4OZYA

Crystal structure of the periplasmic alginate epimerase algg t265n mutant
Total Genus 169
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
169
sequence length
423
structure length
420
Chain Sequence
EMAKPVLPDLSGYTTEAALKKIARNKPGKITVARMMEETGLKEFIGGDNKMAEWVVRQKGIPQAIMISDGYVNLQDLVKKVPKQFLSEVSPGVYVARLPILVKETGIFEIDSKTKELRLSQEGSFIVSEGKMLITNTSVNAWSETRNGLAAYRTPDEFRPFVLTWGGSQTWIAKTKMASMGYNQSSYGVSISQYNPNTAKVLKRGEPTGWIIDSEFADMWYGFYCYETRDFVVKGNTYRDNIVYGIDPHDRSHGLIIAENDVYGTKKKHGIIISREVDNSFIFRNSHNNKLSGVVLDRNSVGNIVAYNEIYQNHTDGITLYESGNNLLWGNRVIANRRHGIRVRNSVNIKLYENVAMANGLMGVYGHIKDLNDTDRDIELDPFDAQVSLIMVGGELSSNGSGPLSIDSPLSVELYRVSML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of the periplasmic alginate epimerase AlgG T265N mutant
rcsb
source organism Pseudomonas syringae pv. tomato
molecule tags Isomerase
molecule keywords Poly(beta-D-mannuronate) C5 epimerase
total genus 169
structure length 420
sequence length 423
ec nomenclature ec 5.1.3.37: Mannuronan 5-epimerase.
pdb deposition date 2014-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13229 Beta_helix Right handed beta helix region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4ozyA00
1OFLA 1IB4A 3GQAA 4XM3A 4MXNA 1DBGA 1PXZA 1IDJA 2X6WA 3EQNA 5C1CA 1O8DA 1IA5A 2IQ7A 3T9GA 4XKWA 2VBEA 5AMVA 1HG8A 2ODLA 2INUA 4W8QA 2PYGA 4U4BA 4HWVA 4XLHA 2VBMA 4XONA 2UVEA 4XNFA 1DBOA 1XG2A 4C2LA 4OZZA 1O8JA 1QJVA 2NTBA 2QY1A 3ZPPA 2NTQA 1O88A 4XN3A 2NTPA 1OGMX 3LMWA 4PMHA 2PYHA 2O1DA 1BHEA 4EW9A 3GQ9A 4U49A 2NT6A 1RWRA 4YEJA 1O8MA 2NSTA 4YZAA 1JTAA 5C1EA 2QXZA 2QX3A 4YZQA 4YELA 4XR6A 1NHCA 1PE9A 2VJJA 1JRGA 1X0CA 4NK6A 4XQFA 3FY3A 3ZSCA 1KTWA 4URRA 2X3HA 2Z8GA 3KRGA 1GQ8A 4W8RA 1O8IA 3JURA 3VMVA 2UVFA 4Z06A 1O8GA 4XLFA 3B4NA 1KCCA 4XMYA 3VSUA 4XL9A 3SUCA 1O8EA 1WMRA 3VSVA 2NSPA 2X85A 1H80A 1IDKA 1O8LA 1QCXA 4XORA 1AIRA 2NZMA 4OJOA 4I84A 4XN0A 4YZXA 4XOTA 3VMWA 2VJIA 4OJ5A 2INVA 4NK8A 3WWGA 4OJ6A 1PLUA 1O8FA 1O8HA 3GRHA 4XLEA 1VBLA 3GQ7A 4W8SA 2X6XA 2X6YA 1KCDA 3B90A 1EE6A 2VBKA 2O17A 1RU4A 3GQ8A 4Z03A 2O0VA 3EQOA 3UW0A 4XLCA 1OOCA 4XLAA 1O8KA 4AVZA 4OJLA 4MR0A 2O0WA 2EWEA 4W8TA 3B8YA 4YZ0A 1OGOX 2BSPA 4Z05A 4OZYA 1BN8A 4OJPA 3VSTA 1K5CA 2O04A 1CZFA 4XKVA 4XOPA 1RMGA 1OFMA 2PECA 2NT9A
chains in the Genus database with same CATH superfamily
1OFLA 2VFQA 1IB4A 3GQAA 3BH7B 4XM3A 4MXNA 1DBGA 1L1IA 1PXZA 1IDJA 2X6WA 3EQNA 5C1CA 3TH0A 1O8DA 1IA5A 2IQ7A 3T9GA 4XKWA 2VBEA 1QRBA 5AMVA 1HG8A 2ODLA 2INUA 4W8QA 2PYGA 4U4BA 4HWVA 2XT4A 2VBMA 4XLHA 2UVEA 3H09A 4XONA 2VFNA 1DBOA 1XG2A 2O6WA 3PETA 2VFMA 4C2LA 4OZZA 2J8IA 1O8JA 3LJYA 1QQ1A 4V02C 1QJVA 2NTBA 2QY1A 2V5IA 2VFPA 3ZPPA 2NTQA 1O88A 4XN3A 2NTPA 1OGMX 2G0YA 1K4ZA 3LMWA 3P4GA 4PMHA 2O1DA 2PYHA 1BHEA 4EW9A 2BM7A 3GQ9A 2F3LA 2VFOA 4U49A 2NT6A 4YCQA 1RWRA 3LYCA 4YEJA 1O8MA 2NSTA 4YZAA 1JTAA 3N6ZA 5C1EA 2QXZA 2QX3A 4YZQA 4YELA 2XTYA 4XR6A 1NHCA 1PE9A 2VJJA 1JRGA 4YDTA 5JLVC 1X0CA 2J8KA 3BH6B 4NK6A 1EZGA 4XQFA 4OM9A 3FY3A 3ZSCA 1LLWA 1KTWA 1CLWA 1LM1A 1OFDA 2X3HA 4URRA 2Z8GA 4KH3A 4JRAC 3KRGA 1GQ8A 4W8RA 1O8IA 3JURA 3VMVA 2UVFA 4YC5A 1HF2A 4Z06A 1O8GA 4XLFA 2XC1A 3NAWA 3SYJA 5JMCB 3B4NA 1KCCA 1EA0A 4XMYA 1WXRA 3WWGA 3VSUA 4XL9A 1TYWA 2IOUG 2BM4A 3SUCA 4OPWA 3JX8A 1O8EA 1WMRA 3VSVA 2NSPA 2XT2A 2X85A 1H80A 1IDKA 3SZEA 2BX6A 1O8LA 1QCXA 1TYXA 4XORA 1AIRA 3RIQA 1QA2A 2NZMA 4OJOA 4I84A 4XN0A 1K8FA 3PSSA 4XOTA 2BM6A 4YZXA 3VMWA 2VJIA 4OJ5A 2INVA 4NK8A 5DNSA 2W7ZA 3ML3A 4OJ6A 3NB2A 1PLUA 4YFOA 1O8FA 1O8HA 2B0RA 3GRHA 3SY2A 1QA1A 4XLEA 1VBLA 3GQ7A 3N90A 4W8SA 4YEIA 1LLZA 2X6YA 2X6XA 1KCDA 3B90A 1EE6A 2VBKA 2O17A 1RU4A 3GQ8A 4Z03A 2BM5A 2O0VA 2QYUA 3EQOA 3PSZA 3UW0A 1DABA 4XLCA 1OOCA 2XTWA 1O8KA 1TSPA 4XLAA 4AVZA 4OJLA 3AK5A 1TYVA 4MR0A 2O0WA 2QZAA 2EWEA 3DU1X 1TYUA 3B8YA 4W8TA 4YZ0A 1OGOX 2BSPA 4Z05A 4OZYA 4XNFA 1BN8A 4OJPA 3VSTA 1K5CA 2O04A 1KQ5A 1CZFA 4XKVA 1OFEA 4XOPA 2XTXA 1RMGA 2YUHA 1OFMA 1QRCA 3SQVA 1QA3A 2PECA 2NT9A
chains in the Genus database with same CATH topology
1OFLA 1IB4A 3GQAA 4XM3A 4MXNA 1DBGA 1PXZA 1IDJA 2X6WA 3EQNA 5C1CA 1O8DA 1IA5A 2IQ7A 3T9GA 4XKWA 2VBEA 5AMVA 1HG8A 2ODLA 2INUA 4W8QA 2PYGA 4U4BA 4HWVA 4XLHA 2VBMA 4XONA 2UVEA 4XNFA 1DBOA 1XG2A 4C2LA 4OZZA 1O8JA 1QJVA 2NTBA 2QY1A 3ZPPA 2NTQA 1O88A 4XN3A 2NTPA 1OGMX 3LMWA 4PMHA 2PYHA 2O1DA 1BHEA 4EW9A 3GQ9A 4U49A 2NT6A 1RWRA 4YEJA 1O8MA 2NSTA 4YZAA 1JTAA 5C1EA 2QXZA 2QX3A 4YZQA 4YELA 4XR6A 1NHCA 1PE9A 2VJJA 1JRGA 1X0CA 4NK6A 4XQFA 3FY3A 3ZSCA 1KTWA 4URRA 2X3HA 2Z8GA 3KRGA 1GQ8A 4W8RA 1O8IA 3JURA 3VMVA 2UVFA 4Z06A 1O8GA 4XLFA 3B4NA 1KCCA 4XMYA 3VSUA 4XL9A 3SUCA 1O8EA 1WMRA 3VSVA 2NSPA 2X85A 1H80A 1IDKA 1O8LA 1QCXA 4XORA 1AIRA 2NZMA 4OJOA 4I84A 4XN0A 4YZXA 4XOTA 3VMWA 2VJIA 4OJ5A 2INVA 4NK8A 3WWGA 4OJ6A 1PLUA 1O8FA 1O8HA 3GRHA 4XLEA 1VBLA 3GQ7A 4W8SA 2X6XA 2X6YA 1KCDA 3B90A 1EE6A 2VBKA 2O17A 1RU4A 3GQ8A 4Z03A 2O0VA 3EQOA 3UW0A 4XLCA 1OOCA 4XLAA 1O8KA 4AVZA 4OJLA 4MR0A 2O0WA 2EWEA 4W8TA 3B8YA 4YZ0A 1OGOX 2BSPA 4Z05A 4OZYA 1BN8A 4OJPA 3VSTA 1K5CA 2O04A 1CZFA 4XKVA 4XOPA 1RMGA 1OFMA 2PECA 2NT9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OFL A;  1IB4 A;  3GQA A;  4XM3 A;  4MXN A;  1DBG A;  1PXZ A;  1IDJ A;  2X6W A;  3EQN A;  5C1C A;  1O8D A;  1IA5 A;  2IQ7 A;  3T9G A;  4XKW A;  2VBE A;  5AMV A;  1HG8 A;  2ODL A;  2INU A;  4W8Q A;  2PYG A;  4U4B A;  4HWV A;  4XLH A;  2VBM A;  4XON A;  2UVE A;  4XNF A;  1DBO A;  1XG2 A;  4C2L A;  4OZZ A;  1O8J A;  1QJV A;  2NTB A;  2QY1 A;  3ZPP A;  2NTQ A;  1O88 A;  4XN3 A;  2NTP A;  1OGM X;  3LMW A;  4PMH A;  2PYH A;  2O1D A;  1BHE A;  4EW9 A;  3GQ9 A;  4U49 A;  2NT6 A;  1RWR A;  4YEJ A;  1O8M A;  2NST A;  4YZA A;  1JTA A;  5C1E A;  2QXZ A;  2QX3 A;  4YZQ A;  4YEL A;  4XR6 A;  1NHC A;  1PE9 A;  2VJJ A;  1JRG A;  1X0C A;  4NK6 A;  4XQF A;  3FY3 A;  3ZSC A;  1KTW A;  4URR A;  2X3H A;  2Z8G A;  3KRG A;  1GQ8 A;  4W8R A;  1O8I A;  3JUR A;  3VMV A;  2UVF A;  4Z06 A;  1O8G A;  4XLF A;  3B4N A;  1KCC A;  4XMY A;  3VSU A;  4XL9 A;  3SUC A;  1O8E A;  1WMR A;  3VSV A;  2NSP A;  2X85 A;  1H80 A;  1IDK A;  1O8L A;  1QCX A;  4XOR A;  1AIR A;  2NZM A;  4OJO A;  4I84 A;  4XN0 A;  4YZX A;  4XOT A;  3VMW A;  2VJI A;  4OJ5 A;  2INV A;  4NK8 A;  3WWG A;  4OJ6 A;  1PLU A;  1O8F A;  1O8H A;  3GRH A;  4XLE A;  1VBL A;  3GQ7 A;  4W8S A;  2X6X A;  2X6Y A;  1KCD A;  3B90 A;  1EE6 A;  2VBK A;  2O17 A;  1RU4 A;  3GQ8 A;  4Z03 A;  2O0V A;  3EQO A;  3UW0 A;  4XLC A;  1OOC A;  4XLA A;  1O8K A;  4AVZ A;  4OJL A;  4MR0 A;  2O0W A;  2EWE A;  4W8T A;  3B8Y A;  4YZ0 A;  1OGO X;  2BSP A;  4Z05 A;  4OZY A;  1BN8 A;  4OJP A;  3VST A;  1K5C A;  2O04 A;  1CZF A;  4XKV A;  4XOP A;  1RMG A;  1OFM A;  2PEC A;  2NT9 A; 
#chains in the Genus database with same CATH topology
 1OFL A;  2VFQ A;  1IB4 A;  3GQA A;  3BH7 B;  4XM3 A;  4MXN A;  1DBG A;  1L1I A;  1PXZ A;  1IDJ A;  2X6W A;  3EQN A;  5C1C A;  3TH0 A;  1O8D A;  1IA5 A;  2IQ7 A;  3T9G A;  4XKW A;  2VBE A;  1QRB A;  5AMV A;  1HG8 A;  2ODL A;  2INU A;  4W8Q A;  2PYG A;  4U4B A;  4HWV A;  2XT4 A;  2VBM A;  4XLH A;  2UVE A;  3H09 A;  4XON A;  2VFN A;  1DBO A;  1XG2 A;  2O6W A;  3PET A;  2VFM A;  4C2L A;  4OZZ A;  2J8I A;  1O8J A;  3LJY A;  1QQ1 A;  4V02 C;  1QJV A;  2NTB A;  2QY1 A;  2V5I A;  2VFP A;  3ZPP A;  2NTQ A;  1O88 A;  4XN3 A;  2NTP A;  1OGM X;  2G0Y A;  1K4Z A;  3LMW A;  3P4G A;  4PMH A;  2O1D A;  2PYH A;  1BHE A;  4EW9 A;  2BM7 A;  3GQ9 A;  2F3L A;  2VFO A;  4U49 A;  2NT6 A;  4YCQ A;  1RWR A;  3LYC A;  4YEJ A;  1O8M A;  2NST A;  4YZA A;  1JTA A;  3N6Z A;  5C1E A;  2QXZ A;  2QX3 A;  4YZQ A;  4YEL A;  2XTY A;  4XR6 A;  1NHC A;  1PE9 A;  2VJJ A;  1JRG A;  4YDT A;  5JLV C;  1X0C A;  2J8K A;  3BH6 B;  4NK6 A;  1EZG A;  4XQF A;  4OM9 A;  3FY3 A;  3ZSC A;  1LLW A;  1KTW A;  1CLW A;  1LM1 A;  1OFD A;  2X3H A;  4URR A;  2Z8G A;  4KH3 A;  4JRA C;  3KRG A;  1GQ8 A;  4W8R A;  1O8I A;  3JUR A;  3VMV A;  2UVF A;  4YC5 A;  1HF2 A;  4Z06 A;  1O8G A;  4XLF A;  2XC1 A;  3NAW A;  3SYJ A;  5JMC B;  3B4N A;  1KCC A;  1EA0 A;  4XMY A;  1WXR A;  3WWG A;  3VSU A;  4XL9 A;  1TYW A;  2IOU G;  2BM4 A;  3SUC A;  4OPW A;  3JX8 A;  1O8E A;  1WMR A;  3VSV A;  2NSP A;  2XT2 A;  2X85 A;  1H80 A;  1IDK A;  3SZE A;  2BX6 A;  1O8L A;  1QCX A;  1TYX A;  4XOR A;  1AIR A;  3RIQ A;  1QA2 A;  2NZM A;  4OJO A;  4I84 A;  4XN0 A;  1K8F A;  3PSS A;  4XOT A;  2BM6 A;  4YZX A;  3VMW A;  2VJI A;  4OJ5 A;  2INV A;  4NK8 A;  5DNS A;  2W7Z A;  3ML3 A;  4OJ6 A;  3NB2 A;  1PLU A;  4YFO A;  1O8F A;  1O8H A;  2B0R A;  3GRH A;  3SY2 A;  1QA1 A;  4XLE A;  1VBL A;  3GQ7 A;  3N90 A;  4W8S A;  4YEI A;  1LLZ A;  2X6Y A;  2X6X A;  1KCD A;  3B90 A;  1EE6 A;  2VBK A;  2O17 A;  1RU4 A;  3GQ8 A;  4Z03 A;  2BM5 A;  2O0V A;  2QYU A;  3EQO A;  3PSZ A;  3UW0 A;  1DAB A;  4XLC A;  1OOC A;  2XTW A;  1O8K A;  1TSP A;  4XLA A;  4AVZ A;  4OJL A;  3AK5 A;  1TYV A;  4MR0 A;  2O0W A;  2QZA A;  2EWE A;  3DU1 X;  1TYU A;  3B8Y A;  4W8T A;  4YZ0 A;  1OGO X;  2BSP A;  4Z05 A;  4OZY A;  4XNF A;  1BN8 A;  4OJP A;  3VST A;  1K5C A;  2O04 A;  1KQ5 A;  1CZF A;  4XKV A;  1OFE A;  4XOP A;  2XTX A;  1RMG A;  2YUH A;  1OFM A;  1QRC A;  3SQV A;  1QA3 A;  2PEC A;  2NT9 A; 
#chains in the Genus database with same CATH homology
 1OFL A;  1IB4 A;  3GQA A;  4XM3 A;  4MXN A;  1DBG A;  1PXZ A;  1IDJ A;  2X6W A;  3EQN A;  5C1C A;  1O8D A;  1IA5 A;  2IQ7 A;  3T9G A;  4XKW A;  2VBE A;  5AMV A;  1HG8 A;  2ODL A;  2INU A;  4W8Q A;  2PYG A;  4U4B A;  4HWV A;  4XLH A;  2VBM A;  4XON A;  2UVE A;  4XNF A;  1DBO A;  1XG2 A;  4C2L A;  4OZZ A;  1O8J A;  1QJV A;  2NTB A;  2QY1 A;  3ZPP A;  2NTQ A;  1O88 A;  4XN3 A;  2NTP A;  1OGM X;  3LMW A;  4PMH A;  2PYH A;  2O1D A;  1BHE A;  4EW9 A;  3GQ9 A;  4U49 A;  2NT6 A;  1RWR A;  4YEJ A;  1O8M A;  2NST A;  4YZA A;  1JTA A;  5C1E A;  2QXZ A;  2QX3 A;  4YZQ A;  4YEL A;  4XR6 A;  1NHC A;  1PE9 A;  2VJJ A;  1JRG A;  1X0C A;  4NK6 A;  4XQF A;  3FY3 A;  3ZSC A;  1KTW A;  4URR A;  2X3H A;  2Z8G A;  3KRG A;  1GQ8 A;  4W8R A;  1O8I A;  3JUR A;  3VMV A;  2UVF A;  4Z06 A;  1O8G A;  4XLF A;  3B4N A;  1KCC A;  4XMY A;  3VSU A;  4XL9 A;  3SUC A;  1O8E A;  1WMR A;  3VSV A;  2NSP A;  2X85 A;  1H80 A;  1IDK A;  1O8L A;  1QCX A;  4XOR A;  1AIR A;  2NZM A;  4OJO A;  4I84 A;  4XN0 A;  4YZX A;  4XOT A;  3VMW A;  2VJI A;  4OJ5 A;  2INV A;  4NK8 A;  3WWG A;  4OJ6 A;  1PLU A;  1O8F A;  1O8H A;  3GRH A;  4XLE A;  1VBL A;  3GQ7 A;  4W8S A;  2X6X A;  2X6Y A;  1KCD A;  3B90 A;  1EE6 A;  2VBK A;  2O17 A;  1RU4 A;  3GQ8 A;  4Z03 A;  2O0V A;  3EQO A;  3UW0 A;  4XLC A;  1OOC A;  4XLA A;  1O8K A;  4AVZ A;  4OJL A;  4MR0 A;  2O0W A;  2EWE A;  4W8T A;  3B8Y A;  4YZ0 A;  1OGO X;  2BSP A;  4Z05 A;  4OZY A;  1BN8 A;  4OJP A;  3VST A;  1K5C A;  2O04 A;  1CZF A;  4XKV A;  4XOP A;  1RMG A;  1OFM A;  2PEC A;  2NT9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...