM A;  2J8K A;  3GRH A;  2O1D A;  3VSU A;  4YZ0 A;  1HF2 A;  1DBO A;  1GQ8 A;  2O0V A;  4XL9 A;  3SZE A;  1O88 A;  4YZA A;  2X85 A;  1OFD A;  1OFE A;  3SY2 A;  2VFM A;  2X6Y A;  2YUH A;  4XLE A;  1DAB A;  3BH6 B;  3VSV A;  1DBG A;  4XKW A;  2EWE A;  3LJY A;  1TYW A;  1TYX A;  1JTA A;  3NB2 A;  1K5C A;  1X0C A;  2ODL A;  2G0Y A;  4U4B A;  1L1I A;  2XTY A;  2NT6 A;  3NAW A;  1VBL A;  4XLC A;  4YEL A;  4YDT A;  4YFO A;  3GQ8 A;  2BM4 A;  1LLW A;  1O8M A;  1BN8 A;  1H80 A;  1CZF A;  1OFL A;  4XLA A;  1O8F A;  3WWG A;  1IB4 A;  4W8R A;  1KTW A;  2BM5 A;  3N90 A;  2IOU G;  4OZZ A;  2UVF A;  1QRC A;  2O17 A;  2B0R A;  2O0W A;  2XC1 A;  2QX3 A;  2VFO A;  1LM1 A;  2QZA A;  3SYJ A;  5JMC B;  4XR6 A;  4XOT A;  3GQA A;  3KRG A;  1KCD A;  4YZQ A;  1OGM X;  3JX8 A;  1QRB A;  4PMH A;  5C1E A;  3ZSC A;  2XT2 A;  1OGO X;  4I84 A;  4YCQ A;  2O04 A;  2PYG A;  4NK6 A;  4OM9 A;  1IA5 A;  1EE6 A;  1QJV A;  2XTX A;  4OPW A;  3VMW A;  1WXR A;  3SUC A;  3PET A;  4XKV A;  3ZPP A;  3VMV A;  1JRG A;  4W8Q A;  4OJL A;  3TH0 A;  3PSS A;  1QCX A;  3PSZ A;  2NTP A;  2PYH A;  1RWR A;  3GQ9 A;  3T9G A;  1NHC A;  1TYU A;  4XOP A;  3UW0 A;  1O8E A;  2BX6 A;  2W7Z A;  4OJP A;  1QQ1 A;  2VBM A;  1O8I A;  1PLU A;  2NST A;  5AMV A;  2VJJ A;  4XOR A;  3DU1 X;  2PEC A;  2VFP A;  2J8I A;  4XN0 A;  1QA3 A;  3VST A;  2INV A;  1IDK A;  1PXZ A;  4XQF A;  1PE9 A;  4W8S A;  1KQ5 A;  2X6X A;  3GQ7 A;  4OJO A;  5JLV C;  1TYV A;  2F3L A;  1XG2 A;  4XN3 A;  3P4G A;  4YZX A;  2NTB A;  2VFN A;  1QA1 A;  2UVE A;  3ML3 A;  5C1C A;  2XTW A;  4EW9 A;  1O8L A;  2XT4 A;  3SQV A;  1WMR A;  2QXZ A;  4OZY A;  1TSP A;  2QY1 A;  4JRA C;  1OOC A;  2BSP A;  2NSP A;  1K4Z A;  3EQN A;  3FY3 A;  3JUR A;  1K8F A;  4HWV A;  1HG8 A;  2NTQ A;  3EQO A;  4OJ6 A;  2X6W A;  4MR0 A;  4YC5 A;  4Z03 A;  4XMY A;  5DNS A;  4C2L A;  1KCC A;  2O6W A;  1O8K A;  1BHE A;  1RMG A;  2VJI A;  4XON A;  3LYC A;  2BM7 A;  1AIR A;  1RU4 A;  4V02 C;  1EA0 A;  4XNF A;  4KH3 A;  4NK8 A;  2INU A;  2NT9 A;  4YEI A;  4Z05 A;  2Z8G A;  3H09 A;  1O8J A;  2VBE A;  2IQ7 A;  1IDJ A;  1LLZ A;  2QYU A;  2VBK A;  4Z06 A;  1OFM A;  1O8G A;  4XLF A;  4YEJ A;  4URR A;  4W8T A;  3BH7 B;  4AVZ A;  1QA2 A;  4XLH A;  3RIQ A;  2X3H A;  1EZG A;  3LMW A;  2V5I A; 
#chains in the Genus database with same CATH homology
 3B8Y A;  3B90 A;  4U49 A;  1O8D A;  3B4N A;  4OJ5 A;  4XM3 A;  4MXN A;  1O8H A;  2NZM A;  3GRH A;  2O1D A;  3VSU A;  4YZ0 A;  1DBO A;  1GQ8 A;  2O0V A;  1O88 A;  4YZA A;  2X85 A;  2X6Y A;  4XLE A;  1DBG A;  4XKW A;  2EWE A;  1JTA A;  1K5C A;  1X0C A;  2ODL A;  2NT6 A;  1VBL A;  4XLC A;  3GQ8 A;  1BN8 A;  1O8M A;  1H80 A;  1CZF A;  1OFL A;  4XLA A;  1O8F A;  3WWG A;  1IB4 A;  4W8R A;  1KTW A;  4OZZ A;  2UVF A;  2O17 A;  2O0W A;  2QX3 A;  4XR6 A;  4XOT A;  3GQA A;  3KRG A;  1KCD A;  4YZQ A;  1OGM X;  4PMH A;  5C1E A;  3ZSC A;  1OGO X;  4I84 A;  2O04 A;  2PYG A;  4NK6 A;  1IA5 A;  1EE6 A;  1QJV A;  3VMW A;  3SUC A;  4XKV A;  3ZPP A;  3VMV A;  1JRG A;  4W8Q A;  4OJL A;  1QCX A;  2NTP A;  2PYH A;  1RWR A;  3GQ9 A;  3T9G A;  1NHC A;  4XOP A;  3UW0 A;  1O8E A;  4OJP A;  2VBM A;  1O8I A;  1PLU A;  2NST A;  5AMV A;  2VJJ A;  4XOR A;  2PEC A;  4XN0 A;  3VST A;  2INV A;  1IDK A;  1PXZ A;  4XQF A;  1PE9 A;  4W8S A;  2X6X A;  3GQ7 A;  4OJO A;  1XG2 A;  4XN3 A;  4YZX A;  2NTB A;  2UVE A;  5C1C A;  4EW9 A;  1O8L A;  1WMR A;  2QXZ A;  4OZY A;  2QY1 A;  1OOC A;  2BSP A;  2NSP A;  3FY3 A;  3EQN A;  3JUR A;  4U4B A;  4HWV A;  4OJ6 A;  1HG8 A;  2NTQ A;  3EQO A;  4XL9 A;  2X6W A;  4MR0 A;  4Z03 A;  3VSV A;  4XMY A;  4C2L A;  1KCC A;  1O8K A;  1BHE A;  1RMG A;  2VJI A;  4XON A;  1AIR A;  1RU4 A;  4XNF A;  4NK8 A;  2INU A;  2NT9 A;  4Z05 A;  2Z8G A;  1O8J A;  2VBE A;  2IQ7 A;  1IDJ A;  2VBK A;  4Z06 A;  1OFM A;  1O8G A;  4XLF A;  4YEJ A;  4URR A;  4W8T A;  4AVZ A;  4XLH A;  2X3H A;  3LMW A;  4YEL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...