4OZYA

Crystal structure of the periplasmic alginate epimerase algg t265n mutant
Total Genus 169
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
169
sequence length
423
structure length
420
Chain Sequence
b'EMAKPVLPDLSGYTTEAALKKIARNKPGKITVARMMEETGLKEFIGGDNKMAEWVVRQKGIPQAIMISDGYVNLQDLVKKVPKQFLSEVSPGVYVARLPILVKETGIFEIDSKTKELRLSQEGSFIVSEGKMLITNTSVNAWSETRNGLAAYRTPDEFRPFVLTWGGSQTWIAKTKMASMGYNQSSYGVSISQYNPNTAKVLKRGEPTGWIIDSEFADMWYGFYCYETRDFVVKGNTYRDNIVYGIDPHDRSHGLIIAENDVYGTKKKHGIIISREVDNSFIFRNSHNNKLSGVVLDRNSVGNIVAYNEIYQNHTDGITLYESGNNLLWGNRVIANRRHGIRVRNSVNIKLYENVAMANGLMGVYGHIKDLNDTDRDIELDPFDAQVSLIMVGGELSSNGSGPLSIDSPLSVELYRVSML'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Poly(beta-D-mannuronate) C5 epimerase
publication title Crystal Structure of the periplasmic alginate epimerase AlgG T265N mutant
rcsb
source organism Pseudomonas syringae pv. tomato
molecule tags Isomerase
total genus 169
structure length 420
sequence length 423
ec nomenclature ec 5.1.3.37: Mannuronan 5-epimerase.
pdb deposition date 2014-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13229 Beta_helix Right handed beta helix region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4ozyA00
2VBEA 4YZQA 3GQ7A 4PMHA 3GQ9A 1KCCA 4OZZA 4AVZA 1O8IA 1IA5A 2Z8GA 3GRHA 1KCDA 2O0VA 1O8GA 4MR0A 1OOCA 3T9GA 4URRA 3VMWA 1DBGA 4OJ5A 1WMRA 3GQ8A 4OZYA 3EQNA 2NT6A 2O04A 4I84A 3KRGA 2PYGA 1QJVA 4OJOA 1JRGA 1NHCA 1RMGA 3B4NA 4YEJA 2UVFA 2NSPA 4XM3A 1JTAA 4XLEA 4XLHA 4XQFA 4EW9A 4W8TA 2X6YA 4YZXA 3VSUA 1OGOX 2IQ7A 3UW0A 2INUA 4NK6A 4XKWA 1O8MA 1OGMX 1RWRA 4YZ0A 2PECA 2VJIA 1O8JA 4XKVA 2BSPA 1IDJA 2QX3A 2NZMA 2O0WA 4C2LA 4YELA 1H80A 3FY3A 1BHEA 1KTWA 1EE6A 1O88A 4OJ6A 2NTQA 1RU4A 1K5CA 1PLUA 4XN0A 1BN8A 4XLCA 5C1CA 4XLFA 4YZAA 5AMVA 2X6XA 3WWGA 4MXNA 1X0CA 4XMYA 1PXZA 2NSTA 4XL9A 3SUCA 5C1EA 2QY1A 4XONA 1GQ8A 1PE9A 1O8KA 2VBKA 1OFMA 4W8RA 4Z03A 1IB4A 3EQOA 4Z06A 4XORA 2INVA 2QXZA 2VJJA 3LMWA 2O1DA 1OFLA 2NT9A 1CZFA 2O17A 3GQAA 2X3HA 4U4BA 4XLAA 3VSTA 1O8EA 3ZSCA 2X6WA 3JURA 1O8HA 2PYHA 2X85A 4XR6A 2EWEA 4XN3A 1IDKA 2UVEA 3B90A 4OJPA 4XNFA 4W8SA 4XOTA 4OJLA 4XOPA 1DBOA 1HG8A 2NTPA 4U49A 4HWVA 4W8QA 4NK8A 1O8LA 1O8DA 1XG2A 1O8FA 2VBMA 3B8YA 4Z05A 1QCXA 2NTBA 3ZPPA 1AIRA 2ODLA 3VSVA 3VMVA 1VBLA
chains in the Genus database with same CATH superfamily
2VBEA 4YZQA 1QA1A 3GQ7A 4PMHA 3LYCA 2B0RA 3JX8A 3GQ9A 1KCCA 4OZZA 2QZAA 1O8IA 4AVZA 1IA5A 2Z8GA 2J8IA 3GRHA 1KCDA 2O0VA 1O8GA 2VFQA 4MR0A 1EZGA 1L1IA 1OOCA 2XTWA 3T9GA 4URRA 3VMWA 5JMCB 1DBGA 4OJ5A 3ML3A 3H09A 1WMRA 3GQ8A 3SY2A 4OZYA 5DNSA 3EQNA 2BM7A 2NT6A 2O04A 4I84A 3KRGA 4V02C 2PYGA 1QJVA 2VFPA 1JRGA 4OJOA 4OM9A 1NHCA 1RMGA 2VFMA 3B4NA 2V5IA 4YEJA 1QRBA 1TYWA 2UVFA 2NSPA 4XM3A 1JTAA 2QYUA 4XLEA 2BM6A 4XLHA 4XQFA 2BM5A 4EW9A 4W8TA 2X6YA 1OFDA 2XTYA 4YZXA 3VSUA 1OGOX 2IQ7A 3UW0A 2INUA 4NK6A 3N90A 4XKWA 2J8KA 1O8MA 1OGMX 1RWRA 4YZ0A 2PECA 2VJIA 1O8JA 4XKVA 2F3LA 2W7ZA 2BSPA 1IDJA 2QX3A 5JLVC 2NZMA 2O0WA 4C2LA 1OFEA 1K4ZA 1TYUA 4YELA 1H80A 3FY3A 2VFOA 1BHEA 4YFOA 1KTWA 1EE6A 1O88A 2VFNA 4OJ6A 2NTQA 3N6ZA 1RU4A 2XTXA 1K5CA 1PLUA 4XN0A 1BN8A 4XLCA 5C1CA 3SYJA 4XLFA 4YZAA 1TYVA 1K8FA 3P4GA 3SZEA 5AMVA 2X6XA 4KH3A 1QRCA 2BM4A 3AK5A 3WWGA 4MXNA 1X0CA 4YCQA 3DU1X 4XMYA 1PXZA 3BH7B 2NSTA 3NAWA 3NB2A 4XL9A 5C1EA 3SUCA 2QY1A 2BX6A 4XONA 1GQ8A 2IOUG 2XT4A 1PE9A 3PSZA 1O8KA 2VBKA 2XC1A 1OFMA 1QA2A 3SQVA 4W8RA 1HF2A 4YDTA 4Z03A 1IB4A 3EQOA 4Z06A 3RIQA 1EA0A 4XORA 2INVA 2QXZA 2VJJA 1DABA 3LMWA 4YC5A 1LM1A 1OFLA 2NT9A 1QQ1A 2O1DA 1CZFA 2O17A 3GQAA 2X3HA 4U4BA 3TH0A 4JRAC 4XLAA 3VSTA 1O8EA 3ZSCA 1LLWA 2X6WA 1O8HA 2PYHA 2X85A 3JURA 3BH6B 3LJYA 4XR6A 2EWEA 4XN3A 1IDKA 2UVEA 3B90A 1KQ5A 4OJPA 4XNFA 2G0YA 4W8SA 4XOTA 4OJLA 2O6WA 4XOPA 1TSPA 2YUHA 1DBOA 1HG8A 2NTPA 4U49A 1WXRA 4HWVA 4W8QA 1QA3A 4NK8A 1O8LA 1O8DA 1XG2A 1O8FA 3PSSA 2VBMA 1TYXA 3PETA 1CLWA 3B8YA 4YEIA 4Z05A 1QCXA 2NTBA 3ZPPA 1AIRA 2XT2A 2ODLA 1LLZA 4OPWA 3VSVA 3VMVA 1VBLA
chains in the Genus database with same CATH topology
2VBEA 4YZQA 3GQ7A 4PMHA 3GQ9A 1KCCA 4OZZA 4AVZA 1O8IA 1IA5A 2Z8GA 3GRHA 1KCDA 2O0VA 1O8GA 4MR0A 1OOCA 3T9GA 4URRA 3VMWA 1DBGA 4OJ5A 1WMRA 3GQ8A 4OZYA 3EQNA 2NT6A 2O04A 4I84A 3KRGA 2PYGA 1QJVA 4OJOA 1JRGA 1NHCA 1RMGA 3B4NA 4YEJA 2UVFA 2NSPA 4XM3A 1JTAA 4XLEA 4XLHA 4XQFA 4EW9A 4W8TA 2X6YA 4YZXA 3VSUA 1OGOX 2IQ7A 3UW0A 2INUA 4NK6A 4XKWA 1O8MA 1OGMX 1RWRA 4YZ0A 2PECA 2VJIA 1O8JA 4XKVA 2BSPA 1IDJA 2QX3A 2NZMA 2O0WA 4C2LA 4YELA 1H80A 3FY3A 1BHEA 1KTWA 1EE6A 1O88A 4OJ6A 2NTQA 1RU4A 1K5CA 1PLUA 4XN0A 1BN8A 4XLCA 5C1CA 4XLFA 4YZAA 5AMVA 2X6XA 3WWGA 4MXNA 1X0CA 4XMYA 1PXZA 2NSTA 4XL9A 3SUCA 5C1EA 2QY1A 4XONA 1GQ8A 1PE9A 1O8KA 2VBKA 1OFMA 4W8RA 4Z03A 1IB4A 3EQOA 4Z06A 4XORA 2INVA 2QXZA 2VJJA 3LMWA 2O1DA 1OFLA 2NT9A 1CZFA 2O17A 3GQAA 2X3HA 4U4BA 4XLAA 3VSTA 1O8EA 3ZSCA 2X6WA 3JURA 1O8HA 2PYHA 2X85A 4XR6A 2EWEA 4XN3A 1IDKA 2UVEA 3B90A 4OJPA 4XNFA 4W8SA 4XOTA 4OJLA 4XOPA 1DBOA 1HG8A 2NTPA 4U49A 4HWVA 4W8QA 4NK8A 1O8LA 1O8DA 1XG2A 1O8FA 2VBMA 3B8YA 4Z05A 1QCXA 2NTBA 3ZPPA 1AIRA 2ODLA 3VSVA 3VMVA 1VBLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VBE A;  4YZQ A;  3GQ7 A;  4PMH A;  3GQ9 A;  1KCC A;  4OZZ A;  4AVZ A;  1O8I A;  1IA5 A;  2Z8G A;  3GRH A;  1KCD A;  2O0V A;  1O8G A;  4MR0 A;  1OOC A;  3T9G A;  4URR A;  3VMW A;  1DBG A;  4OJ5 A;  1WMR A;  3GQ8 A;  4OZY A;  3EQN A;  2NT6 A;  2O04 A;  4I84 A;  3KRG A;  2PYG A;  1QJV A;  4OJO A;  1JRG A;  1NHC A;  1RMG A;  3B4N A;  4YEJ A;  2UVF A;  2NSP A;  4XM3 A;  1JTA A;  4XLE A;  4XLH A;  4XQF A;  4EW9 A;  4W8T A;  2X6Y A;  4YZX A;  3VSU A;  1OGO X;  2IQ7 A;  3UW0 A;  2INU A;  4NK6 A;  4XKW A;  1O8M A;  1OGM X;  1RWR A;  4YZ0 A;  2PEC A;  2VJI A;  1O8J A;  4XKV A;  2BSP A;  1IDJ A;  2QX3 A;  2NZM A;  2O0W A;  4C2L A;  4YEL A;  1H80 A;  3FY3 A;  1BHE A;  1KTW A;  1EE6 A;  1O88 A;  4OJ6 A;  2NTQ A;  1RU4 A;  1K5C A;  1PLU A;  4XN0 A;  1BN8 A;  4XLC A;  5C1C A;  4XLF A;  4YZA A;  5AMV A;  2X6X A;  3WWG A;  4MXN A;  1X0C A;  4XMY A;  1PXZ A;  2NST A;  4XL9 A;  3SUC A;  5C1E A;  2QY1 A;  4XON A;  1GQ8 A;  1PE9 A;  1O8K A;  2VBK A;  1OFM A;  4W8R A;  4Z03 A;  1IB4 A;  3EQO A;  4Z06 A;  4XOR A;  2INV A;  2QXZ A;  2VJJ A;  3LMW A;  2O1D A;  1OFL A;  2NT9 A;  1CZF A;  2O17 A;  3GQA A;  2X3H A;  4U4B A;  4XLA A;  3VST A;  1O8E A;  3ZSC A;  2X6W A;  3JUR A;  1O8H A;  2PYH A;  2X85 A;  4XR6 A;  2EWE A;  4XN3 A;  1IDK A;  2UVE A;  3B90 A;  4OJP A;  4XNF A;  4W8S A;  4XOT A;  4OJL A;  4XOP A;  1DBO A;  1HG8 A;  2NTP A;  4U49 A;  4HWV A;  4W8Q A;  4NK8 A;  1O8L A;  1O8D A;  1XG2 A;  1O8F A;  2VBM A;  3B8Y A;  4Z05 A;  1QCX A;  2NTB A;  3ZPP A;  1AIR A;  2ODL A;  3VSV A;  3VMV A;  1VBL A; 
#chains in the Genus database with same CATH topology
 2VBE A;  4YZQ A;  1QA1 A;  3GQ7 A;  4PMH A;  3LYC A;  2B0R A;  3JX8 A;  3GQ9 A;  1KCC A;  4OZZ A;  2QZA A;  1O8I A;  4AVZ A;  1IA5 A;  2Z8G A;  2J8I A;  3GRH A;  1KCD A;  2O0V A;  1O8G A;  2VFQ A;  4MR0 A;  1EZG A;  1L1I A;  1OOC A;  2XTW A;  3T9G A;  4URR A;  3VMW A;  5JMC B;  1DBG A;  4OJ5 A;  3ML3 A;  3H09 A;  1WMR A;  3GQ8 A;  3SY2 A;  4OZY A;  5DNS A;  3EQN A;  2BM7 A;  2NT6 A;  2O04 A;  4I84 A;  3KRG A;  4V02 C;  2PYG A;  1QJV A;  2VFP A;  1JRG A;  4OJO A;  4OM9 A;  1NHC A;  1RMG A;  2VFM A;  3B4N A;  2V5I A;  4YEJ A;  1QRB A;  1TYW A;  2UVF A;  2NSP A;  4XM3 A;  1JTA A;  2QYU A;  4XLE A;  2BM6 A;  4XLH A;  4XQF A;  2BM5 A;  4EW9 A;  4W8T A;  2X6Y A;  1OFD A;  2XTY A;  4YZX A;  3VSU A;  1OGO X;  2IQ7 A;  3UW0 A;  2INU A;  4NK6 A;  3N90 A;  4XKW A;  2J8K A;  1O8M A;  1OGM X;  1RWR A;  4YZ0 A;  2PEC A;  2VJI A;  1O8J A;  4XKV A;  2F3L A;  2W7Z A;  2BSP A;  1IDJ A;  2QX3 A;  5JLV C;  2NZM A;  2O0W A;  4C2L A;  1OFE A;  1K4Z A;  1TYU A;  4YEL A;  1H80 A;  3FY3 A;  2VFO A;  1BHE A;  4YFO A;  1KTW A;  1EE6 A;  1O88 A;  2VFN A;  4OJ6 A;  2NTQ A;  3N6Z A;  1RU4 A;  2XTX A;  1K5C A;  1PLU A;  4XN0 A;  1BN8 A;  4XLC A;  5C1C A;  3SYJ A;  4XLF A;  4YZA A;  1TYV A;  1K8F A;  3P4G A;  3SZE A;  5AMV A;  2X6X A;  4KH3 A;  1QRC A;  2BM4 A;  3AK5 A;  3WWG A;  4MXN A;  1X0C A;  4YCQ A;  3DU1 X;  4XMY A;  1PXZ A;  3BH7 B;  2NST A;  3NAW A;  3NB2 A;  4XL9 A;  5C1E A;  3SUC A;  2QY1 A;  2BX6 A;  4XON A;  1GQ8 A;  2IOU G;  2XT4 A;  1PE9 A;  3PSZ A;  1O8K A;  2VBK A;  2XC1 A;  1OFM A;  1QA2 A;  3SQV A;  4W8R A;  1HF2 A;  4YDT A;  4Z03 A;  1IB4 A;  3EQO A;  4Z06 A;  3RIQ A;  1EA0 A;  4XOR A;  2INV A;  2QXZ A;  2VJJ A;  1DAB A;  3LMW A;  4YC5 A;  1LM1 A;  1OFL A;  2NT9 A;  1QQ1 A;  2O1D A;  1CZF A;  2O17 A;  3GQA A;  2X3H A;  4U4B A;  3TH0 A;  4JRA C;  4XLA A;  3VST A;  1O8E A;  3ZSC A;  1LLW A;  2X6W A;  1O8H A;  2PYH A;  2X85 A;  3JUR A;  3BH6 B;  3LJY A;  4XR6 A;  2EWE A;  4XN3 A;  1IDK A;  2UVE A;  3B90 A;  1KQ5 A;  4OJP A;  4XNF A;  2G0Y A;  4W8S A;  4XOT A;  4OJL A;  2O6W A;  4XOP A;  1TSP A;  2YUH A;  1DBO A;  1HG8 A;  2NTP A;  4U49 A;  1WXR A;  4HWV A;  4W8Q A;  1QA3 A;  4NK8 A;  1O8L A;  1O8D A;  1XG2 A;  1O8F A;  3PSS A;  2VBM A;  1TYX A;  3PET A;  1CLW A;  3B8Y A;  4YEI A;  4Z05 A;  1QCX A;  2NTB A;  3ZPP A;  1AIR A;  2XT2 A;  2ODL A;  1LLZ A;  4OPW A;  3VSV A;  3VMV A;  1VBL A; 
#chains in the Genus database with same CATH homology
 2VBE A;  4YZQ A;  3GQ7 A;  4PMH A;  3GQ9 A;  1KCC A;  4OZZ A;  4AVZ A;  1O8I A;  1IA5 A;  2Z8G A;  3GRH A;  1KCD A;  2O0V A;  1O8G A;  4MR0 A;  1OOC A;  3T9G A;  4URR A;  3VMW A;  1DBG A;  4OJ5 A;  1WMR A;  3GQ8 A;  4OZY A;  3EQN A;  2NT6 A;  2O04 A;  4I84 A;  3KRG A;  2PYG A;  1QJV A;  4OJO A;  1JRG A;  1NHC A;  1RMG A;  3B4N A;  4YEJ A;  2UVF A;  2NSP A;  4XM3 A;  1JTA A;  4XLE A;  4XLH A;  4XQF A;  4EW9 A;  4W8T A;  2X6Y A;  4YZX A;  3VSU A;  1OGO X;  2IQ7 A;  3UW0 A;  2INU A;  4NK6 A;  4XKW A;  1O8M A;  1OGM X;  1RWR A;  4YZ0 A;  2PEC A;  2VJI A;  1O8J A;  4XKV A;  2BSP A;  1IDJ A;  2QX3 A;  2NZM A;  2O0W A;  4C2L A;  4YEL A;  1H80 A;  3FY3 A;  1BHE A;  1KTW A;  1EE6 A;  1O88 A;  4OJ6 A;  2NTQ A;  1RU4 A;  1K5C A;  1PLU A;  4XN0 A;  1BN8 A;  4XLC A;  5C1C A;  4XLF A;  4YZA A;  5AMV A;  2X6X A;  3WWG A;  4MXN A;  1X0C A;  4XMY A;  1PXZ A;  2NST A;  4XL9 A;  3SUC A;  5C1E A;  2QY1 A;  4XON A;  1GQ8 A;  1PE9 A;  1O8K A;  2VBK A;  1OFM A;  4W8R A;  4Z03 A;  1IB4 A;  3EQO A;  4Z06 A;  4XOR A;  2INV A;  2QXZ A;  2VJJ A;  3LMW A;  2O1D A;  1OFL A;  2NT9 A;  1CZF A;  2O17 A;  3GQA A;  2X3H A;  4U4B A;  4XLA A;  3VST A;  1O8E A;  3ZSC A;  2X6W A;  3JUR A;  1O8H A;  2PYH A;  2X85 A;  4XR6 A;  2EWE A;  4XN3 A;  1IDK A;  2UVE A;  3B90 A;  4OJP A;  4XNF A;  4W8S A;  4XOT A;  4OJL A;  4XOP A;  1DBO A;  1HG8 A;  2NTP A;  4U49 A;  4HWV A;  4W8Q A;  4NK8 A;  1O8L A;  1O8D A;  1XG2 A;  1O8F A;  2VBM A;  3B8Y A;  4Z05 A;  1QCX A;  2NTB A;  3ZPP A;  1AIR A;  2ODL A;  3VSV A;  3VMV A;  1VBL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...