4P06A

Bacterial arylsulfate sulfotransferase (asst) h436n mutant with 4-methylumbelliferyl sulfate (mus) in the active site
Total Genus 157
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
157
sequence length
571
structure length
564
Chain Sequence
AGFKPAPPAGQLGAVIVDPYGNAPLTALVDLDSHVISDVKVTVHGKGEKGVEISYPVGQESLKTYDGVPIFGLYQKFANKVTVEWKENGKVMKDDYVVHTSAIVNNYMDNRSISDLQQTKVIKVAPGFEDRLYLVNTHTFTAQGSDLHWHGEKDKNAGILDAGPATGALPFDIAPFTFIVDTEGEYRWWLDQDTFYDGRDRDINKRGYLMGIRETPRGTFTAVQGQHWYEFDMMGQVLEDHKLPRGFADATHESIETPNGTVLLRVGKSNYRRDDGVHVTTIRDHILEVDKSGRVVDVWDLTKILDPKRDALLGALDAGAAHAGQQAKLEPDTPFGDALGVGPGRNWAHVNSIAYDAKDDSIILSSRHQGVVKIGRDKQVKWILAPSKGWEKPLASKLLKPVDANGKPITCNENGLCENSDFDFTYTQNTAWISSKGTLTIFDNGDGRHLEQPALPTMKYSRFVEYKIDEKKGTVQQVWEYGKERGYDFYSPITSIIEYQADRNTMFGFGGSIHLFDVGQPTVGKLNEIDYKTKEVKVEIDVLSDKPNQTHYRALLVRPQQMFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Arylsulfate sulfotransferase AssT
publication title Structural and mechanistic insights into the PAPS-independent sulfotransfer catalyzed by bacterial aryl sulfotransferase and the role of the DsbL/Dsbl system in its folding.
pubmed doi rcsb
source organism Escherichia coli cft073
molecule tags Transferase
total genus 157
structure length 564
sequence length 571
chains with identical sequence B
ec nomenclature ec 2.8.2.22: Aryl-sulfate sulfotransferase.
pdb deposition date 2014-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05935 Arylsulfotrans Arylsulfotransferase (ASST)
A PF17425 Arylsulfotran_N Arylsulfotransferase Ig-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3100 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4p06A01
4P05A 3ETTA 3ETSA 4P04A 4P07A 3ELQA 4P06A
chains in the Genus database with same CATH superfamily
5D7SL 1EANA 3Q2WA 4JFED 4XP9H 4NNYB 2PO6C 5CD5D 2AXJA 4LQFL 2WBWB 3OKOA 4FLRA 2HVBA 3BT0A 1UXWB 3O81A 5IVZA 4NHCL 3T0BA 1LWRA 3H8NA 5A3ID 5CJQH 5E6IA 5DZPA 2MQGA 4JFXA 1NANI 3HHSB 1KJMB 1R3LA 1BA9A 3C2AH 2VXQL 4QHNA 4MDJA 3DRTA 5ENWB 3VRIA 5HHQA 4KKAD 4UI2A 1JXJA 5DEGA 2HLFD 5BRZA 3NN8A 1TJHH 4JY4B 3CQFA 3LH9A 5DQJA 3WEMA 2JKRM 2H2SD 1F5WA 4Y1AB 4FQLL 4QKXB 4PG9B 4DP7X 1ADWA 1IC7H 1FSKC 2OMYB 1AGDA 4OFQA 2WZ5A 3MCKA 4PJEA 5BCAA 1QPKA 4YZFF 2CMRL 3I75A 1FVCA 3S88H 3MV7E 2ZZUT 4GLRI 5I1CH 5JHDA 3QRFM 1TETH 4Q7DA 3D06A 4GXFA 1CGYA 2EE9A 4XMLL 1U91B 3QUXB 4JPIB 4E41B 2AXGB 3CG8A 3EO9L 3ECQA 2PYEB 5ICZB 3FN0H 1JK9B 5HTSA 4GKZB 1JFHA 2FSEB 1KTLB 1Z9SA 1KZQA 1XXFC 1KLFB 4F1ZA 1GYWA 2JCCA 3HZYA 4L1SA 5KSAA 1JGDB 4WAFA 1OCZB 2AHIA 5IROC 4NKIL 4HSQA 2VT0A 3UAJC 4AVKA 2DYPA 5DMKB 4ZS7H 1AIFA 4A7TA 2XT1B 2DQDH 2CQVA 3HI6L 1NKRA 2KZBA 5EOCJ 2HB0A 4PBXA 4WU5A 4XO3A 2P9RA 1ZT1B 2OJZL 3ES6B 2CHZA 1HVXA 2Y36H 1NSNL 3FCGA 2VXUL 2W0FA 4BZ2L 4I9XA 1JGLL 1T22B 4FTVA 4XCYB 3EHBC 3OG4B 4ILDA 1E3FA 4I5BA 1J0IA 2AJ3B 4AYFB 1CBVH 1LE9B 4K73A 4ZUTB 4X6CF 2FHBA 1KCRH 1PQZA 4MQ7B 3WIHH 1JYVA 3MCLH 4GUPB 7FABL 2I60H 3BVTA 5IVXA 5F7FA 4OD1H 5DFAA 5K9QI 1JZFA 2ZCLL 2D0FA 1EXUB 3UJTL 1E27A 2FEEI 5IR1A 4MNGE 2A1WL 1ANUA 4JFDA 3VGDA 1L9TA 3UTSA 1JNLH 3ROLA 2Z31A 3C08L 1WCBB 3CPLA 3F6IA 1EFXD 4YPGB 4FQPA 1JRHL 5F0LB 5AW5B 3LRSA 5GSVB 1SXNA 1WAAF 3BYTA 4PJDA 4U1IB 5CZKA 1S7WB 3C09C 4XCEA 3CXDH 1JPSL 1PW3A 2LVCA 4WSKA 1F4WL 1IC5L 3U6RB 1MCBA 3SE8L 2AAVA 1TYJA 3IETB 2VERN 4HKBB 4OLVL 1KTJA 4HKXB 4QRPA 5JXAH 2I07A 1X3DA 3MLRL 3FTVA 3TEZA 1TZ8A 1BZEA 2ZXQA 2Z9TA 3QWOA 2CRZA 3KPMA 4K07A 5IQMA 1NGQL 2P8MA 3DRQA 3BZ5A 3REVA 3S4SG 1T4WA 2IAMC 4LLUB 1MCOH 1RIUL 5L4FA 3H54A 3KPRE 3EO0B 4DKFH 3S8FB 1U8HB 3RIKA 3H9SE 3Q44A 1OPGL 4CC0A 2E74C 1UD6A 4ERSL 3VGHA 3HAEG 2XICA 2ZXEB 3VFVA 3LZOA 4B6ZA 2E8ZA 1WHPA 2J88L 4ZTPH 5HSFA 3L3OA 3A6CH 4PRAA 5E9NA 2LTQB 3MKKA 4BK5C 2XQBL 3UOAB 2QVMA 5B1CA 5KVDE 2X1WL 3B9KB 3BDYH 4B96A 5FHAH 1OV8A 1E4WH 1I31A 2BVOA 4N8VG 1GC1L 3CHQA 5HXMA 4L0ZA 2ZP9A 4GSDH 4YC2C 5E00B 3L54A 1PZ5B 2Q8BL 3JZYA 4I4WB 3K4ZA 2UWEF 1T1XB 3ASOB 2CK2A 4WUKH 4X7CC 5JXEC 3MRIB 3ZE2E 1UKQA 3LQAC 3MV8E 3DV4B 3BZFA 2I5YH 1CDHA 1YC8A 5CEZL 4W6YB 3WEXA 3G6DL 1E5UI 2VLKB 2VLRA 3GSRB 1BM3H 3P4MB 3V4PH 4F5CA 2DJUA 3D3VB 4JFFE 5DC9B 5AW7B 3V8OA 1JNNH 3L9YA 1J1OH 1Y6NR 3E6FB 4MASA 3QDGA 4G7YL 4I3SH 1U8NB 4LHJB 2WXIA 3QI9A 5LCVH 5CUSH 5DWPA 3FB8B 5C2BL 5J0BA 3BFWA 3FT4A 1LHZA 3HG1D 4QRAA 2WZPD 5CKGA 2BFVH 4N9GA 3I9IA 5FYLD 4Z7UB 4P9HH 4IS6A 1FLRL 2DD8L 3NFNA 1S7TB 1Q1JH 4DN3L 3BAKA 1R46A 1OTTC 4P05A 4NO2B 4WKZA 1HI6A 4PRBB 4Y4KB 2WJ5A 4JHAH 2ODIA 4FA8A 5EDXA 2B2XL 3CUPA 1NAMH 2HFEA 1G7MB 1X7QA 4TQ8A 2Y4SA 4OM0L 3MUUA 3HC0A 4OGYL 3H0TB 3N9GL 4PP1D 4X6BB 3CN1A 3R19A 4XCFL 3B6SB 1W6LA 4L8SB 3D87B 3OKDA 4G70B 4UYQA 4KKCC 5JMRA 1PFCA 1T7VA 4XR8C 5GRZA 4QI3A 5KW9L 3BPLB 3ZMEA 1FAIL 4NFDA 1TVHA 3CVHL 1A4KB 4Z3TA 1RJLA 3UJIH 1F6AB 3MBED 4PLKC 2VO5A 4JKPL 4PWHA 2Y2TA 1F86A 2P44B 1RIVH 1NMCC 3S96A 4G71B 3MVSA 2HP4A 3MLTB 1KSRA 2AVFA 4IIQA 4PJBA 2CO6A 1FLTX 3SDCC 2K1MA 3S3JA 3W37A 3NSCA 2X6UA 1ZVNA 5I74C 5CCJA 3BCFA 3ZT6A 4MMXC 4YHMH 3A23A 2FO8A 4L1BA 1YEFL 3IGFA 2F58H 1MXGA 5C0DB 4IDLA 1T04B 1IVTA 1FV1A 3MREB 2A6KA 4BUQA 3CFEA 1SMDA 3VWKD 1OSPH 1KJ2A 4ZG1A 3GHBH 1PJWA 4KK6C 1HOEA 3DJ9A 4PJFA 3O3BB 2E5EA 1BEYH 1ZTXL 2IG2H 2YQGA 2A4ZA 3QCVH 4H20H 4HEPA 4DIXA 5BUGA 5I6KA 4H8UA 5HHME 1U3JA 4XX1G 5I19H 5JZ7D 3FFCD 2Z35A 4OR1A 4OJDH 1T7ZA 5E2WL 5KN5A 1CFMA 2Q5BA 2XN9A 1JDAA 2CKBH 2DY2A 4P5MB 4XN5A 3SD2A 3ZRSA 2E6PA 3BN3B 2C9RA 2J6EH 1YCSA 1OVZA 1I1AC 2UZXA 4X0NA 2QPEB 4EMZA 1F58L 2VYRE 1TEFA 1O7DE 2WTRB 1NUFA 2FX9H 3TL5A 4NHUB 3CGTA 2XY1A 2YUWA 4ZK8A 2HKFH 4WWNA 3NRFA 1NCCH 5EOCL 4PWIA 1YJDL 1T1ZB 4ELKA 4EOWH 2WWNA 3QXTA 3P9WB 3P30L 3V9CA 2AJXH 5IB1B 2YD7A 1AC6A 4F33B 3W3BA 2N7SA 5GGSA 3T65B 4MA3A 3DMMC 5EOTB 3S5YA 2X9XA 5HGGS 3ENEA 5DUMH 4ALAL 4EI6B 2R59A 3PQYA 3DO3A 3AGWA 3QZWG 4GB9A 4JGUA 4JRXD 4N2GA 3IAGC 1G0XA 4ZUVA 2XWJA 1L6ZA 1DVZA 3KPLA 1JK8B 2I9LA 4QTHB 4F7PA 4TNWK 1KN4L 2IALA 5HYJA 3CIQA 3W5MA 5KVGH 3NK4A 3O2VH 4N6RA 1BWWA 3C5ZA 1AAJA 3E2HB 1FZJB 3IMRA 1F1AA 3P11L 3RU8L 1PZUB 2WO3B 3QORD 5AZEL 1V3KA 3D0LA 1JHTA 1T83C 4PTUB 4PJGA 5DRZA 2VZVA 4K7PL 4MD4B 2WLJA 2DJ4A 3WGUB 4UILL 3BISA 1BQSA 4QT5A 2V5RA 4WRLA 3FONB 3LN4B 2C3HA 9CGTA 4OCXH 3VFNB 3H53A 1EFQA 1K4CB 4F58H 4A2GA 4F3FA 1UVQB 3CMOH 2JJTC 2ICEC 3FFDB 3WNLA 3I9GL 1GGYA 4IDJH 3VXRB 4NNPH 2M83A 2Y7NA 1ED3A 1D6EB 5EU6B 2DI9A 3B2UD 2RHEA 4GQZA 2X3BA 2IGTA 4NO5A 1IZKA 1WDAA 1CZ8H 4WHTB 1DUYB 2VH5H 1ACYL 1PDKB 1YEHL 3LVEA 5DZ9A 1GRWA 1U8LA 1MW1A 1VDGA 2VN3A 2WBXA 4JHUA 2GYSA 4TTDC 5FCUH 3GZKA 2F74A 4EN3A 4EN2A 1TVBB 4JHVA 2QADB 4OAWB 1BJ1H 2PW1A 3QE5A 4JBSA 3CFJA 1Z2KA 1TZOA 4I0PD 3ZUCA 3FCTB 1WEJH 5FR3A 1KBGH 4PW9A 4G3YL 3ZUNC 3MV11 2WMPA 1J5HA 1JZIA 3GDBA 1ILUA 2OS7A 3EZJB 4C57C 5F7HA 5HD8C 4GBXD 4KNTA 3N2JA 1G9ML 1FO0B 3DBXA 1RP8A 3PGFL 4G7SB 5IJVA 5I66A 5AD0B 5IMLB 2XU9A 1ORQB 4OV5B 1Z9LA 3QJUB 4K9EL 1XGYL 1QFUH 4JDEB 3SDAA 4NXSA 1DSYA 5TGBA 4FQ2H 3EJQA 1JPGB 1PAMA 3L1GA 3OR7A 3RI5K 5B38G 1XBDA 4AE1A 1E50A 4DT2A 1KIUA 3F85A 1UYWH 1L9PA 4QUOA 5KSBF 3U46B 1NIEA 4PWEA 2NQ3A 2NY5L 3UBXG 2F8OA 1DJXA 2ZICA 3OXRB 2WB1A 4FQIL 3BUIA 4JDZB 4E9RA 1RERA 2VDNB 1QUPA 1D5RA 4HFUL 5E6RB 4WWKD 2A9BA 4QWWC 4XCCL 3ZKSD 2X2IA 1LMIA 4LK4A 3SJVE 2CIIB 3IT8D 1GCYA 1CE6A 4NKQB 2IH9A 3QIUB 3IJ7A 3UZVA 1BQHA 3IMTA 3L16A 3PY9A 2LFEA 4KXZI 4LPXA 3O45B 1Q9OB 3O6MH 4Z3FA 2EVGA 2D4FA 2FLRT 4RX4A 5DD3L 3MRRA 2R2HB 1RU9L 5E8PB 3P0VL 4PRNA 1BG1A 4F8QA 2UZIH 2WIIB 3ZSTA 4FQCL 1TSHA 1YPZA 4FG6D 3DJRA 5BPPA 2XKNA 4FQHA 1V5JA 1KJMA 2P5ED 4FFWC 4E2OA 3M07A 5C0AA 3QUZD 3O0RL 4FQXD 5PAZA 2E3VA 3JWOC 5EUKB 8FABB 4AY0A 1B9ZA 5EORH 1VACB 3MV9D 5ESVB 4KOCA 2SODB 4ZMOA 2P46B 3WTTA 5BV7H 4ZAKC 1CTMA 3M6DA 4XNYH 2B5IC 5CINH 1NCBH 5GS1A 1KGWA 2DJSA 3C60D 4IK7A 4PG9A 1WE5A 4XAKD 1N0LA 3CFBB 1MRFH 3ROOA 1WZ1L 4JHBA 2VQ1B 5D1QE 1M05B 3DSFH 2YGPA 2RQEA 3BUYA 3SDXE 4JG5A 1BD2E 1KXHA 1SN2A 4NQED 5E2TH 4AMWA 1RMFL 3OTTA 3SE6A 3FQXA 4JKMA 5DS8B 4LMQI 4KDTA 1YMME 2FR4B 1AZZC 3RWEA 2J5LB 2HTKD 5F1NB 5DLLA 2CR6A 1DBKH 2K45A 3GK8H 4PSPA 3FUJA 3EF7A 3H9HB 1QRNA 4GRWF 3AITA 3EYOB 2Q20A 1N59B 4X5PA 3VD1A 3LNEA 4HIJA 3FH5A 1H6FA 1TXKA 2BZ7A 4U49A 1D5XB 4KK5D 4NSKA 4ABUA 4FXGA 4ODUB 4YDLC 4M6NL 2IPKB 5D2NB 3LH2H 4PJEF 4K8RL 1GYVA 1CGUA 1UWFA 2JLPA 4HK0B 1EPFA 2HFFA 4U4IA 2AEPH 1G7QA 4P2QA 2YPLD 4OZIE 2OTUA 2WLNA 2J5WA 5ISZE 1NOLA 3LNFA 4B9YA 1KNOA 4HAFA 5G5DA 5D9SB 1D6VL 1CLCA 2EILB 4HJJL 3ZRCC 1HQ4A 4OZHE 4DOHE 4LVNB 4ODSH 1X7TA 4P46D 3CDYA 3WFBL 4GKNA 4TPRL 4GIAA 3COOA 4AV0A 1JZ8A 1WIPA 5AYUH 2C1OA 1HH9A 2NY1D 5BMFH 4NCDA 4UV7H 1IRAY 4M5SA 1T22A 5KBMA 3W9DB 2CJ3A 2QV4A 4A2LA 1BYOA 2W9DH 2ZAHA 4PWGA 3TBBA 3F01A 3ZE0E 1F4XH 1K4DA 3P69A 2IFFL 3B2PA 3AQXA 3MRHA 3N41F 2FT7A 2B4CH 2F9BT 4AZ8B 2EIZB 3EUUA 3RVVC 2V2WA 1AY1L 5IJKC 2W92A 4XVOA 2ITCB 4H88L 2JK5B 3HPLB 4P2RA 4X9FA 5I1IL 3ARGD 2QQNL 2FD6H 4WW1B 1S78D 4D7BA 4F9LC 5IB2B 4OJFL 4B3VA 4F20A 3O8XD 3I6GB 4XN2A 2D03H 2XTJE 2JMRA 3CSPA 1OF2B 2UUDK 3MROB 1KGCD 3PRZA 1DQMH 1S7WA 2GJ6E 4X2UA 2QFPA 3P9MA 4XO8A 4YHYC 3PL6C 2L7JA 3RTQD 3J8F7 4NP4L 3IETA 3GEWB 3F04A 1WA2X 2CUAA 2AQSA 3RUGA 2A6IA 1FN4B 4C83A 1B4LA 5L88H 3U7WH 4D8PB 2L0DA 2OMXA 4L4TA 3CDZA 4NWTL 3IJSB 3RX8A 4PREA 4BH8B 3KEDA 3N40P 3LB6C 2WGXA 2DIAA 2BOBB 4U6XA 3N0PB 4H8HA 2BCMA 2UXGA 1C12A 5KVMC 5FUZH 1BIIA 1T66D 1VZHA 4JZJB 4PS4L 2VDRB 2X2HA 3EH2A 5KZCD 4NQCA 1U8HA 2L7QA 4WK2B 4APQD 1TEYA 1OGPA 1U30A 1M1SA 3ABLB 3FQTB 3PHOB 4PJDF 4JVUA 1KPRB 1BMGA 4XTRD 4HPOL 4ISVB 2NY4B 2YAOA 4ODXA 4WTWA 4GUQA 4U2YA 4DTGH 3AY4A 3SKJH 4IW4C 5J56B 4NQDB 4YDJA 3ECWA 3EDDA 2R0ZH 4L1DA 4U1NB 2YGNA 4DW2H 5F89B 1A25A 4G6ML 4BZ1L 1BMWA 3LHAA 1CGXA 1TPXC 4LLQB 4TS6A 3GLDA 5LGHL 3GS4A 5E00A 5C0IB 3NFPA 4P2OC 3VWJD 1O9ZA 4AVHA 4GSQA 2MCAA 4LE8A 2X4PA 2BH0A 2FH6A 4FKHA 4NPYB 1W16A 4AJ0A 5JMOC 2AV1B 3SGJA 1I3VA 4L3CA 1F1DA 5F96H 3FOLA 3KXFD 4TUJA 5AUMB 1T5KA 5C0BB 1N7MH 1D5MB 5JNYB 4QRBA 3TBWA 4TQEL 3CZEA 3KPOB 3CPUA 2KLSA 1U8NA 4J3OF 1ODUA 3QFJE 1P5UC 4FJ6A 4MDIB 3U9UA 1RK0B 4O02A 1IM3B 3NDZE 5EF3A 1WITA 3MGOB 4Q0XH 4DPRA 1MJ7H 3BPNB 2Y7LA 5BQDA 2MIZA 1NTDA 4NKOA 1T1WA 4KZCA 3K74B 4C47A 1C7TA 2A0LC 3RVTD 3HJ0A 4WQOA 4XMVA 2X4SB 4JFPA 7PCYA 4Y4KA 1S7UA 3VH8G 2E0PA 3DETC 4XVSH 3K6SA 5D7LA 4LLWB 1FNEA 4AXWA 3OLGA 1XFPA 4X7SL 3B6SA 5DJDA 5AOLA 5J1SC 1CLYH 4AGPA 4HHAA 1HHJB 1E3XA 4NNXB 1F97A 3MV7B 1CD1B 5EO9B 1A4KA 2EDMA 4G7QB 1ETB1 3MGAA 3O4LA 1EHNA 4ODHL 2HX7A 3MNZA 1F6AA 2WOYA 3JTBA 4ODWB 4M5TA 2EDDA 2VJ0A 2R23B 3B5TA 2C1PA 3GSQB 3MX0A 4ETQB 1KELL 3MLTA 3BT2H 4LMQE 4KI5D 3G08A 4TULL 1I8MB 1Z9MA 4FFTA 4ZMLA 5G2NA 4KOBA 3VRJA 4Q6IB 2ZSVA 1QBML 4YHKL 1YEKL 2UX7A 4JPQA 1DBAL 2NY3D 1ZV2A 3E7JA 4PJHF 3GIVA 3SGEI 1L6XA 3ELQA 3MREA 4R2GC 5FB8B 1V10A 1D9KC 2XWDA 2YKLL 4HGMA 5AG8A 2NYYC 1J7VR 3T3PB 4PWFA 4FERA 5FYKH 3WN5A 4AW7A 2DMCA 2H7WA 4P9HC 5DVKA 4FULA 5KVEH 3W0WA 1LGVA 1XF5A 3O6KH 5DJXB 4Z0BH 1XL6A 3G5VB 3IDJA 4K5PA 4LT7A 1JTOA 3LN9A 3V4LA 1FZOA 1D7FA 2H0PA 2OLDA 1A02N 2IAAC 1M7DB 3SBRA 3GXNA 3W1ZA 3HKZA 1J8SA 2MH4A 5KUMA 1E4KC 4WTXA 4PLNC 3H56A 3EDKA 5CWSA 2Q1EA 5KAQG 3TCTA 3DNKA 3AMLA 2FLMA 4AM0B 2WQAA 4PJFF 5ELIA 3MUJA 4UQ9A 2XXCB 1J0KA 2LLLA 1PG7W 4I89A 4HGKC 4WK0B 5DLML 4FYSA 2LAAA 4U31A 1LNUA 1OL0A 3WD5L 3BN9D 3H2QA 5DJZA 4HWEL 1P4IH 3SODB 4WENB 1B0WA 1IFHH 1QLRB 4N1EA 2YR3A 1OK8A 5C0NC 2X7LB 3Q2CA 3QUML 3WIFB 5BZDB 4KAQH 3P2DA 4XB7A 3SE9H 3ZGHA 4QTHA 2QVFB 4ONFH 4YDMA 1KYAA 3M7FB 5KYWA 4WDIB 5CZXC 5HBBA 2NW3A 1PS3A 3L3IB 1NIDA 1NC2D 2AP2A 2JELH 4GAAA 4YWGL 1KXTB 3QPQC 4N0YH 3U1PA 4MZ2A 3FZUC 2WBJA 3LXBA 4NFCA 3QDME 1TQTA 2XZCL 4M8QA 1PYWB 3HZVB 3FUIA 4MD4A 1PLGL 3WIAA 3K6IA 3BIAX 4DO5A 5F3BB 1QHOA 3MODH 2Y06H 3MYZA 3IGKA 4N26A 5T3XH 2EYSB 2LE9A 3IMWA 2B0SH 4P5TB 5KYYB 4YZWA 1SEBB 5BS0A 1K3IA 5FECA 5DURD 1BVNP 5LXGH 5I28A 1WGOA 2EIKB 3AU1B 1VA9A 2VMFA 2N01B 4XNUL 4Z7WA 3WMPA 8CGTA 3APNA 3T0EC 4C56D 2V7HB 1SMAA 3CBJB 4KTEL 4PI2A 4GH7B 1G84A 1QI3A 2VR4A 5IB4B 3ZE2B 4PV9A 3GNMH 3MV8B 4PJGF 3WFCH 5JW5A 1QSVA 1LD9B 4JQIA 5GGVL 3Q06A 5DHXB 1UJ3A 1J1PH 4AG4H 4APXB 4S1DD 3O3EB 3GKWH 2NYZA 3L8QA 4YEEA 3SBQA 4HPYL 2PO6A 4XBGB 3UC0H 2Q6WB 3ZR6A 3HC3H 4QNPE 3SO3B 5D7JC 3V4VA 2D7TL 2PUQT 4K4KA 1VEOA 4C4BA 3FCTA 5DEFB 3RIAK 3EDEA 5AVWB 4CW1B 1BZ9A 2XWXA 4TOYL 4BWTA 5GJTH 2GSIB 3DX8A 1JBJA 4JM2F 1XR8B 3GRWA 2C9PA 2DWSA 5FX3A 5HVHB 3TF4A 3OKNA 2NX5A 1SDAB 2QEJA 3QEUB 5IMLA 1ORQA 4AIZB 2B1AL 4AZUA 1FVDB 4K3JH 1D3CA 3UABA 3K5SA 3RX5A 4JDEA 1A7RL 3OSVA 2B15A 2MFNA 4U0RB 2X53A 5JLZB 3QUXC 3TNMB 4BKTC 2DDQL 1SYVA 3GGWB 4P3DA 4WI9A 4MX7A 4TQIA 2R2EA 3GSWA 4HUUA 3DROA 4LU5H 5ALCL 2R9HC 3DIVA 3MRMA 4FD0A 3LQMA 4JY6B 5A3IC 1LILA 4AEHL 2F61A 1DL7L 4RETB 5TQ0H 3S8GB 3Q9PA 4PGEB 4JFHD 4PJ9B 3ULVE 4PJAE 1XWVA 3SKUD 2OW7A 3G9VA 5ADPL 4KXBA 2ARJB 3BUDA 1KLUA 4IU3B 4BM7A 4HSCX 3F00A 4DK5A 3WTUA 1SHXA 4L4JA 3BP4B 5EBWB 3QYNA 3O45A 2V4LA 4G2AA 1CGSH 4GEJA 1O6SB 2R2HA 3DGDA 3UG4A 4AV4A 3KYNB 2XJKA 3MQIA 3ZJAA 3UAJA 2GITA 2X28A 2UY7A 1OP3K 2YO3A 2OMWB 3Q3GA 4KKPA 4Z76A 1NDGA 5J1AA 1W9XA 2QSVA 2QQQA 1J5CA 4M5YL 2E27H 4JUSA 1YEIL 2OMZB 3HG4A 4HD9A 5AWNH 5F88A 5GSRA 2FX7H 2R4SL 4PI0A 2MHAA 3ISYA 2BVPB 5TE7H 3ZL4H 4KO5A 1VFAB 4YS4A 1U2HA 4KY1L 4RZCB 4S1QL 1VCAA 5D8JL 5HHMB 3CFBA 4HIHA 4EI5C 4D3CL 1VFOA 2VQ1A 4EVNB 1YEEL 1I7UB 1S4IA 3A67H 5CCHE 3WEOA 4PUBL 1ZHKB 3KYMB 5FYJU 2XWRA 3GMLB 4WK4B 1QWHA 4H1LB 2DIBA 4OLXH 5IHHA 3QA3B 2EDBA 4G8EB 3IJ9A 3A6OA 2R0WL 3ARDD 3HR5A 4JKLA 3BRGC 1N59A 3QNXB 3VSQA 1OE1A 1YDPA 3FO9B 4I48A 3AREC 4I85A 5CSZB 3P3RA 4XNAA 1E5AA 2N0MA 5AW9B 4R0LB 2WLIA 3IKCA 3T6WA 5B8CC 3K6DA 1BXUA 4L2LA 3K8KA 1ETZB 1FGVH 3CFKB 5ADOL 5J5EA 2EVJA 1SN5A 2I85A 1IGYA 2ARWA 3CZFB 2R83A 5T1MB 4RA0C 2O61B 5IBUB 1A1OB 5SWZA 3CQPA 5E24E 3ILDA 1AHWB 1IAMA 2VWEE 4G1MA 5KG9B 1S9XA 1EXHA 2COQA 5AB9A 2A9NL 3KLDA 3S3CB 1LK3H 2BJML 4WEBL 4EPSA 1P5VB 1MHPL 3D34A 3JWNH 3ASWA 1XGTB 2EIMB 3MRNB 2WANA 4B9PA 5I1EL 5K9OB 1FNAA 5T5FA 1JV5A 5DQ9B 1Z66A 4OGXH 5F3HA 5BV7C 3GS0A 3JTSA 1MI5A 2X5PA 3CH1B 5EBGA 1NCAL 3ETSA 1A9BA 1AD9A 2VR5A 1E6OL 1JV2B 3AAZA 3H42H 2DIEA 3BW9A 4BK5A 1INEL 4GRLD 1QVOA 5DZVA 1BQ5A 3P4LA 3GZPA 1YEDA 1SVBA 5LG1A 2XA8H 4JRWA 3HPLA 3DPBB 3PF2A 4G6KH 1XAKA 4OB5L 3T4YA 2W59A 2VXSL 2FE0A 5CD3B 4U6VH 2V5SA 3I9PA 1OF2A 4Y2DB 4M4PA 4FKKA 2W9LA 1FYHB 4PMEA 4K3DL 4OKDA 3TBCA 4CUCA 2VITA 1AANA 3THMH 5IKCB 4X6FA 3KWUA 2DBLH 2VLJE 2VDLH 4DPAX 4MAYC 4BH8A 2ZX5A 5IEKA 3QG6B 3HJEA 1U8PB 5HGBB 4OSUH 4O00A 4XNXH 2XPZA 3E8UH 3GWJA 4TVPL 1A4JA 1MH5B 2XDHA 3QAZB 4XC1L 3EGXB 4YSQA 3GUTB 1X5MA 3KWVA 3LX9A 3O2DH 4L8SC 4QTFA 4X5XB 4F7CB 4MA7H 3WV0A 2WUBH 3OX8B 1N10A 4KRPC 5I0DA 1NOAA 3BPLC 2FWLB 4JPWH 3QHTC 1G7IA 2YN3A 3NIGE 4LBAA 5LJYH 1WBZA 3UTTE 1KGJA 3RUGF 5E2JA 4OM1H 5I24A 1XF4B 3S48A 4WU7B 4I7ZC 5IQLA 2OX5A 3OC8A 4JEGB 2WWMC 4L1HA 4WO4D 4P9ML 1MCSA 5AVTB 2YUVA 3OKEA 5EWIL 4EDWL 4N8VA 2WZAA 3OLDA 3OHMB 3ZQ9A 2B4CC 2P8LA 2YGQA 5IW1B 1S7SB 3LV3B 3VFTB 3KLAA 1UKSA 12E8L 2AV1A 2EDHA 2VZTA 4K55A 4X6DB 2DL9A 2XQ0A 3CN3A 5DRNA 5EN3A 2WP3T 5MP6L 3HNTL 3B5HA 1CFVL 4EQ2A 1JN6B 1AXIB 4G8GE 4P23C 5DJ6A 1KACB 1KTBA 3SDCA 1ZWIA 4XPGH 4ZODA 1VGKA 5CFAA 4OZFH 5L2KD 1RK0A 4HETA 2JSFA 2R7EA 5I1KL 3QUYD 1VGEL 1B88A 4MMXA 3C2SA 1S7RA 5HHOE 4YN3A 5FK9A 1IQDA 2BVQA 1OANA 3SQBB 4CSSA 4UTAL 1SOSA 1SY6L 5AB0A 2LV4A 3EYFB 5KVDH 5L9DH 4MVBC 5CEZE 1HL4A 4BRJA 3R8QA 1ZE3C 4DP9X 3E8VA 2GJJA 3FU6A 1B2WH 4ZXBD 1YN6B 3LMJH 3WE1A 1DQQB 4LL4A 5C6WH 5EU4B 1QWNA 5H94A 2EUZA 4J2XA 4XE0A 1TFHA 4TUOB 1UM4H 1GHFL 2D7QA 1RV6X 5HPMB 2XPYA 1Y6KR 3PWVB 4M4RA 2BP8B 5ETUB 2G30A 4A63A 3HLAB 4X5LA 5A40E 5EIQA 1MF2H 4Z7UF 3ZW3A 3SDXB 5INDB 1GA2A 5C9JB 1BD2B 1G5AA 1VEMA 1NQBA 3MZGB 3IPFA 1OB0A 2X4TA 1KGYE 5E8EB 1T20A 4X9YA 3EJRA 4WUUA 5C9KA 2F8VA 4ZD3L 2IWGA 2F53D 1C5CL 2GJZB 3VWKC 4HS6B 1EAPB 5T1JA 2BM3A 3BSHA 3RI5F 3EH4B 4CSZA 5IFHH 2QBWA 1GGIL 1ADQH 4TSCH 3VXPA 4AC2A 1W2KT 1ZEAH 4PIBA 2VM9A 3L5IA 1SVZA 4PB0H 4JREC 5EDSA 5JZ7C 3E2HC 3PGCB 2VUYA 4DKAA 3DMMA 4D0BA 3FO2B 3RA7H 4AMXA 4HD5A 3QPKA 1KPUB 2OL3A 5D71H 3RL2A 3HG5A 3HOGA 4OZIB 3GJFB 5ISZB 1KCVH 2A77L 5CEYA 5IV2A 4PJIA 3V0WH 4DOHB 3WFDL 4DP6X 3HS8A 2ITEA 5E9DA 3UTZB 4TQPA 2M8XA 3RWFA 4LLYB 4MJIB 4BBWA 1F2QA 1BQRA 2NY2C 1XHHA 4JFTA 1NFIB 4UAHA 1S7XB 5TFSH 4DN4H 2OXHA 1T83A 2F54E 4KO6A 1DUZA 3GBNH 3LPFA 1DJWA 2F6AA 4N90E 2EICA 4HIXH 2J2ZA 1GAFH 1KENH 5E23A 1S6NA 1FP5A 1FBIH 3EXLA 4MB1A 3DIDA 3C6LD 4BFIA 3EYUL 4AM0A 2JB5L 4RISH 4HJGB 4I87A 4TUUA 4TLTA 3FO0L 4KUCF 1CXIA 5DA4A 1SXCA 4U05A 5IMOA 5AW2B 5JIIA 1YVLA 3EFOA 4HS3B 4JGNA 4U1MA 1FFRA 4ODVH 4F9PC 5F0PB 4ZUUA 5ID1A 5CJQL 3QORC 1CFSB 4XMXA 1DJIA 3VFRB 2GJ6B 4BHUA 2NNCA 3AC0A 1ZS8A 3O0LA 3C2AL 5L6YH 1UATA 2AEQH 3L17A 1Y18B 2ED6A 2X7LA 2LFGA 5H4YA 3WXVL 3ERXA 4PJ8B 5CSBA 5ABDE 2XV0A 4JN1H 3QZWA 1DLHA 3FQUB 5IQNA 2OYPA 4BQ8A 3FQ1A 4NUGH 4E68A 1DVTA 1IBZA 1HHHA 2ESVB 4UZUA 1AO7A 3VXMB 2R0LH 3FRUA 2XG5A 1XCTB 3G6AB 5KUKA 2VDKB 3ARSA 3K3QA 4RMBA 2DAVA 1H6TA 5TE6L 4H1LH 2YWYA 1J0JA 5IHZB 5LAXA 1BIHA 5I1JL 2NQDA 3F2LA 5CLZA 2ZXWB 1ZPUA 5D1XE 5FGCE 4LSUH 2XZQL 1UZ8B 1ZT4A 3NCJL 1AGFA 2DV6A 3BLKA 4M7ZB 4HIIB 5FKPA 4EIUA 3IRCA 1Z5LA 1CFTB 3LEVH 3X13A 3P3UA 3PXJA 1S9YA 1QQDB 3FUNA 1W72H 1M6UA 2OYLA 2H1PH 2VC2B 4ZW8A 3ETTA 1L9RA 3D52A 3ZLQC 1MNNA 3EDFA 1K8DB 1QLEH 2HMIC 5IB4A 3D6GA 3M46A 1BGXH 4YHLL 1AQHA 1G6RH 3RKDD 1URLA 2FBJL 3TVMB 5B39G 2Y2WA 5D7HA 3EAKA 4APXA 3UO1L 4XP4L 3BZ4A 2XVKA 2WYTA 4L37A 3F12B 4ZZFA 4L9LB 3W5NA 4JM0A 4X98A 2GQHA 2WKGA 4CDGC 1XF3B 3I3EA 1XL4A 3IJEA 5I8KH 4ELME 4PBVC 3TO4B 5J6HA 5F9OH 3LQZB 4M61A 1O9WA 4P5RA 2ERJB 5CIPH 2R1YB 2FO4B 5ESQB 4Z7WF 4DSYA 2OI9B 5C0RH 2MPAL 3AXLB 2CDFA 4UWQB 1HKLH 2QT6A 4WV1B 1XR8A 3NQIA 4YHOL 5B7EA 3BUQA 5IT2L 4S2SB 1KCRL 4CVWA 3DI3B 4YH6A 5AG9A 1ND0B 1J8KA 2CBOA 5BOJA 4L23A 5DO8A 4M1GL 4N0FA 4ZAKA 2FLBT 3D39A 1F3DH 5JLZA 1A22B 2WO4A 5IBLC 3H3PH 3NQKA 1V05A 4CBPA 3GGWA 5SWSA 2FJHB 2NXYC 5C07E 3H6JA 1L9QA 2IPUG 1Y6MR 1KJ2L 3IDXH 3K0WA 2YGVA 1NGWB 1MRCH 3GPSA 4FG6C 5AEAA 4PEEA 4CSTA 3CZUB 3QUZC 4HG4K 4G6AD 2ARJA 2EYTA 3FN3A 3QEQD 4XI5C 3BVUA 2Q86B 5DSCB 5EIIA 4J6RL 5E6ZA 2AJSH 1NIFA 2OKMA 3JYCA 1IGFH 3T6ZA 2CPCA 3AM8C 5LUMA 2QMJA 4R90L 2HUEA 3FB5B 4LSDA 4E9TA 2I9TB 5J06A 2QQLH 4HF5H 1H15B 2Y9RT 3B7SA 5MERB 3RY4A 1WFNA 1JGUL 1W15A 1DVXA 4JDVA 4L3EE 3HB3B 5K33A 1G9HA 3FU9A 4FXLA 4LSSL 4MXWH 2DWXA 2OMZA 1Z3RA 4HFWB 4AUUA 3A22A 3GJFK 3OHXB 2IH3B 4BA8A 4YQXH 5E6ID 2BVPA 2EDXA 1AR1C 4J8QA 4N0RA 3PV6B 1BX2B 4HKJA 4NPKA 2PXYA 2UY6A 3MLXH 4RZCA 1LO0H 1EFXB 2FSDA 4XMKH 3PAZA 4WZ9A 2YS4A 5I6XB 4WUKL 1WC7A 3L6FB 1RP9A 2Y5QA 1I7UA 3CHXA 3RFZB 1I8KB 2FECL 3AUVA 5EPMB 4HXAH 1Q0EA 3KL0A 5FO9B 4DNLA 1ZHKA 5G4OA 1IX2A 1BM3L 3V4PL 1PZ2A 4LHUG 4LLMB 1QW8A 4RRPG 5JIQA 3WO3B 3NRQA 1C1EL 2W60A 2W1NA 4S0SD 4F80A 1QNIA 4PRHA 5IVOA 5LCVL 4P46C 5CUSL 4ATTA 3JUZA 3VJ6A 4F9LA 1GCFA 2V9UA 4IEFA 3V5DB 3FBKA 1ZA6B 4MJJA 4UIMA 5EU5A 5A16A 4B7LA 1JXKA 2A7BA 1ZS2A 2V3EA 2HH0H 1ASOA 3MNWB 3KZ8A 1IAIM 4P9HL 4H25B 3ECBB 4PRIE 3VB8A 4FAAB 4HDIA 3PL6A 1MUJB 3IJHA 5FEBA 3JTTB 4BSVB 3ZIYA 4Y2LA 4N0CC 4PGJA 1YEJH 4U7MA 5I76B 1N5AA 5DD6A 3L48A 4MWFB 3IU3A 5HVWA 3KPSA 5EIVA 5KS9E 1TF4A 4EIGB 4M8RA 1QD0A 3KYAA 1NAML 2X70A 4PWKA 1DQLL 4NENA 5HGDB 2WIMA 5F8RC 2Q7YB 3V95A 4IKKA 3QJXA 3DHUA 3F58H 2QVTA 3UYPA 3O4OC 3S36X 3ARGC 2AK4E 5KOMC 5D5ME 5HHVL 3QDMB 3BO8A 3QRLA 1Q9LB 4DH2A 4H0LC 3O8XC 1AKPA 2AJZB 2IDSA 5JUEL 2M1KA 3U83A 3V7MA 1V54B 1BQUA 1PNDA 5I73B 3QUHA 4XNZB 2A9DA 2XTLA 4N28A 1CGVA 3JWNG 4Q74A 4AGLA 4JR9L 3FO1A 4KKBD 2RTTA 2ZUQC 4H8QA 2AQQA 3GYRA 2ZOOA 4FTVD 2J8UA 4P2CG 4DP5X 2L7UA 4PTTA 3D7PA 3MJ6A 15C8L 3HG1B 3PP4H 4PJ7B 1HINH 4P2OA 2FATH 2ZUYA 2ZKHH 4IGBB 4F7TB 1T66C 4HWBH 3X3FL 4QDGA 2VM3A 1QZ1A 5DJCB 4L4VA 4P4KD 4XTRC 4LQ1A 5I1LB 4TTGA 2WP3O 1UWGH 1OSPL 1MVYA 2Z31D 3GHBL 2DLFL 3UACA 1IKOP 2G5BA 3TO2A 3CNKA 4Z7NF 4MNQA 1LEKB 5F71A 3ZDZF 4W9JC 1CICA 3WFEL 3DO4A 5GPRA 1C5DA 3BQUD 2WM0A 3L7EA 1EBPA 4MAUL 5I19L 3IXTA 3T09A 3GUTA 5E8DL 3NSJA 2XN2A 4FQQB 4LFHD 3FSWA 3MBEB 1UQSB 2OXGB 2QZQA 1PG7H 3NCWA 5EZLB 5KBPA 3D2UA 1A6UL 2J6EL 4F2FA 3EH5B 2OR9L 3PABB 4B9KC 1DVFD 1NUDA 1P2CB 4YIQB 5IOPB 3JWNC 2BFGA 4KJWC 2ZT9C 5T33L 1XB6A 3PXHA 1CTOA 1T5WB 4YEFA 1G7PA 3P4NB 3VMNA 1MCKA 1MPAL 3KE0A 1NCCL 1JERA 1VJSA 5IY5B 3L5HA 4JRYE 4ES8A 2AK1L 2V5MA 1MFBL 3FF8A 2ZUXA 1S7SA 4QRUA 3VFTA 1CL7H 1NMAH 5GGVY 2VL5A 3GIZH 1JVKA 1EGJA 2UZYB 1TTGA 4PJAB 2BVEA 1O9VA 4H7VA 1ZHNB 4H5SB 1GH7A 4JO3H 4UBDD 3KAAA 1B3IA 1IZJA 3J07A 2PCFB 2BIQA 3FB7B 4YZFE 1S2EA 2K9UA 3OBAA 1E3ZA 4C4UA 1IEBA 3VFOB 4Q9RH 4Z5RB 1HWWA 5C09A 2RALA 3O2VL 1HL8A 2YN5A 5ALBL 1NCWL 2GAZA 1QSED 3ARBC 3QZMA 1SF5A 4JVWA 4BE5A 5J4MA 1RZIA 3U4EB 5F21B 5DTFB 3DX7A 1GYUA 3EJTA 4OZFG 3ULUF 4N2KA 4YSTA 4HCRL 3HFMH 2ICES 5TD4A 2OMTB 4D2NA 1JGVH 4HEME 3RVUD 5E0QA 1A6AB 4F58L 4PJ6A 2XXGA 1YN6A 2VC2H 1BLNB 1DN0B 2EH8H 3CMOL 1WCQA 3JWDC 4NYLB 2OQJA 3R06B 4OJEH 5D6CB 3VH8A 4ABWA 5I9QC 4KI5C 5DJ2A 3SKMA 3QPXH 4ADGA 3MAWA 3RIAF 3BD5A 4NI3A 1CIUA 3OGCA 2H8PB 3GMMB 3TIEA 4B27A 5TDPB 2IGFH 5FA3B 1NAKL 1DHKA 1ZVSA 4X8JA 1MAJA 4TM9A 1QBLH 4X50A 4XH2B 2H1XA 4AQEA 3VFUA 4BUHA 5EEXA 1E4KA 1TG8A 1CBJA 1J5OH 3C6SA 3QBTB 2PP8A 2QKIC 4ONGL 3DJSA 1E9PA 4ZTOL 2KPNA 3CBRA 4G5AA 4YHIB 5CSGA 5JQIB 3K91A 3SYAA 1ZLSL 3VMPA 4Z0XA 1I7RB 1QHPA 2HZHA 3PWPE 1X5JA 2H26A 4M7JH 4K23L 4X6CE 1HU8A 3KM1A 4XB8A 4YR6A 3PNWB 4Q6KA 2OR8A 1K6QH 4OLZH 2HPTA 4HMCA 3TCLA 5L7XL 3NACL 3IGAB 2N56A 3MJ7B 5DDHA 4IBLT 3BVNB 1IEHA 4MCYB 1KJ3L 3VQ2C 5FO7B 1DQDH 4W68A 2WSPA 3MXWL 1NCUA 3GJFA 4G11A 2FJUB 1F3RB 2YD3A 1X5FA 2NQCA 1MQ8A 4FQJL 5K1JA 4PR5A 2DLIA 3SGDI 2ZF8A 3SPCA 1IM9A 5DJ0A 3MLUL 1WAAE 4J4PC 5EBLB 3HMXL 4MJIA 2XX1A 3P9LB 4KK8C 4WWID 1TJXA 3FMGL 3SYCA 1VADA 2BNRA 1AE6L 4I0CC 3MU3A 1A6ZA 2TSAA 2C3GA 4LLVB 5MI0B 2X4NB 4FZEH 4X6EA 5FA4B 4QLWA 3BN9C 2OTWB 1ITBB 3CU1A 3D25A 3EOTH 4UQ3A 2B1HH 4PJXA 5EU3A 5SX4I 3MRKA 1X9RA 3IVKA 3IMUA 3T3PF 1GIGH 3O11A 5T1DH 5JA8B 2JVUA 4JE0A 5CNHA 2J6WA 4I0PB 4NAQA 2CKBA 3OKMB 3T0EA 1R34A 4JO2H 3O9WC 4EAEA 2Z93A 4HT1L 2PPEA 4DZBA 5DFTA 1OPOA 1CT8B 2V3FA 4GBXB 3ESPA 2BDNL 4L5FH 3ME0A 2YEZA 1CDGA 3L9EA 4UB0H 5HI5C 2BLFA 1U2CA 1FC1A 3G04B 3X11B 3X1EA 3UZEC 5LWYH 2UWEE 4QHLB 2YD1A 4RSYA 5DMIH 4QAMB 4JO4H 1JPTH 1OGAD 3QDJE 1RVFL 2G2PA 1NCBL 2A9MH 2OJ1A 1LEIA 2W65B 3FCSA 2DH3A 3OF6D 1OAZL 4Y2NA 3TYFB 3LYRA 1SDDB 2XACC 2WOBA 2OMVB 1M2OA 4WWKB 43CAA 4FXKC 5HYJD 2DF3A 5I8OH 5A2CA 3NIGB 2IOOA 2Q8AH 3C5ZD 4H1LG 4I3RL 3UTTB 4PJ9C 4JFEA 5MEND 3GK8L 2F2HA 4PGBB 4OF8A 4HUWB 4N8UA 5D96C 5F1IB 3QQ9C 4X80H 1G9NL 3BPOB 5DRWB 2OZNA 4NM8H 1T3FA 1N8ZB 3OJMB 5GIRB 4WW2C 1D5BB 4WFHD 2GY5A 2X89D 3IDIA 4KXCA 3BWSA 4OVVA 3S8WA 2FVNA 2P5EB 2YD2A 2YARA 5F9JA 4A7VA 1C7SA 2AEPL 3DUSA 3U48A 3B5GA 4Z7VB 5DVLA 4PV8A 1SEQL 4IRZH 2Y1VA 4FABH 3MV9B 1BQLH 5H2BB 3PWUB 4L9LA 1RIHH 1JTTA 1XH0A 4ODSL 2AJYH 2V7NB 1NLBH 2J7LA 2O5YH 3V5HA 4TSBH 3DURB 3CCHA 1TNNA 3C60B 2L04A 1RZ8B 4W6WB 3V5KB 4H0GA 1JNHB 4IJ3B 5F9WB 3IPBA 3HLKA 4NC0B 2R1WB 4UV7L 4YBQC 5I8EB 4DZ8A 2DM7A 5ESAB 3RAJH 43C9B 2D2OA 1MWAB 1UG9A 2W9DL 2ZJSL 5JPMC 4EN3D 4UUJB 1DFBH 2BVUA 4PWJA 1LQSR 4JHWH 4NQEB 2IDFA 3BAWA 1Q0YL 4G9FE 2ENJA 1UT1A 4GKSB 2NSMA 3MRCA 1U4EA 3I6KB 3EJZC 1FORL 3HNVL 1LP9A 2YAHA 3QJFB 3UZQA 3WUWB 1O7DC 2IXQB 2FD6L 5C0FB 1JYNA 4CMMA 4EI5A 2NLJB 3CLWA 4WHCA 2D03L 4ESKA 1KULA 3HZKA 1KDJA 5DD1H 2VJ8A 4XMWA 3ZRFC 3D09A 3GLEA 2FJGA 2NUTB 1BF5A 1NGZA 3WMQA 4GAYB 3LKPB 1IC4L 3WL9A 2WXMA 2D7MA 1TQVA 4YHZH 1E9OB 4KVNH 3RWIB 1IT9H 5IUSA 2HT3C 1S3RA 3FTSA 4JM4L 4GG6A 3AREA 3VB9A 4R26H 2C3XA 3STLB 3I50L 4RFNB 4M3JA 5CGBA 5B8CA 1LK2B 1KCUL 3GRBA 4QYAA 3SCMD 5I6NA 4JB9H 2EUWA 5JIKA 3TYGH 3HC4H 1N3NB 1Z5HA 4PJ5E 5AOZA 1PX8A 4DTGL 2SEBA 5KEZA 3SKJL 5DZAA 1G4MA 5GS0D 2CLRB 2ZNXA 3IJ8A 3LS4H 1DQJB 1IKFL 3R4DA 2R0ZL 2XZAL 5F0MB 3U2SA 5IFJB 2G2RB 3HUJA 4DW2L 1NMBH 3RVXC 2A6DB 3MMEA 1NBYA 3KG5A 5T3ZL 1OGTB 2YGOA 1BG9A 3DGGB 3DWTA 1YQVH 5FYJE 2DM2A 2F54B 4OZGA 3JBG7 3ULVH 4M93C 3SY0B 1A4BA 3Q13A 4OCSH 3II1A 3CVIL 4UYPA 3MTXA 4NGHH 4UTCA 4LCCB 1I8KA 1FJ1B 3RTQB 1AVAA 2D0HA 4DHLA 4AQOA 4KQ4H 3IAPA 2YMOA 2X1PA 3NFSL 1XIWB 5D1ZD 2Z8WC 4GXVH 3BYYA 1IMHC 3L7FB 1DVQA 2WC7A 2CJUL 2FYYA 4GIPD 4OLUH 1D7CA 2AC0A 2W0KA 1P7HL 4ANVA 1ZANL 4NBYB 3S3DB 4L8BA 3UEQA 3EXJA 4LEOB 2GI0A 4D0DA 1DVUA 1JPFB 3ZK0A 4ZDHB 4YSOA 4L8CB 1CG9A 3WN6A 5C0CD 4QLRA 3MNWA 3BAEH 1T2QL 5J6SA 4DPBX 5KZCB 5D7SH 3MNVB 3WNNA 3SGEH 4H25A 5BRPA 1WA1X 5F7DA 4APQB 1T80A 3B1TA 3P40A 1QRND 4BSVA 2IAND 1RSYA 4KWUA 4ZUWB 3G6JA 3IPEA 3LNIA 2AV7B 4NHCH 4MAYA 2DWEB 4MXVF 4L05A 4GRLC 5HGDA 3UAEA 5JIPA 4IU2B 5K9KA 1FYTD 4M00A 4XNQB 5IESL 1DZBA 1T4KA 2VXQH 4M9OA 4YXKL 4JKKA 1HSBA 1QSFE 2GHZA 4P2QD 3ZDXB 1Q9LA 3VWJB 4DFIA 3MC0A 3TBYB 2O5ZH 1SJEB 4BFBD 3UC2A 2XFXA 5D1XB 5DYOB 5FGCB 5HGAB 5K69A 4FQLH 1RK1A 1T0NA 2JWYA 4FFYL 5DHMC 3C8KB 1EUTA 1B0GB 4CADB 5EC1A 2CMRH 4Y5VB 4WF7A 3DYOA 4MCMA 3GRWL 5T5NF 1FO0L 3S35H 1L3WA 2WZPA 3WY2A 2CBTA 4RGNE 4Y19D 3QS3A 4B5ZA 1CK0L 4OFKA 4PD4J 1IE5A 3EO9H 2QDWA 1EVUA 3OJDB 2OMUB 5KSBE 2FIKA 4NO0D 2GTZB 5DQDL 4P23A 2HN7A 4MNHA 5DJAB 4LCWD 4LVHB 5CEXB 4M3KB 4EUPB 1MAKA 3REWA 2ICWA 4IBQA 2GG1A 1QUNB 2VDNL 3QEHA 3RPIA 1GKOA 3L3GB 4MZIA 3IDYC 3B9AA 3HI6H 2VW7A 1UH2A 2BP3A 4CVUA 2JKIS 1RY7B 3WLBB 4ABVA 4EDXA 1KXQA 4Y1TA 2W07B 3SBPA 3W39A 4KROB 1UQSA 5D1QC 4G7VL 3V6OE 4XMPH 2RB8A 4UQEA 1NSNH 2VXUH 4BZ2H 4N4YB 3D50A 3RL1A 1JGLH 5FFOA 2F7QA 1FA4A 5IOPA 2PLTA 3JT0A 5DD0L 4OQTH 3PP3H 2EABA 2WLLA 4LLDB 4RESB 1Q9WA 2EZ0C 2BHZA 4G42B 1RKRA 4J5VA 5DHDA 2MTPA 1MCCA 2P5PA 3QUYC 4TVPE 2Z1PA 4YNYB 1U8OA 4TMPA 2ZCLH 2NY3B 4DGVL 3UJTH 3W9EA 1QFWL 4DERA 2IPUK 5AZ2L 2A1WH 2VXTL 3L4CA 3VWKA 3SDDB 3C08H 2JV6A 4E42B 1R5IB 3AG2B 4JX0A 3WJJC 5F7UA 3LPOA 2WQSA 1WWWX 2NSXA 4F8PA 1GW6A 3QEGL 1JPSH 2D3NA 3GI9H 3M1BB 5GGUA 4FYRA 1F4WH 1IC5H 3SE8H 4OLVH 1E4XI 4UV4L 1UA3A 3V6ZA 4A7GA 3UBFA 3MLRH 2BXZA 5BRZE 2A4EA 3FFCA 3V0EA 4YO0A 1ZLEA 1MFAL 3D05A 1NGQH 3BKCL 4LAQL 3VSVA 3QR1A 4GRWE 2Y69B 2H3NA 2ADGB 3EOYG 3S36L 4KJYA 1MRDL 3MFFB 4X6DF 3H9ZA 1A1MB 1A6AA 1NBVL 1WWAX 3STZB 1RIUH 1BLNA 2VTFA 4YDVB 4PJEE 2IO5A 3R06A 2JKXA 2F7OA 3MUGB 3BZEA 1GY1A 2IH8A 5JHDE 4ERSH 3MRPB 2FNWA 5EEWA 1NM4A 2J88H 3QJHA 3QFGA 5KBNC 4Z7AA 5ABZA 3UYRL 4JNXA 2XQBH 2OZ4L 3B9VA 1M7UA 3JSSA 1QEXA 4XH2A 1DEEB 2XTJC 3WFCL 4FA6A 4P06A 1LMKA 2Y24A 5DYFA 3CV5A 4AG4L 4N8CL 1GC1H 4HJ1A 1B0RA 1CFQA 2X2JA 5B1JC 1NCOA 3GKWL 4JRXA 4UQDA 5HYSB 2Q8BH 3WDHA 3ZL2A 3HC3L 1KWGA 4LRIC 5KSVA 4A2DA 3T4AB 1K5NB 3O4LD 5CEZH 3LDBC 1JRHI 4F9PA 3IBEA 3QORA 4A7QA 3D0AA 3GMOA 1HXYA 4Q14A 3WNIA 2KC0A 4PRIB 1X6NA 3I74A 4ZUSB 4Y2OA 2YD9A 1NL0L 5C2BH 1P7KB 4OF5A 4P5KB 2FWOA 1I3RB 1ICTA 1U8CB 4IHOB 1R9FA 2UZPA 3TT3L 2YHGA 5G4MA 2J12B 2VAAA 3AG4B 2VQUA 5D7IB 5DZLA 4GI6A 4A2FA 5JDJA 2E8YA 1FLRH 2DD8H 5DURB 1B4JH 4DN3H 2Q2EB 4XXDB 5GGSY 4G8FB 2ED9A 2P5WA 1CLVA 2P3YA 3FU7B 5D5MB 2FBOJ 3KCWA 1R3HB 3KPNB 3F5WB 2B2XH 1UUNA 1CWVA 2KZWA 4LU5L 5AAWA 2IVFC 4U1SB 3VFSB 5C08E 4NOFA 2X4NA 4KJQC 1JF1A 2AQNA 2C3VA 2ZIDA 1JYXA 3FAXA 4OGYH 3N9GH 5JYMA 1U93B 4XCFH 4MD5A 4JFDE 2XWBB 1SYSA 2PWEA 4TNVK 3UTSE 3NG5A 3TVMC 3OMZA 4XRCA 5KW9H 3L3HB 3O6FB 4K3EH 3JVGC 4LRNL 2VDRL 4Y4HB 1FL6A 5DD5L 3T1FB 3NMEA 2A83B 3CVHH 4PJDE 4DKEH 1JTPA 4Z9KB 4WI8A 1FF5A 2WQRA 1UTDA 5F0JB 4NXKA 4QRPE 5JHMA 5EZPA 2MNWA 4JDTL 1MFEL 2ERJC 4GBXA 3VXOB 5GGRA 4YHNA 3P2TA 2OK0L 3OLEA 1MCPL 4OKVA 4KXAA 4TSAL 4OF0A 4NUQA 3RGBA 3FF7A 2O5XL 3VFWB 3KLHD 4A2EA 5AWNL 5CU5A 5D7KE 5AVYB 2FX7L 3NSFA 1YEFH 5HI4D 3RNQB 3E3QE 4IKJA 3ULUL 4Y89A 3DVGA 4FJZA 3NJIA 1CU4H 4ZS6D 1NCGA 3G5XB 4WI4A 5CGTA 1VFBA 5T8IA 1JI2A 2W65A 3FTXA 3IS0X 4KV5F 1XF1A 3QQDA 5EMYA 3TA3C 3OB0H 4EO5A 4K0OA 2CGRL 1SDDA 5CN3A 5MEPB 1WRFA 4LSTL 3A67L 2ZPKL 2FEDD 2NW2A 2ZOLB 2B77A 1U3HC 3LKNA 2AJVL 2WBJD 2ZX8A 1H8OA 4OLXL 4IYKA 4QXGH 2DWDB 1WP6A 3DOSB 2GK0B 3MOBL 3VYNA 4A6YB 4QRSA 5E2WH 3F7QA 3FUKA 3M7OA 2HRHA 4NERA 1JMZA 4BH7A 2VLRE 4OJAA 2CO4A 3W56A 2VB5A 3T77A 1MHHB 1F58H 2QR0B 4M8UA 2BW5A 5BS0D 3V0FA 3QDGE 1KC5L 5DVPA 1OAYL 3QUZA 2CK0L 4Z7VA 4FQXA 3L2MA 5EOCH 3N0AA 3ABKB 3R1GH 1QWUA 4IOIA 1CDBA 2KPWA 3P30H 1TKWA 3PWUA 2WHVA 2IDTA 5CILL 3KCPA 1VENA 2V7NA 3AM8A 3K2KA 4F8TA 3E6HA 2H3XC 1PZAA 3V5KA 1TU2B 2X87A 3MRBB 4ALAH 4RQQB 1OTUD 3U4AA 3VCLA 4GW1B 3G9AB 2RFXB 3W57A 2C9XA 1GKEA 2PO6D 2DI8A 4LCUB 1BLIA 3AXIA 1KN4H 5B22A 3X1NA 1NUNB 4NQEA 4JL1A 1GXEA 2GVYA 3MRGA 4Z77B 1JGEB 1UFUA 3P11H 3H42L 4ZPVB 3RU8H 3ARFB 3CFIC 5AZEH 1OP5H 3CAFA 1ONQB 3GXTA 4PGDB 3SPVB 2ZG3A 4UILH 3L45A 4PJHE 4XOAA 4G6KL 4D9RD 5C0FA 2HKAA 2XVLA 2NLJA 4JFOA 3X14B 1BFOA 3EUDA 2X4QA 4XBPB 4NUPA 1Z6JT 2AQ1A 3S0PA 5BJTB 3KPPA 3FPXA 3I9GH 4G80B 3TZVC 2E9WA 1F0LA 1CI5A 1NC4D 1T6VN 1SXBA 3GJEA 2YPLA 4NUJA 5GQBA 4X4XB 1PX3A 3CLFL 5EZOL 2D31A 4MQXD 2DBLL 3GMNA 3PWPB 5F7BA 4P46A 1E9OA 2DH2A 1ACYH 3LZNA 3KGSA 1L5GB 5IHLB 3NIFF 3CX5K 2D3VA 1KUMA 1TTAA 3ARYA 3D85B 3NCXA 1HCZA 3K6OA 5J12B 5DMYA 2DEYX 4UINL 4PJFE 4XWGL 3L1OL 1N3NA 1W6WA 1FNGB 4OFYD 4JPWL 4OGZA 4G82A 5DVNA 3C5JA 1HWHB 3FH7A 3OXSB 4G3YH 4OM1L 2GTWA 4I77L 1TZGL 5IROD 5AW3B 3TNNB 1FPTL 1G9MH 2G2RA 4QO1A 5FXCH 3BP7B 1HHIA 1T2JA 3PGFH 4PVNA 3ZHNA 4HBQA 3ARGA 4G1EA 5EFIA 4ZSOA 2XN9E 1I8LC 3DGGA 2HG5B 3O8XA 4KNUA 3Q1EA 4K9EH 1XGYH 1OT4A 3V0IA 3L3KA 4IRSD 2E47A 5CZVL 3GSXB 4FZ8H 4HALA 4BQ6A 3QO0B 3KH3A 3P77A 4LCCA 4W9FC 4YSAA 2X10A 3EDJA 1R47A 4I2XB 2PCXA 3UBHA 3VXSA 5E4IA 1XXDC 5H35B 4JL2A 1WAPA 1KY7A 4QMEA 4BDVA 3EHBD 2CLZA 2XOTA 4FQIH 2NRDA 3MRJA 4XPGL 4G5ZH 4HFUH 2QKSA 4U3SB 1CN4A 4XCCH 1M9WA 2EIDA 3QNZA 2ZOUA 4V1DD 2FJFB 2CSPA 1YUHA 3FSZA 3EJPA 2XG4A 1JZ2A 4Y4FB 1KIPB 1NGYA 4KO9A 3W81A 3PQYE 4OZGF 4Y16D 4DAGL 2OJEB 2HJFA 1VZGA 1HDMA 4J27A 3QIWC 1U6AH 1WAEA 2CIKA 2VDOB 1KXVC 2BP0A 4W93A 4DEPB 5DD3H 4ZUWA 1WV7T 2K8MA 1RU9H 4KKBC 3EJYC 3MFGB 4Y9GA 4UNVA 3P0VH 3LMJL 1A7NL 5DHYA 4FQCH 3KM2A 1EA9C 4XO5A 4PJGE 3RZCC 2PABA 5EUOB 4WO4B 2TRYA 3EOAA 1TZIA 4Z95H 1GZPB 3NCMA 2ZNWA 3D48R 4RFOL 3HI1B 3VWJA 5E4EC 3ARWA 1Z7JA 3SYQA 2X4UA 1SUJA 1M7IB 4BSWA 1PX4A 2OSYA 1IARB 1ZK5A 3KXFA 4E0RB 2IAMD 2DQFA 2VXVL 3OAZH 3BZDA 3PPEA 4R7DA 1N18A 2NT0A 2Y07L 2G2NA 3C8KA 5CBEB 3ULVC 1BAGA 2VISB 5DZNA 3K2UL 2V5YA 1LVEA 1WICA 5I6OA 5L2KB 1A1NB 4CGUB 4TSCL 1RMFH 2AFNA 4E9SA 1MI5D 4XNDA 2V2TA 3DYPA 35C8L 3CFNA 3VD5A 2QTVA 1EZSA 4M43L 3BQUC 4OVUA 4E9XA 4KNQA 4Z3IA 2NCMA 2PN5A 4NP9A 5JQ6L 4NLAA 1ML0A 1U8IB 3QK0A 4NCC1 1W0VB 1MZYA 3US1A 2JJUA 1X5KA 5D71L 3PHQA 3PYCA 1UGNA 4ZXBB 1KCVL 1G1CA 1T5XB 3ASNB 4O2FA 4YXHL 4M6NH 3V0WL 4AENB 5JXED 1KGXA 1KIQA 3WE6B 4K8RH 1D7DA 3OJVC 2HLEB 1XAUA 3ATFA 2G0KA 3SO5A 2MQ0A 3ARBA 5TFSL 2R2BB 1JWUB 4PJ7F 4PHXA 1T0MB 2OPCA 4FLSA 1GY2A 3UFIA 1BXXA 4U6TA 1D6VH 2EDWA 2XPGA 3MJ9L 4HJJH 4NO3A 5FO8A 3LSOB 4TPRH 3JV4A 4L0PB 2PNDA 4G9FB 1MLCB 2Y3AA 1KENL 5KJ4A 1GTNA 2P45B 4HG4J 1AP2A 2F53B 3SZKC 3HBGA 5DC2A 3WNMA 1ACCA 4FQ1L 4AQ1C 1EMTH 5DHVB 3GMQB 1OTTD 1XD1A 4LKXA 1FG2B 2GCYB 2C4XA 3HZ3A 2BCKB 2IFFH 1L7IL 3FOMB 2HFGL 2H9GA 2ICCA 2M2DA 2RD0A 3U4KA 1RCYA 1XGQA 4YDKL 4J23A 4KQ3L 3GBLA 3U0TA 2QKIA 3N50A 2AEQL 2QQNH 4PY7B 4B50A 4KKCD 4OJFH 5C1MB 4R96A 3UMTA 5ERWB 4JN1L 1KTKE 1A14L 1E65A 3Q5OA 1N2RA 3J2PA 1U41A 1I8IA 4ZMZA 1MVUA 4RMUA 2ZX9A 2VWEC 4NP4H 1YN7B 2R0LL 5C0AE 4ZFOA 3QUKB 4OFIA 3HRPA 5KSUA 2Q9OA 1DDHA 1PIFA 4NWTH 4Z78B 3HE7B 3TBSB 1H5BC 3UXFA 1N6QL 3H9SA 5EULV 4NN5B 3UERA 5BXFB 4OZFA 2I27N 1AD0B 5MHSD 4UM8A 2QGCA 2BHYA 4LOFA 2OSWA 4R84A 2KKQA 3RY6C 2D9QB 4PBDA 4RFEB 3C6LB 4HZAA 5EEZA 4J4PA 2L4OA 2Y72A 4PS4H 4AITA 4W4OC 2G60L 4LEXH 5TDOA 3RWHB 2HLAA 2GBAA 4WFGD 1U8QB 3ZOAA 1JP5A 2VR9A 4PLOB 4HPOH 3IKKA 4FRWA 2H1PL 4HJUA 3ALPA 2KT6A 4NC2B 3KLLA 1R4XA 4J8RB 5J11C 5E5MA 4E41E 2ITDA 3O3AA 4A7GF 3BI9X 3ZU8A 1ZHBB 2PYEE 1T21B 3JV5A 4BZ1H 3VXQB 1ECZA 3BRFA 4GNKB 5LGHH 1JFQH 1TCMA 1GOHA 5JOFA 1E2WA 2PKDA 2A6JA 3D33A 4R4ND 3MLYL 3TX4A 4JFFA 5IQ9A 2XRAL 3TEXA 3NPZB 5EH1A 4TNFA 2DRUA 3MJWA 5TH2A 2CDGB 3LIZA 1NC2A 3O9WA 1SBBA 4RDQF 5F9OL 4BEIA 1I1AD 4O5LL 1RD6A 4AKQA 1I1RA 4CNIB 4HWNA 1YHPA 4MJ5A 4TQEH 1HKLL 2C5DC 4PMFA 4ZUSA 5DFVC 1JZGA 4RCAA 1KF9B 5BVJA 2ZD0A 1SLXA 2E86A 1FE8L 1B6DA 1NDMA 1ADQA 1U8CA 2G4EA 4KHXL 3UZEA 1VKXA 3CE1A 4AQAA 3ZL1A 2E9JA 4UQIM 1BVLB 1G7JB 2QSQA 1I7ZB 4ZMWA 3PDDA 5EN2A 1SJHB 1ZGLA 1XF2B 3DMMD 3WUWG 1GTFA 1AOZA 3MYJB 2CRIA 3SN6N 1A6TA 4Y5YB 1R3HA 4C56A 3SBWC 2K8QA 4POZD 2NTFA 4LSVL 1HSAB 3WLWD 2VZ3A 4FXKA 1MRCL 4U1KB 1ZLUH 2NY6C 3LJ3A 3V0VA 4XBEL 3ZPDA 4P2RE 4L29A 1U93A 2CJSA 2VJXA 4X7SH 3S35X 4BFJA 2X3CA 1SLVA 4GP5B 1N70A 4M3HA 3DSNA 3L95B 1OARL 3ZMRA 1L9SA 2B08A 3RILA 1FZMB 1X5HA 2I25N 5GGTL 2AJSL 1EEZA 3N04A 1IGFL 2YA0A 3FQ4A 4QHUA 1LEGA 4ODHH 2OFQA 4RGNB 1JZJA 1AIZA 1MFVA 4WW2A 2K3HA 4HF5L 1GC1C 5FO2A 3OAYH 3KPQA 3O3UN 1KELH 3RUGE 1F6LL 1ZKAA 4L4TE 1BXAA 3SDYL 5I16B 4TULH 3EBAA 5KSBB 1AFVH 1DANU 1V7NH 2V8LA 5D2LB 2GUOB 4ZFQA 1SXSA 1BZDA 3B37A 1QBMH 3HRZC 4UNIA 3TPUB 3U9PH 1HHKA 2Y5TA 1YEKH 4XZUB 4AX3A 1E0OB 5IF0B 2R51A 1DBAH 3GTVA 4KMTH 4NQCE 2DQJL 4U1HB 5FS5A 3NZ8A 3WFHA 1NFDB 1RJZB 5I75B 3VE0A 3US0A 4GP8B 3LKOA 2YKLH 2WLZA 4XMKL 1DJYA 5HHNB 5DWUH 4BJLA 5DVMA 4P48A 5BZWA 5JPMA 1S5HB 4QOKB 3BWZA 3AB0C 1AO7D 1YO4A 3GO1L 1IIKA 1FNHA 1X9UA 2DQEL 5FGBC 2ZOLA 1KJVA 1MZZA 2DKSA 3EFDL 3MOAL 1NJ9B 1TLKA 3MHZA 5GRYA 1PLCA 4ZFFA 1I7TA 4ZQKB 1J12A 1TMCB 4O58L 1F3JA 1N9PA 5BNXD 3MGTA 1ILSA 4MD0A 2VLKE 2IADB 4FGMA 3TLRA 5E1HB 3D3VE 2YD4A 4AIOA 1ASQA 4RFNC 4FNUA 3NGBB 4ZO6A 2K78A 1XSKA 4HH9A 5DLMH 2MTAA 3QZOA 3OKOB 5K1NA 1PD1A 5E9AA 5IVZB 4AYDC 1J9CT 1A3QA 4Z7UE 5E6IB 4JFXB 2HT2C 1THCA 4JZOA 3Q7JA 2DPKA 5EBMA 4HWEH 1H3PL 4E9WA 1R3LB 2Q3XA 4QHNB 2WO2B 3DRTB 4MDJB 3VRIB 5HHQB 3LEYL 2DQUH 3W11C 3QUMH 5DEGB 5A2JH 5BRZB 3NN8B 3D69A 5M94B 3KR3L 2ALWA 3TOPA 2GT9A 4LCUA 5DQJB 3QWNA 4UOW1 5F97E 3QG7L 5TDNA 2NY0B 5D7LE 1ET7A 3HMWH 4I9WD 1ZHLA 1JGEA 1EERB 1QRKA 2X9YA 4Z77A 5CIPA 4IOFD 4Z7VF 4YWGH 1J05A 2VRAA 5K39A 1MJ8L 1AGDB 2G75A 4PJEB 2E7LC 5IWLC 4JE4B 1GYAA 2P1YA 5EEYA 1XGPA 4Q4IA 3UYOD 1PLGH 1FVCB 3MNDA 1UA7A 4N8PA 3ARDA 5JHDB 1GR7A 3Q2NA 1A6PA 3RTLA 1NGPL 2ZXAA 4Q9BA 3RPKA 3ZHDA 4YAQA 4XBPA 4S0HA 3SB3A 4BD4A 1R33A 1OE3A 4GUOA 2WCSA 4DK3A 3D39D 5AFAA 4BKSC 4JGMA 2ITFA 1Z9SB 4J1UA 5HGHA 1P1ZB 3WHE1 3B1UA 1OF0A 3QIBC 1IB5A 4XNUH 1IAII 5SWSD 2MJWA 5EG6C 3H3KA 2JCCB 3HZYB 4FFVD 5KSAB 1TTUA 4KTEH 1WSST 3B3IA 3B56A 1FGNL 3EF4A 4RVBA 1M4KA 5DMJB 5M95B 5AW6B 1UFGA 5GGVH 3U2JA 2DYPB 1AIFB 1K2DA 3EO1A 3IFNL 5AKTA 3GMRA 4DO6A 3QXDA 5GS2H 3TA4D 2NXZD 3T71A 4HPYH 3HBZA 4U1GB 4FLQA 3R4RA 1QR4A 4L3AA 2B20A 3CX2A 3W0WE 3BDXA 4RBPK 3U36A 2WNXA 5D1ZC 4FTVB 4ALAC 5HHPA 1KV7A 1ZVHA 2IQAA 4GRLA 3BKML 1PSKL 4I5BB 1E8WA 3L3DA 1AGBA 1U3ZA 4X8CA 3Q2LA 3MRDA 1A66A 4PHZA 1PQZB 1NINA 3K71A 2B1AH 3TURA 1IL1A 4OIIL 3OKLA 5IVXB 3GINA 5F7KC 4TV3A 1FL3A 5FKAB 2PMZA 1E27B 3A6BL 1TR7A 4PW3A 1RULL 5IR1B 3ATDA 4AYEC 3DVNA 4UT9L 2DDQH 4P4KB 4OLWL 3FYIB 1OP4A 1OW0A 4D9QD 2UXVA 3UTSB 2FUQA 2Z31B 4YOKA 2DQTL 3CLEL 3CPLB 4HHWA 2F1AA 5ALCH 4ZNEA 2VDKL 3LRSB 4XXWA 3QRGL 4PJDB 2JIXA 4I8DA 2J71A 4LVHC 4AEHH 4Q9RL 1QFOA 1DL7H 4XCEB 3A47A 5FDYA 4A1RA 4QRPB 5EZIH 4N87A 3HR6A 1RZPA 5ADPH 2ADJA 5DF0A 1SPDA 2I07B 4PN6A 3OZ9L 2OJEA 3MRLA 3QWOB 1ETA1 3RRQA 1KWKA 3KPMB 4JY5L 1HH6B 4GAJH 1ET8A 3DRQB 3J7HA 2FYVA 4GG8B 3F3HA 3I6SA 3REVB 5D4JA 3V0GA 2AEOA 4PVLA 4PPTA 2VC2L 3DUUA 3U1SH 2Q3ZA 4GKLA 2LU4A 3PL6D 5C0EA 3AG1B 2KBGA 3HCVA 4L2YA 5JDSA 1GZPA 2VLMD 4QRRD 3VFVB 4UTBL 1QABA 1YEIH 3IRZA 1PIGA 3L3OB 3KPSD 2GPZA 3PREA 3ARPA 4N25A 4PRAB 5EO0A 3GBDA 2R4SH 1JUFB 4OQ1A 3LB6D 5C86A 4DP4X 1MCNA 2FB4L 3JQOB 4NN7C 1G9MC 2BVOB 2HJKA 1RZJH 3R0MA 4E0RA 4S1QH 1B90A 5D8JH 3RDTD 5EU6E 1YYLH 4AVJA 4Z7WE 5HYSG 3VAEA 3MJGX 3PUCA 1YMMA 1LO3L 4K9EC 4D3CH 2X44D 1BW8A 1E9QA 3FRPG 2FZ3B 1YEEH 4RRPM 3SEPA 5LBSA 4F2MA 5L2KA 3BZFB 4UDTA 5I17A 4PUBH 3QHZL 1OSZA 3QUYA 4HU2A 2VLRB 3IN0A 1QSEB 5A7EA 5CJBA 4OLZL 4W9DC 3ZDXF 4U6HA 2QGEA 4LPUA 4PH8A 3FSOA 2NY5C 2A73A 1GZHC 1VF5C 2VDMB 3QDGB 1ZMYA 4EEEA 5SX5K 3QI9B 2OTPA 3T0WA 5ES4B 1KPVA 2R0WH 4NQSA 3FT4B 4TNVF 4N9GB 1T5XA 2J20A 4P2OD 3WJJA 5J1TC 4XZ4A 4AENA 4HWBA 1OAQL 4IS6B 2NYKA 3ZHLA 3NFNB 5LLIC 4DVRL 4OD2A 4OZHA 4GRMA 1NGXA 2NX5E 1AKJD 3NIDF 3CHSA 2RJMA 3GT6A 1HI6B 5ADOH 1MLBA 2QTEA 2KZ1B 3LPWA 3CUPB 1I82A 2C4FU 5FM5O 1F6FB 5CP7A 3T2NL 2OULB 2XA3A 1MCQA 2HFEB 3AWFA 1X7QB 2UYLA 3HC0B 1DO6A 4MNQD 2A9NH 2EP6A 4K15A 2BJMH 4WEBH 1MHPH 4MA1B 2QSCL 2XVBA 3ALWA 3A4DA 3L81A 2DLGA 2A0LD 2DMHA 4XPFH 1TVHB 4M1CC 5T1DL 5JA9A 2MCMA 2GCYA 1RJLB 1CDUA 5AQ0A 1TUPA 2JQZA 2R0KL 1F18A 1NCAH 5DJ8A 3D2UD 3T4AC 1JWSA 1OCWL 1E6OH 3DETD 1BVNT 4ORGA 3S96B 1INEH 1YMHA 4IIQB 1INDL 2CO6B 4PJBB 3BH4A 3S37X 1U33A 3D9AH 3T04D 3VI3A 2WXKA 4OB5H 2BINA 1FNFA 5ERWA 1OD9A 5EA0L 4AJVA 3X12A 1BV8A 1IFGA 3WHE0 2K6YA 4DGYL 1CGTA 1R24A 4KI5F 1CXKA 3DXAD 3DUHA 4DEUA 4K3DH 2XNAA 2AJUL 1UH3A 2A6KB 3ZKMD 1Y7VA 2IGLA 3TIDA 3CFEB 1UOKA 3SQOH 1HEZA 2ISDA 4NN6C 1C5BL 3CVCA 3KBPA 1WBYA 1GS6X 4JJ5A 1HZHH 4K8RC 4Q89A 3TTSA 1JXGA 3LD8C 2LR4A 4H2AA 4NS0A 4F91B 5I18L 4TVPH 4ZO8A 3C6LA 3ABGA 4RWHA 1GGTA 2Z35B 5IHWA 3UADA 2KI6A 4DVBA 4M62L 1FNSL 3GSNA 5KN5B 3QC5X 4Y9EA 2XN9B 4R2GD 4HUVB 4NM8L 1D9KD 2YJLA 5FM8A 1VESA 2UZXB 3DTXA 4R97C 2D7PA 1Q0XH 2Z91A 4WFEE 5GXBB 3FC8A 3VXUD 5TTRA 1M1XA 1ZHBA 3IDGA 2FO1A 3STBA 1B6UA 5JHLL 4PRPD 2R1XA 3RURA 3CDGA 4IRZL 4ELKB 1FH5L 1JF5A 5EWIH 4EDWH 4FABL 3B8YA 3CMGA 4JLRA 3JVGA 1P1VA 5D2NE 3H2PA 2AEWA 3GTTA 5DUJA 5GGSB 1OGAB 3APCA 3NCYP 12E8H 4MA3B 3BOVA 3CXHJ 2O5YL 3KWWA 3QFJA 1R3KA 4GRWH 4TSBL 5E99L 4JQXC 4QHMA 5MP6H 3S98A 2EDYA 4LSRL 3HNTH 3X3GL 3UBGA 3VDAA 3PQYB 1NEUA 1BZOA 4CNIA 1WFMA 2XWJB 2WXJA 4MFHA 3KPLB 3BLBA 2I9LB 3VRLF 4F7PB 4QXVA 5SWZE 3D12B 3D18A 2IALB 2XI9A 1DFBL 4GXUM 4XPTL 5HYJB 3S5ZA 3FDWA 4N6RB 4YE4H 3Q8AA 1GW0A 5I1KH 3C5ZB 1VGEH 4XN9A 4WIQA 5HJBA 4D0CA 1I7ZA 1JHTB 4QTIL 1AZUA 1FWXA 4XMZA 1K85A 4PJGB 2VMDA 1SY6H 1PY9A 5DRZB 5FYLL 1SJHA 2F68X 3L3JA 4NRZA 1AXTH 5DS1A 3P3TA 4G6JH 3VGEA 1GOFA 5FHBL 1WWCA 3TA3A 4N3UA 3FT0A 2Y22A 2J1XA 1ZJAA 1U8JA 5HJ3A 4JFSA 5CZXD 4Z7NE 5HYQA 2CH8A 1J8HD 3SYPA 5D70H 4RMVA 1GHFH 2NNXA 3ZDZE 2YXFA 1ED3B 1U3HA 2H32H 4PGCA 2MCPL 1JXFA 2EDNA 3DX6B 3FU3A 1J8RA 2WN2A 4NO5B 4BHUI 1AG0A 2DKUA 4O2EA 5FWQA 3F6JA 5D7IF 2LVEA 2GEQA 1AQMA 5IEHB 4RGMB 2VQTA 5T1LD 3WAJA 5SWQA 2Q87A 2JKNA 4CGTA 1RLBA 1U8LB 4NDMA 2AS5M 3RB5A 1B9KA 5KBDA 5CGYC 4KZDL 2D3JA 5F93C 2ZOWA 1JPEA 2F74B 3HNSL 4EN3B 5I16A 3KVQA 4FMFA 4M6MH 4WI3A 4OU3A 3TYGL 5BOPA 3D4ZA 1GGIH 2WQWA 3CFJB 2FEDC 1SFDA 1GSKA 5AKSA 1BWMA 1CD0A 5L8JB 5ITBL 2EE3A 2WMPB 2HT4D 1F1GA 3WIIL 1Q9KA 4FDWA 5IF0A 1ZGLM 3ARFC 3DBXB 3CIAA 4UAOB 5IJVB 2E75C 2WTOA 4LGPB 1OTSC 4WCYL 1YQVL 4WW2F 2A77H 3SDAB 1OCCB 1AQ8A 4NQDE 3EBHA 3DIFA 5TGBB 3WFDH 4JO1H 1W91A 1S5HA 4WSGA 5D7JD 3OKYA 2H6PA 4UIKH 2R4RL 1KIUB 3A24A 4GS7B 1JZHA 4Y1AD 3KJ4C 3QEQA 2ODHA 5HHOB 3O6LL 4MHHG 1WD8A 4X4ZA 2APVA 3QXAA 3ZN6A 3ULUE 2ENSA 4BELD 5DK0A 1S7QA 1YSOA 3DLQR 5DK2A 2CRMA 3VSUA 3O41A 5KYNA 3ARXA 3G5ZA 1VIWA 3HBPA 4FN0A 5C0BE 1CE6B 3RBSA 3LNHA 3TZVA 1TYRA 3UZVB 1BQHB 3EYUH 1AS8A 3QUXD 3VG9B 2JB5H 2KQMA 2ADYA 2PYED 5F6IB 3FO0H 1QLFB 1AQKL 3MRRB 3QS2A 1ZLVH 4PRNB 1J10A 2R9HD 2CO7A 1V3MA 1IC0A 1YPZB 3WSQL 4F15C 1PTZA 3K6FA 3ZE1B 2X88A 2XKNB 5A7BA 4FQHB 1A6WL 4D8OA 4J3OH 3VGBA 3I02B 3EGSA 3T0AA 4POYA 5C0AB 2CR3A 3VGFA 4HV8A 3WXVH 3BGMA 1Z3GH 2O5ZL 4J3BA 3VFPA 5LAPA 3ZBMA 5C6PB 1CD8A 4UT6L 4X7EC 1TEGA 2ZOKA 5GS1B 1EAJA 1CE1L 3MACH 4YMPA 4RNRA 3UBXI 1N0LB 5BUPA 2NCEA 3B7RL 3ROOB 2GB2A 1SLUA 2O1AA 5TE6H 4TF4A 1GJWA 2ED8A 1Q94A 3CHOA 4MQXC 3WO4B 1IO4C 4YLBA 5I1JH 3BUYB 5LO7A 2YAPA 1ULVA 2DQGL 3MTRA 1VFMA 3KJ6L 3S35L 4N5ED 1PMYA 1OCOB 2YRLA 3FQXB 5IM7A 2XZQH 3GMPA 3NCJH 2PTUA 4WUUE 3SKNA 4PVMA 5GZNC 3RWEB 2EKSA 3KYOA 3CFUA 2EINB 2OSXA 3I2CL 3HZMA 1QRNB 3ET9F 1XV8A 2FWSA 2XWTA 1FL5A 2XYBA 2VQ4A 1A9EA 1P1ZA 2A2QT 4HIJB 4EI5D 1F8TH 4NSKB 4FXGB 5I6LA 1TJMA 4YX2L 4K7FA 4HX1A 2BY0A 1U21A 4PS3A 1ES0A 4R5VA 1D7BA 4UZSA 4YHLH 3EYSH 4F1SA 5I1AA 2FBJH 2HFFB 2IEPA 2P7TA 1G7QB 5BZZA 4P2QB 3UO1H 4XP4H 2OTUB 4RWYL 2AABL 4QRQA 2H1LM 4ZOAA 5DJYB 3BXNA 1KNOB 5G5DB 1R5WA 4TRPL 1UXMA 3PFQA 3T3PE 1HQ4B 5AL8A 4IRSC 1KXVA 5E9DE 3H7BA 4GKNB 4KRLB 2E4FA 2C1OB 2CBMA 1HH9B 2BSEA 3ARED 1DLFL 4MB4A 4XMPL 5MEQA 3T3MB 1HEJC 2MPAH 3VXTA 1BEXA 3RZCA 4OQTL 4YHOH 1OAXL 3BSZL 5IT2H 2BSSA 1K4DB 1CJYA 2J1KA 3OMAB 2ADIA 3MRHB 3LEXA 5I0VA 2YK1L 5D6DC 4I18C 1LDPH 1ZV5A 3D5OF 1ZIAA 2V2WB 4M1GH 3D2TA 4Y16C 3CJJA 5FKAA 4NZUL 1OIOA 2BIMA 2A74C 4P2RB 4RDBA 4P4KA 3QRBA 2XIDA 4Q9QL 3LHPL 2PW2A 1XSOA 4KH2A 4LCWB 3PDGA 1TMQA 3HS0C 4NRYA 1KJ2H 1PJ9A 4YK4B 2CDEA 3UIZA 2VL4A 3P9MB 4ATWA 3GI9L 1I1YA 1WO2A 4LIQE 4CC1A 2Z4QB 3PWLB 1KBBA 3BQUA 1TO4A 1NM9A 3LVTA 3RUGB 2JJSC 2A6IB 4C83B 1IE4A 2W94A 3DX4A 3SOTA 4L4TB 2OMXB 3CDZB 1EEYA 4J6RH 4PREB 1HH6A 2P80A 2PTTA 4OV6F 4FEMA 3ZX1A 1YEGL 3IB4A 4GG8A 4U6XB 2KH2B 2Z64C 1DANT 4LASL 4X4MA 3WDIA 3MBWA 1ID5I 4WNJA 4G83A 1C12B 4R90H 1DVFA 1BIIB 2X38A 3VGAC 5CFHA 3BP6A 4W9GC 1X5LA 1JGUH 2HA1A 3GHEL 4NQCB 2BSRA 3CTTA 5FDWA 4I1PA 3D4YA 3ZKXC 4HUMB 2JXMA 4ODXB 2YPKA 3CXFA 1BAWA 4LSSH 1QNZL 3AROA 1EHLL 5CMAA 1AQDA 1HOCA 1I1FA 4MAYD 2APWA 4YDJB 1JUFA 1DP0A 3QGVA 4DGIL 4LESA 5E8NA 2VXQA 3WS6A 1UENA 3NABH 1KCBA 1M3JA 1UXSA 3NFPB 4AQ1A 2JJVA 3WKNA 2YC1A 4ZX6A 1MEXL 2FZ3A 2X4PB 4OCNC 4AM0Q 4F92B 4KRPD 1MWAL 1H0DA 3IMSA 4M7LT 4L3CB 3SGKC 3T8XA 5EUOF 5DC4B 3FOLB 1ECYA 4TUJB 3QNYB 1QSEA 1BCIA 1SHWA 4FI8A 2CCVA 4HQQL 4WEMB 3TBWB 4E5XG 1C1EH 5LVEA 2R29A 2X1XR 3ML9A 3RIFK 4TNEA 1QAWA 4AT6A 1AZCA 2WWMD 1E2VA 2ZXGA 1R3IL 2GC7C 3U9UB 2WNWA 4FNSA 4O02B 4ZMNA 4XCNA 1HZKA 1JZ7A 1AZVA 4NKOB 1T1WB 2AQ2A 1Q1PA 5C70A 3P02A 4CU8A 1B4JL 3JYBA 4LB8A 2YSSA 4NZTH 4XXCC 4EJ1C 2F5BL 3ISRA 4ZJ9A 2AQ3A 4F7KA 1U42A 5JW4M 5K5YA 3PFUA 4JFPB 1O7VA 4R8WL 4WJKB 4UQBA 2ETWA 1S7UB 4OD3L 4P23D 1MCLA 3C5SA 2VR6A 1WBXA 4AQ8A 1H5BA 1XX9C 2F7RA 3K6SB 1DQLH 4FNPA 1J9SA 5D7LB 5I1AB 1FNEB 4AXWB 4IKNA 4V2BA 5I6MA 4X5WA 5DJDB 2BHFA 4QXUL 4QCIA 1U8KA 4NKMA 5HHVH 5LQBH 2CRYA 4HHAB 4W4OA 5IB5B 3V8CA 5JW3L 1I85C 1HT6A 4K3EL 5JUEH 3F65A 2DL2A 4KHTL 4EBQH 5I15H 1SM3L 5IW6B 4DKEL 4MVBD 3RWJA 3O4LB 2YLKA 3MNZB 3CX5J 2VO8A 3T8VA 5EOQH 3U82B 4B0MB 5ITFB 1KCKA