4P06A

Bacterial arylsulfate sulfotransferase (asst) h436n mutant with 4-methylumbelliferyl sulfate (mus) in the active site
Total Genus 157
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
157
sequence length
571
structure length
564
Chain Sequence
b'AGFKPAPPAGQLGAVIVDPYGNAPLTALVDLDSHVISDVKVTVHGKGEKGVEISYPVGQESLKTYDGVPIFGLYQKFANKVTVEWKENGKVMKDDYVVHTSAIVNNYMDNRSISDLQQTKVIKVAPGFEDRLYLVNTHTFTAQGSDLHWHGEKDKNAGILDAGPATGALPFDIAPFTFIVDTEGEYRWWLDQDTFYDGRDRDINKRGYLMGIRETPRGTFTAVQGQHWYEFDMMGQVLEDHKLPRGFADATHESIETPNGTVLLRVGKSNYRRDDGVHVTTIRDHILEVDKSGRVVDVWDLTKILDPKRDALLGALDAGAAHAGQQAKLEPDTPFGDALGVGPGRNWAHVNSIAYDAKDDSIILSSRHQGVVKIGRDKQVKWILAPSKGWEKPLASKLLKPVDANGKPITCNENGLCENSDFDFTYTQNTAWISSKGTLTIFDNGDGRHLEQPALPTMKYSRFVEYKIDEKKGTVQQVWEYGKERGYDFYSPITSIIEYQADRNTMFGFGGSIHLFDVGQPTVGKLNEIDYKTKEVKVEIDVLSDKPNQTHYRALLVRPQQMFK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Arylsulfate sulfotransferase AssT
publication title Structural and mechanistic insights into the PAPS-independent sulfotransfer catalyzed by bacterial aryl sulfotransferase and the role of the DsbL/Dsbl system in its folding.
pubmed doi rcsb
source organism Escherichia coli cft073
molecule tags Transferase
total genus 157
structure length 564
sequence length 571
chains with identical sequence B
ec nomenclature ec 2.8.2.22: Aryl-sulfate sulfotransferase.
pdb deposition date 2014-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05935 Arylsulfotrans Arylsulfotransferase (ASST)
A PF17425 Arylsulfotran_N Arylsulfotransferase Ig-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3100 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4p06A01
4P04A 3ELQA 3ETTA 4P07A 4P06A 4P05A 3ETSA
chains in the Genus database with same CATH superfamily
4JO3L 4NP9A 4XCFL 2EDFA 2V2XB 1SYSA 2WWMC 3CQQA 4Y4HD 3WFCL 4PI0A 3UZEA 1SN5A 4EQ3A 4LKCB 2WB1A 3GMNA 1G1CA 3DGGA 3HS0B 3RA7H 3D3VE 4OLEA 4W9DC 4Y5VB 4XPBL 1CGTA 2QHRH 1AKPA 5GGSY 1VFBB 4Y2DC 1I7ZB 5I1AB 1JSYA 3O2VH 2VR4A 3L7FB 3NJVA 1N2RA 3BWUF 3IAQA 5EU6E 4F1SA 1M05A 4PRIA 5IHZB 4AITA 3C5ZD 5DJ2B 3AC0A 4S1QL 1TQSA 3CHOA 1CFQB 3MYJA 2DIAA 2JIXB 2PETA 3KLLA 1A64A 3CSPA 4NRXA 4OJFL 4JFEA 4HGMA 4J3WA 5INDA 3D09A 2BY0A 4WUUD 2GTZB 4O2CB 4W9IC 1KGJA 5I5JA 4UT7H 3B83A 3UGEA 1HE8A 4HJGB 4MCYA 1OGAE 1OAJA 3W82A 2OLDA 5JNYB 2V2TA 4HLJA 5FA3B 2YMTA 1ZHLB 3Q5OA 3BUBA 5FGSA 1QLEB 2O93L 4JPKL 1ITCA 3HFML 1TJHH 4MSWB 5JIDA 2CCLA 2ICCA 4ZTPH 2EXYC 5DVOA 2EIMB 1KIQB 2BNQA 3GC3A 2PPFA 3WMQA 3R18A 3L16A 3POCA 3TZVC 4H1LA 4GQ9H 1NLBH 3RY6C 1PY4A 5L8LB 3QWQB 4F2ME 4GS7C 1YN7B 3OWRA 2BHUA 4N1EA 4KAQH 43C9A 3QHFH 3UG4A 4QI3A 3IXAA 2CO7B 4W70A 5LNDA 1FL5B 4Z77A 3EJJX 2PPCA 3F84A 4N2OA 5BW7C 2ILLA 3TM6A 4EI0A 5KYYB 3IE4A 1XSJA 2DOCA 1IFRA 1LP9E 2AJZB 5FYLD 2ESVD 1EEZB 1QSVA 4OKDA 3WXWH 1ES0B 3F7YB 3WNJA 2BP8B 4LVEA 3I9IA 4PJAA 4XPHH 3R1GL 5D1ZB 4ALAC 4F37K 4I1NB 5I0XA 2A73A 1ZANH 3L5WA 4FYSA 2WJ7A 4OJFH 1GHFL 3F3HA 2BERA 4HT1H 4G42A 1OSZA 4GO8A 3DPBA 1YDPB 5LWYH 2VMFA 3O8XB 4WFGD 1SEQL 1HHJA 3X1GA 2XIDA 2GK0B 2PYED 4PTUB 1S8DB 4LHUA 3CCHB 3QQDB 2AQNA 1RZ7H 4E9TA 1BA9A 1F41A 3HFMH 1ZTXE 1XMEB 3B2VL 3V10A 3LX9A 3RVUC 3RUGB 2DBLL 3C2AL 4G5AA 5HHOA 5IQLA 3S0PA 3VI3A 1UM6L 2YPLE 1ID2A 2ZX7A 1CF8L 5BO1L 4ZFGH 4G8AC 1ZGLA 1OW0A 2IWFA 1GGCH 2Y07H 4JO4L 3BPLC 5EORH 3AS0A 4PRIE 1QAWA 3QS3A 3OHXC 4EI5C 1KIPB 5LGHL 3K1KC 4P2QA 4GMTL 3WY1A 3AUWB 2X09A 4KU1A 5DEFA 1M1XA 4H5SB 2BMKB 4TQHA 3RX9A 1DANT 4DVBB 4XPGL 5E99L 3G6DL 3OAUH 4JFEE 1MCDA 2ATKA 4TNFA 3MV9D 2WY3B 1AH1A 3X13A 4YIQB 4LDEB 4WJ5A 4CMHB 4L8BA 1NBVL 1CB4A 3PWPD 1HHGB 4L5FE 3RVVC 1M3JA 5EEWA 3ZDXF 5IOKA 1TCMA 1TZHB 1I7RB 3DV4B 1WC7B 2BVQA 2KZBA 3LKRB 3LKSB 3RHWF 2F0CA 5ID0A 2V6HA 1PZ5B 5DMJB 3QIWC 5AZ2H 1D9KB 1UUSA 1IGCH 2VUYA 2P47B 4WWOA 2BNQE 2CDGA 2B16A 4QHUB 1M6OB 3WE1A 5FM5O 4AYMC 1CU4L 3KW8A 2NNAB 2XWCA 4GBXD 3UEZA 2I7OA 2VE6A 5CSZB 2KPNA 2DWEB 1U8HB 3UXFA 2VN3A 1NJ9B 3MV8D 4N0RA 4R9HA 5LN8A 2WUCL 5G55A 3NIDE 2O6PA 2P9RA 4NRZB 1WFNA 2WLKA 4NC0B 3LQAH 2XWTA 2FSDA 2ERJC 2DWXA 3Q2CA 2D7TH 3SIKA 4MJJA 3MMEB 1M7DB 3CMOL 4YPGA 1PMYA 2H8PB 3OAWA 2UX7A 3FO9A 3L1FA 1U93A 5EZLB 3UBXA 1NGWA 4BE5A 1CJYA 3GK8L 3VG9C 5CSBA 4E9XA 5CEZD 5CUSH 4PJAE 3KJ4B 4OKVA 5ACZB 4L3FA 1WDAA 4MS8C 2YD7A 5T3ZE 5J11C 2I7SA 5DYOA 5A2FA 4P5TC 1N64H 5AKRA 2J88H 1HQRB 3WN5A 1N7MH 4OZFH 3WMSA 4HIXH 3HRZA 4PHXA 4NJ9H 4PW3A 1L9MA 1Q9LA 3S5YA 2WLMA 1CVRA 2FH6A 4OJDH 1S3KH 1JHKH 1T22A 3V5KB 1QG3A 4FG6C 1JCVA 5J3HC 1CGWA 1EPFA 3G6AB 3GMPB 3GMQB 4XTRC 1FC1A 2AEOA 5CCJA 1BQUA 2YGQA 2VDPB 5HHOE 3VI3E 4N0YH 1AAJA 4NBXB 4N9GB 4AGQA 3M17A 1WT5A 1MQKH 3FL7A 4EOWH 5KW9L 5C97A 1JRHH 2DKSA 5DWUH 4Y4FA 2G9HB 4HCFA 5F7UA 2LTQB 4MA1C 3E6FB 2ZUYA 2ZXQA 4G8FB 3EGSB 3QQNA 1QVOA 3QUYD 3MJGX 4JY5H 1RQ5A 4C8XA 2HRGA 4P2QE 4XPFH 4NJAH 1TIUA 4BQ9A 3AGVA 5F9JB 4M43L 2WXIA 3E7JA 3RTQD 1NEPA 4FQJH 3LPFA 4QAWA 5C0NC 1TZIB 1WFUA 3MGAA 3F7VA 1IZKA 4YSPA 3LXCA 3RY4A 4YDJA 5I6MA 4KH2A 1FZMB 2Y7QA 3VXMD 4XVSL 2UY6B 5F9OL 3SGJC 1LP9F 5DFWH 2WWOA 4WHTB 5FGCE 3Q6GH 4NO3B 3VFGH 2R39A 4N3UA 2QV4A 4WWPA 4RZCA 4KRPB 1COBA 5MEPA 3RZCB 4KOCA 2V9RA 4QRRB 5AW6B 5J1TC 3OG4B 4Z6AT 5IJVB 3Q8FA 5IB5A 3QXAB 4HCRL 2VDKB 4U1SB 4CSPA 4M1CC 1JZ7A 2ENSA 4B9PA 2EINB 3QEGH 4XNYH 3VWKB 5C07A 1S7XB 3WFEL 2AKRA 1OANA 1OGPA 4LLVB 3O4LA 3QCUL 4N2BA 1BBDH 1JNLL 1U8KB 5L7XH 1UADC 3KGSA 4MWFA 1L7TL 1R0AH 3OC5A 3CUPA 1H6TA 1L9TA 2HVKA 2MSPA 3AAZA 5C0AB 3Q2LA 4Q6IA 1QMUA 1BZQK 5HHNA 4TNWK 1MDTA 3PXJA 5KW9H 4JHWH 1MHCB 4G1EB 4DK6A 4HWEH 2EVHA 2FJHA 4Y2LA 2FR4A 4FADA 5AAWA 4HG4J 2OMWB 4HLZG 4IKKA 1FSKB 2QR0A 4NO0D 3JT0A 3QISA 2V3DA 2OS7A 2FX7H 1XH0A 3QEQD 5HGGS 4YUEL 1MEXL 4CRPA 3FUFA 5E6RB 4KPHH 5EZPA 1YEKL 3O9WD 3BAEL 3BCFA 1ET5A 4J1UA 1TPXB 4WO4B 1I8LA 2MCPH 4LLYB 3P54A 4LPVA 1KXHA 5IOPB 1D2PA 2A83B 1ZHKB 1XO8A 3P9LB 4QRSB 1S9XA 4FXKA 3AQXA 5D4IA 2OL3A 4Z0BL 3KPOA 1N59A 2G2RB 3B2MA 2GFBB 5LGJA 1QQDB 3B2XA 1OZTG 2WYTA 2H3NA 4ZUUA 3O6KH 2AGJL 2RALA 3UPCA 2ZKXA 1OP4A 4M62H 4YDLB 1BD2D 1I9RL 1NC2D 4FFVD 4GKLA 2JB6A 4LASH 1OTUC 5SX4H 3HZMA 3QZNA 1J10A 2HFTA 5DT1L 3AT0A 4PB9H 3NESA 4IMLA 1H5BB 1YY8A 3RVTD 5IUCA 4XR8C 1FZJA 3IGFA 1NUNB 1SZNA 3BZFB 3LMJL 4LE8A 4MD4A 4PQXA 1NWPA 2CJUH 1DQML 3MGTA 3NIDF 3IDIB 1EO5A 4AYFB 3ZT5A 4ZMZA 3IJSB 5E9AA 3VFOA 1AQDA 1MWAB 1FGNL 2DH2A 1VDGA 5LAXA 1MH5A 3PFQA 3CHSA 1F3JB 5E6SB 5CFHA 7PAZA 4OCYL 4M7JL 4HIPA 1JYWA 5HXMA 4OGYL 3J07A 2XZAL 5D70L 4ZOCA 2E56A 3T77B 1SM3H 5H8DA 1A9BB 5L0QC 2XY2A 4YHNA 2NY7L 4BQ6A 2HPOA 4KX9A 5GRJH 1JXKA 5DD5H 4FGMA 5KVEH 4NB7A 4XC3H 1WRFA 1IC4L 1G7MB 2V8LA 4FLHA 5IT2L 4JGUA 5LBSL 5C07E 3DROB 3O4LE 4Z5RA 4KROB 3PHOA 1M1SA 4WGVB 4GAJL 1YMHB 4OGZA 3FFCD 1XGYH 5AW1B 1JZ5A 2ZSWA 3R0NA 5FECA 4CKQA 5KVGL 1I9RH 2NY2C 4R7NB 3CHQA 4LL4A 4XP9L 1R24B 5DQ9A 4Z0XB 1JOIA 1CURA 5L4FA 4KX7A 3CFJA 4UU9B 1IBGL 4Y1SA 5JPMC 5DXWA 1C12B 4QY8A 1PZ2A 4PJ9B 4GO9A 4K3HA 5I66A 4PW4A 4P23D 3GRWL 1ACZA 4FRWA 1HQ4A 4IBLT 4MCMA 4L1BA 3ULUD 3VO0A 4YBLB 3HNVH 3JBG7 4ZD3L 1OGTA 2FB4L 2YPVL 1YJDC 2XG4B 3HMXL 4WUKH 2J6EL 4GG6B 2AMGA 3ZBMA 2PCFA 1ZE3C 32C2A 5D70H 4FLSA 2F74B 3MNWB 5E2TH 5B38A 4F7KA 4U3XA 1LK2A 3NCXA 5IHLB 1A7NH 3P77B 2GIMA 2ATAA 2IBZY 1XGTB 4J3OD 3G5VB 3QIUB 4FP8H 4YSTA 4JFQB 3ULVH 2YHGA 2I25N 2RH0A 3NCBB 2GAZA 3Q1SL 4Y2DA 3V0DA 1NCAH 3QXDB 4PJCB 3ARZA 4P3WA 1OAUH 3WO3B 4ELKA 2UWEA 3ISRA 1SEBB 5DRXA 1AGEB 3VXRB 2FSEA 2Q86B 3BHBB 1BMZA 1SRDA 5GRUL 2YGVA 4HALA 4UAHA 2ENPA 2YRZA 4NZDA 2X2HA 3NRQA 4H40A 5GGTA 2RFXA 5K9OA 2WIIA 4X83A 5EN2B 2VDNL 3BAJA 3RWHB 3K5SA 4NKDB 2AS5M 3I02B 4I0KA 5I73C 4NFBA 1TZOA 2AXGB 2XQYG 1D7FA 4U7MA 5AVWB 2X1PA 1TXKA 1ZK9A 1HDMB 1KJ2A 1T4WA 3GRWH 3RJDA 4GRLD 3LKPB 4K71C 3OBAA 5DJDA 3ECUA 2X1XR 1NCDL 1Y1UA 5DEGB 1H8LA 1YO4A 4HEPG 1XF4B 1TJIH 3EDEA 4FFYL 2R1YA 3TZVA 5DS8A 1OT1A 5DFAA 5F7MC 5KJRH 1E5AA 3RY6A 4CADB 3L1OL 3R8BB 5IR1A 2PW2B 1IBZA 4IS6A 4WEUD 2P5EB 1YUKB 1T1XA 2FEDD 2VDLL 1GKOA 3DRQB 1SQ2N 2VABA 3CDGA 4OZGB 2FEEI 4PJFA 5BW7A 4XOBA 2GTWA 3UYOD 2FL5A 2OXGB 5A7BA 2ZKYA 2ADIB 2R2HB 1UT1A 4ORZC 3C2SA 1MCOH 4MAUL 5ACLA 1HILB 4MNGB 2OMTB 1B9KA 5D72H 4KUZH 4OFVA 3ECBB 4IOFC 3DO7A 1JMZA 2W0FA 4QLRA 2LU3A 4E5XB 2WVSA 1U33A 3SB3A 3KPTA 4K23H 5I23A 1KNOA 2O5YH 4PYHA 3Q6FB 3JTTA 1TTCA 2QADC 5F88A 5IQ9A 4BFBD 1B88A 2G4GA 3ENEA 4ONHB 1NTDA 2ADGB 4X4YB 1IFHL 2VR8A 2W9EH 1HEZB 3O45B 3HZKA 2GBVA 2XUWA 3WXVH 3DX7A 3HR5B 5AVRB 1QNZL 3IM1A 5FCUL 4DKEL 1A3RL 4N4YB 3ZZQA 4WU5A 5C0BD 4M6NH 1MJ8L 3GO1H 2GBAA 5JZ7C 1I1FA 3O3EB 4Y5YC 3RJQB 1TKWA 4MAYB 1HINL 2GJJA 3EO1B 5JIPA 2YLKA 1VFOA 2GSMB 4IOIA 4E9LA 4GRWF 5D7IA 3LH8A 2R9HC 4NERA 25C8H 2EIBA 3VXUB 1AE6H 3OHXA 1G9NH 4ODWB 2UWEE 4EI5A 2VITA 1KN2H 2BIMA 2IG2L 2YZ1A 5IHHA 3GSQA 3X11B 4OZIB 4XNUH 2E9GA 2X4QA 3BH8A 3QA3B 4KTDL 2HTLD 3QIBB 1OF2B 2ID5A 1VZHA 1DDTA 4FKHA 3QDMB 1KPVA 1EJOH 4FFZH 4TUKH 1I3GL 1Q9OB 1RFDH 2Y5TA 5DS1A 3VQLA 3BKJL 4Y9FA 3ZT7A 1KJVB 1TCRB 2YLHA 3KBPA 3TF7C 4E41B 3UCRA 3VWJC 3W39A 5C0CA 2YFNA 4KKBC 3LPPA 4QF1B 2YUZA 5I1GH 1UXWA 1T89A 4PMEA 4ZMWA 3QIWA 5KJ7E 4BHUA 3BUYA 5JUEL 1JNHB 1UOLA 2GUOB 4AVJA 2VOTA 1A7RH 1R5IB 5I71C 3V9EA 4P07A 1FLRH 3D85D 3D9AH 4M3JA 3ARGC 2JKWA 3DBSA 4ZBJA 4NQSB 1E4WH 3CVCA 3ZKMD 1ZWIB 3SPVA 3ILQC 3VH8A 1G7PA 5BRZA 5BZZA 2WOYA 3RIAF 1FORH 2OMZB 5F6IB 3B8YA 2WZPD 3GXMA 2VQTA 3L3IA 4M6OH 1HZLA 3E6HA 3VXSD 4PJFE 3I9PA 3ZDZB 2CPUA 1IM9B 5IW6B 4KHXH 5JIKA 5EDSA 4LLDA 4XCEA 2PXYD 2WINA 2P4AB 4TUOB 1FYTD 1QYGH 5EO0B 3P0VL 1XXDC 3QPQD 5B3SB 1TTUA 4K7FB 5EU3A 3MXVL 4ZUVA 1I1YB 4JGMA 4QOKA 4MJ2A 4K3EH 5JYMA 1KFAH 4P5TA 1MJUH 3NT0A 1DE4B 4ACPA 4KITB 1NBQA 1GCYA 4HETA 3VU2A 3EDDA 3IJEA 5EIIB 2AK4B 2BS8A 3M07A 1JPGB 3GMOB 3L9YA 4MRCA 4WFED 3BD5A 1ZVSB 2KDGA 4QNPE 3ABGA 4K7PY 4X5WB 4AQEA 2P48B 1MWOA 4Z7QE 1QR1A 4IW4C 2BSTB 4LBEB 3UBXI 3PP3H 3KLHD 4WI8A 5HI5D 1UWFA 3NA9H 4JFFA 2WOBA 4WSGA 5DWPA 2L7UA 3D6GA 5D7IE 5MENB 4MASA 4GXUN 5E8EB 2APBA 1LVEA 2W1NA 2K7QA 3BVNA 4ZFFA 2WXFA 4DZ8B 4G6JL 5DZ9A 3HG1A 1OSPL 3BKCL 3FUNA 4YDZA 1G7HA 3CSFA 4J3OG 5BMFH 4B0MM 4RWHA 1BVOA 5HGAB 2WLNA 3MZGB 2RHEA 1DVFA 4LCCB 3CFKA 4P3CL 4FQXD 2WNXA 1TQWA 4X98B 3IPFA 3BVXA 3L2LA 3ZKQD 3ARDB 1ETB1 3C5SB 1EV2E 4TV3A 3SGJA 5DD0L 5C8JA 5IEHA 5IVZB 1ZKAA 4MXVE 3D50A 3BDYL 3GZQA 5C0CE 1S9WA 2Y2WA 4KKLC 5AVQB 3SE8L 3KVPA 4NZ8A 2K78A 1QX1A 2X6CA 3EO9L 4KVCL 4XAKE 3T6ZA 4S11A 5AG9A 3DPDA 2VDRB 3EYOB 1WLHA 3LZLA 3QWOB 5K5YA 1BZ7A 3NFSH 4HIJB 4AJVA 4YZFE 1ACCA 1G9ML 4JZOB 2J8UB 5T3XH 3V4PB 2DLHA 1UASA 3L13A 4Y1TA 3WO4C 2V5RA 5J1AB 2FO1A 1YNTB 1A6UH 1P5VB 2CHDA 3GMMA 3IB4A 2H32A 5IG7B 3HN8A 4AY0A 5BRZE 5F21B 2XN9B 3IBEA 4FQ2L 3V4VL 4Z76A 4Y89A 1C16B 4NKOB 3TEYA 1W8OA 1RU9H 2P5PA 2Y0SA 5HJBA 1YYLH 1B0RB 3M1BA 2XRAH 2W95A 4JM0A 1NCBH 4UQBA 1OHQA 4XNXL 1WBZB 2Y06L 4BJLA 2XVBA 5HJ3B 3J8F7 3FT4A 5ID1B 3HZYB 4BRVA 3AQDA 1E3XA 1TTAA 1EO8L 5BUAA 1G4RA 1JG9A 3ZSTA 3RWCB 4NAQA 1Y6MR 1CIDA 4LOVA 4CNIA 3HC0B 2FJSA 1NC4D 2ED8A 2BLFA 5D1QD 1LHZA 2B15A 1H3XA 1YA5A 3DSFL 1XGUA 7TAAA 2NR6C 1F90H 4HS6A 5D7JA 3FUMA 2HVJB 4YN3A 1S7QB 3RNKB 3MTRA 3PWUA 2A9BA 5SWSA 3BZEB 3H9SB 1MCPH 5F7KC 2WO4A 4HMEA 3L3KA 3WJMA 1KWKA 5DD1L 4UTBL 1E9QB 3NSCA 1WBYA 3P4LA 4L4JA 4U1JB 5EU7C 3SE8H 5C0RH 5KVFE 1WFTA 4G6AC 2V7NA 3SPGA 4BYHA 4RMQA 2XY1A 3DETD 3VG0L 4WFHE 2EKSA 2WTRA 5FFOA 4BH8B 1MI5B 2X4OA 4UTAH 4I3GA 3ZZSA 5JORA 2VISB 3BT2L 4JFFE 4K3DH 4NHUB 3PL6B 3VXQA 3W11C 5K69A 3MRGA 5CINL 3REWB 4AV4A 3O3UN 3P73B 4ZFOL 4TQEL 5EH1A 2O5XH 5ESVB 5CCKL 3UERA 4KVPA 5FYJL 1AVAA 4AQ1C 1F8TL 1A4KA 4YR6B 3CFNA 3VX0A 1CLVA 3HG1E 3ARPA 3FBQA 3QDHA 3CD4A 3H8NA 1FV1A 3SCMC 1LEGB 2NX5D 4DN3H 4IRJC 1IGIH 3APMA 5SV3A 1BZ8A 2HLAB 4PJFF 5IIEA 1X4ZA 3U0TB 3MLWH 4RDBA 4NPYA 5DEJA 4DEUA 2R27A 4GT0A 2Y6SD 3EYFB 5E8NA 3VACA 1ZA3B 2B5IB 1L3WA 4JG9A 4LSTH 4OIBA 3OZKA 4J7RA 5JLZA 3MJ7A 3JZYA 1S2EA 3QG6B 5DHVB 3H3PL 4A1RA 2J2ZB 1EO7A 2XZCL 2ZYRA 4RAVB 2IGFL 2BSBA 3K71A 3DURB 1HHIA 1TYEB 3QUXB 2F19L 4KI5D 4NEHB 5E1IA 5F6HI 5AD0B 1JPEA 4UT9A 5DD6B 1T3FB 1IC1A 3ZXAC 1MRDL 1M42A 3TWYA 5IFAH 5CP3A 2HT4D 3NOIA 4U2ZA 3M8OL 3G3LA 2XVLA 4F8QA 5HTSA 4NZTL 1X6LA 3MRJB 3PPEA 3QYMA 4EPSA 5C0DB 5KZCB 3LY6A 4QNPF 2GK2A 2XZZA 1KIRB 3MRCB 5DZPA 4KX8A 1G87A 4Z7QF 3ARFC 1NCNA 1RSFA 2X2JA 1A1NA 1KDIA 5DC0A 4LRNL 1DN0A 1SLXA 2Y7NA 5JPMA 1J8HA 5IVOA 3ESNA 3RDJA 1WWAX 2FIKB 1IAMA 2EXSA 3M7OA 5I74C 1ZLSL 4YK4C 3K6SB 1BLNA 4L2LA 3TBSB 1UC6A 1UJ3B 3ME0A 1SN0A 3HA0A 1MN4A 5TK2A 2OX5A 4EUPB 3MBWB 1QBML 1Z66A 2QVFB 4PJ7B 5SWSE 5EWIH 1KWGA 5IMOB 5C6WH 3D25B 5GZOD 4G1MA 2E27L 1F6LL 2R69A 3ROOA 3FRPG 2JVUA 3L2MA 4AG4L 1JI2A 4E9QA 2XN1A 1D7CA 3MLSL 1Z5YD 4G71B 4MXVF 3LRHA 4OGQC 5TJWK 4HS3A 1W72H 1YQVH 1AQMA 4QXUL 3DVNA 3WN6A 4ZMXA 3KLQA 4LIQH 2MMXA 2RAMA 4NENB 2L7QA 1KMGA 1OARL 4W4OC 1CFNB 3W9DB 1EMTH 4YZFF 4A2GA 2H47C 2WVVA 2OTWB 1F4WL 4JDVA 1HHKA 1XZ0A 1CDCA 1J48A 2BIQA 4L1HA 4NUJA 5I76A 5KUMA 4OFKA 2YD0A 4OFYD 3ELAT 3C6SB 3P3RA 5IMLA 3MRNB 3FO0L 4PSPA 2XI9A 1XMWA 2QTVA 4HUUA 5D1XB 1A7OH 1J8KA 2P49B 2MCAA 3BYTA 1OT4A 3DIFB 4OLWL 1ZS8A 3D4CA 1KLGA 4S1DC 3QDJD 2EH7L 4OLUH 4ZMAT 5I75B 4YHKH 1RUKH 3U7YH 1YYCA 3BSZA 1J12A 4YHLL 5DZNA 1UCBL 3S97C 1Z5LA 3O6LH 4H2AA 1FFPB 4WEBL 1OOAA 2OXHB 2C9QA 4P2YA 1H0DB 4XODA 2LR4A 3ZK0A 4MAZA 2D3NA 1A1OA 1UG9A 5HI3C 4DFHA 1A6TB 2EZ0D 1NDMA 2Z4TA 1AFVL 4X80H 2HKHL 2MQ3A 3M7FB 3KCWA 2P5WA 2NNXA 1QA9A 4UB0L 5EEXA 4HPYH 4IDLA 3O11B 3WLBB 3I6GA 1UOKA 4RNRA 2EE0A 3EO0A 2FGWL 3IDYB 3SZ6A 1IAKB 5C0FB 1P5UB 1A8ZA 1ACYL 1B4LA 5F71A 5IVXA 4ZPVB 2OAAA 4AM0A 2AJXL 5GS0L 1KCRH 3HAEG 5GIRA 3ZX1A 1HVXA 3FN3A 4H0IA 4UV7H 4F92B 2EDTA 4LVHC 1J8HE 2FEEL 3U0WH 4L5FL 3T4YB 2DQGH 2XX1A 3GKWL 2HRPL 5ESAB 1N4XH 2FT8A 3EJZC 4ZS6C 5JDSA 2X41A 4QYOA 3OMNB 2DM2A 3MC0A 2IFFL 2X2UA 3UTPD 4WGWB 4KQ0A 4JRYB 3G04B 5I1HL 4XPAH 1ACXA 2QTEA 4NXSA 4OSUH 2BVPA 3MRBB 2ED7A 2EYSA 1E8YA 3OD3A 4DP9X 3SYOA 3MLTB 1VESA 4K0OA 4NPKA 3GXDA 4OY9A 4X8JB 1Y6NR 3L3GA 1FZKB 1JHTB 4EIBA 3LIZH 4UAOB 5K9QG 1TNNA 4JHAH 4OLZH 3VFSA 2KERA 4XNMB 1KTDB 4PJEB 1HOEA 4N90E 2R59A 2ZICA 3PJNA 1AKJA 1HSAA 2ZYIA 3PHQB 4Y5YA 4P04A 3U6RB 4DAGH 2B1HL 2B3IA 3ET9F 2EACA 2NOYA 3L8QA 3L6FA 4PRAA 1KCKA 3TU6A 1EHKB 1L6ZA 2P7TB 4PV9A 2IAMD 1WPCA 2APTA 1KELH 4ZTOL 1VF5C 4D9QE 2WXRA 3FN0H 4G7SB 3VQ1C 1JK8A 1VGEL 5ISZA 1BXXA 4UIMB 2HUEA 3QARA 5KTEL 1Q9KA 5GSVB 4Z7VA 4YDNA 3VFMA 2KMWA 3VXOB 3NSDA 4OU3A 2BWQA 4P9ML 5D7LD 1S7TA 4JLRA 3K2IA 4TRPH 5JHDA 3RWEB 4V1DD 2GI0A 4LPXA 1CR9L 2X7LA 3MRKA 1SDAB 4RZKA 1A3ZA 3VWJA 4M4RB 1QSEB 2Z4QA 4DP4X 4Q0XH 3KPSA 3S3PA 1MFAH 1TF4A 3B7TA 1M4KA 5F0MB 4UQIM 1DBBL 3D2UA 4XPTH 2P46B 4HJJH 5T1LA 2QBWA 4L9DA 3UC0L 3T0EC 3IFPA 4B9KC 2F8IA 2P5WE 1HWHB 1PCXA 2CK0L 3EGDB 4G11A 2B59A 3SJVA 1MVUB 2NXYB 1KG0B 3VYPA 5IK3B 3ARGA 3VXNA 2AJ3A 4OM0H 1PZDA 5G4NA 4HLZH 1X9RA 2WXOA 5E5UB 1T04A 1QRND 5ALBH 5IVXE 2N7BA 4DN4H 2Z64C 3CQFA 4JZNA 3UFIA 1CFVL 4LAQH 2P8MA 1O6VA 2XWJB 4L4TB 4TQIA 3BIKB 1P4IL 3DIDA 3LRSA 4JPVH 3TN0C 4XXCC 5FYLH 3QFDB 1I9JH 3QEHA 4BQ8A 2BVOA 1GR7A 2BDNL 3ZT6A 3CNKA 1XR9A 4HBQA 3H0TB 5BZXA 1GAFL 3HVNA 1CF1A 5F7EL 5JW5A 3K2UL 1SOXA 1LE5A 1RJZA 2ZE0A 1V3JA 4PRHA 3V5HB 2DQIL 2AJUL 3HBQA 2OR7A 2W9DH 4LF3A 3KWWA 2KS0A 1TEFA 2DQCL 4UOW0 2BNRA 3WNMA 3QRFM 3IS0X 1TLKA 5CJOL 3QWRA 4J6RL 3Q3GA 3T3MB 1WEJL 3QXTA 4MCZB 3QNYA 1NINA 4NO5A 4WI0A 2IPKA 2OZ4H 3KL3A 4N2FA 4JFHD 4IU2B 1Y0LA 5D7EA 4KK8D 4CW1B 3C9NA 1UWEL 2EYRA 4AMKH 1F58H 4YO0A 2ZF9A 3UTTD 3VFUA 1AMYA 3UTOA 4UBDD 2XPGA 4F7CB 5GSRB 3GI9H 4M8QA 4Y88A 4RGMB 4M3KB 3O2DA 5BNXD 2A1WL 4J4PC 4ZUTA 5FXCH 5CJBA 4A38A 5KYXB 3P2DA 4CVWA 2YD6A 2WC7A 2DD8H 4YHPB 5D1ZC 2G5BB 1BEYL 3IETB 2ZOLA 1Z9LA 5DQDL 3GQFA 4XNQA 4QT5A 3UTQA 5ISZE 5HGBB 2P28B 3D3VD 3NZUA 3P4NB 5CFAA 1TQUA 1KOAA 1R9FA 1MW0A 3EOAA 3V7AE 3OLDA 1CTNA 4N3TA 3RGVB 3UTSA 5JHDE 3DECA 3VGFA 2OFQA 3JV0A 3O8XC 4CU8A 2H7WA 4DF9A 5EPMB 5D6CA 2IOIA 4AEHH 3C8KA 3JWOH 5JXEC 3KPSE 3V8OA 2WXPA 3CHPA 1QEWB 4XAWL 5FUZH 4C58B 1RZJL 4XNDA 3CVHA 5F7DB 2RCSL 3TYGL 5BV7C 3K81A 5IB1B 1BVKB 1FNSL 3R7RA 4GKNA 4UM8A 3CN3A 4L29B 1EDQA 3B5GA 3SJVE 5E0QA 5T33L 1EFXD 1RJLB 4QRAA 5EBWB 4LEXL 1TTFA 2R29H 2J1WA 2Z92B 3BO8B 1PNDA 2X2YA 4PJBB 2G30A 3BP4A 5FYJU 2ZUUA 2HFGH 4XO9A 4DKDC 4DNLA 1CPUA 4X4XA 1OZUA 3TO4D 4EIUA 3IWVA 4HUXB 3A6CL 3RU8L 4P2AA 4LNVA 4CMHC 4APQB 5CEZH 3RHWK 2OMNA 3VFNA 4HUWA 1BZOA 1FNGB 3ZKXC 3ILPB 4LGSB 3L5IA 1AI1H 4LHJB 5TPWH 1GCFA 4OR1A 4IU3A 1OK8A 3QUZD 4PRHE 2NR6A 3GSWA 1FG9C 3FHAA 3CG8A 3RTLA 5AW4B 1IAOA 2VDNB 2BNRE 4URKA 2OSWA 2DI9A 4XH2B 2D3JA 4S2SB 4XB8A 3B4NA 5E6IC 2ZD0A 5DTFB 3Q7JA 3MUZ1 2DTML 4K3JL 4R4BB 3TT1L 1QO3B 4LGRB 3NCCB 5JR1L 2GITB 2YQBA 4BFRA 3OZ9L 4R3SA 4JFWA 2CIIA 5SWQA 4DK5A 5IM7A 1G6RH 3NIFF 1DEEA 2HJKA 5ETUA 4G8GD 2NY4B 4BKTC 1BF8A 4BKSC 3WV0A 1MCRA 1DN2A 1P7BA 3QZWA 1L7IL 3S3DB 4KC3B 4NFDA 4P59L 2AJYL 3NK3A 2VDLB 1ND0B 1Q90A 3C8HA 1QATA 1CDBA 5DUPL 4A7QA 3SCMA 1GC1L 4FQPA 4N6RA 3PLYA 4MNHA 4I3SH 5IVXF 2YPLD 1AQHA 4IRJA 4I85A 3WNPA 3TASA 2OMXB 1T0PB 2E46A 4AUUA 3SE6A 2X4RA 1OAKL 1IE4A 3UTSE 4E68A 1I8MB 4PGZA 5E4AA 4DGUA 3DJRA 4TULL 5KBLA 2P3YA 1FIGL 2H1LM 4PS7A 3SPCA 1IM3B 3HUJB 4R0LC 5HHPA 5I19L 3S4SG 3US9A 2Y22A 5T5NF 4MKMA 4GUQA 1HS6A 5DVMA 2KKQA 1DQJB 4NHCL 1CMOA 4NNPH 5EF1A 2LTQC 3T0XA 5F3HB 4EBQL 2MIZA 2F58L 3BWSA 1KEML 3US1A 5AOKA 4YS4A 1I7TA 4QRFA 5LLIC 2OSLA 2WBKA 3FU7B 4KJPD 2YRBA 2FCBA 2KQMA 4DUXA 1JS4A 4XN8A 1R3LA 3S5LG 3ARFA 3ZDYE 4LT7A 1CGVA 3NPZB 1AXTL 1E27B 3L3JA 4XO3A 4JPWL 4ZS7L 2FJGA 1N6UA 5DJCA 4NRYA 2CBOA 4HOXA 3DVFA 1LDPL 5C08E 4Y2OA 3OQ3B 1LO4L 5CLXA 1OXYA 2BX5A 4E9SA 4YDVA 1ADWA 3EXLA 4OTXH 4NZRH 1X7TA 1GC1H 1LXMA 1U92A 2F7QA 1SF3A 5F0LB 3VCLB 4OUUB 3EOTH 4HH8A 1MFEH 4X0KA 4PRPE 3B2UD 3CFEA 3DHJA 5F0JB 4PJIB 4JUSA 3RDTB 4YXKL 2Z31B 2EDWA 4U1HA 3BH4A 2Z6FA 1FVEA 3HE6D 1N67A 1Y18B 2F5AL 3TT3L 5ILTH 4JKLA 1BOGB 3S37X 4N0CD 2WV3A 1VACA 3MOBL 3HI5L 3QQ4A 4RGOL 4XO5A 1VPOH 5EU7E 4EDXA 5T3ZD 4D8PA 1FCCA 1L0YA 3T1WA 4UM9B 1WZ1H 3EOBB 3FUJA 1WA2X 2X0VA 3SYQA 3K3QA 1SPDA 2EADA 3S37H 1AIFA 3VM5A 4JJ5B 1Q1JH 4W4OA 4P2OB 5H37H 4P48A 1J9CT 2E4TA 2XQBL 2ZPKL 5FW6A 3A4EA 1JNNH 3CBJB 3RBGA 1FSKC 3OJ2C 3ARBD 3MJ9H 4XBMA 4Y9CA 4ZXBB 2A6KB 1GMIA 3DGCR 5BVPH 4LLUB 3GJFH 2NUTB 3QQ3A 4U1NA 5BS0A 4C47A 1TPXC 3HR6A 2BRRL 1D6EA 2FAUA 4PV8B 5IBLC 3K0YA 4R97B 3L81A 4XCNB 4H8WH 4C56A 1FRGL 2VN5A 5BRQA 4ES9A 4XO4A 3SQBA 2DWDA 2FWUA 4N6QA 4OCNC 3ISYA 2Q2EB 4H8HA 2GBTA 2IANA 4HISA 5DYFA 3BISA 5C6PB 3STLA 2ARJB 2CHZA 2GT9A 3PDOB 1UB5A 4HHAB 1RUMH 4RAUA 4MLSA 5G4OA 4U6YB 1XCXA 3O0RH 4M6ML 1ASQA 3GIZH 2AQTA 2C9UA 1IBDA 1I9IH 4APXB 4F27A 3Q43A 1H3GA 3QPKA 1DFXA 4AQAA 5FO8A 2ZWZA 1CK0H 1V7ML 4NFCA 4G6FB 3SDYH 1H5BC 2X4SB 1RMFL 3PIQB 1L0QA 1UOWA 1CYGA 3AADB 3NDZE 1I53A 1MIEL 4JG0L 4PS4H 4WW1A 1IMHC 3SGEI 2I27N 2DLIA 2F7IA 4U0RC 2DLFH 1R33A 2ZF8A 1X5LA 3EJUA 2VMDA 1SVCP 4HMDA 1NLDH 5GGTL 2BY3A 3LIUA 2NY1D 2JQAA 2MKWA 1MHPL 3DX8A 2JSFA 4AL8H 5GGSA 2BFGA 4HX1B 5F9WB 1G7LA 2WZ0A 3LSOB 3EJZD 4FQCH 2XHNA 4R2GD 3FT3B 4FXTA 2Q6WA 3ZSSA 1UM4H 4O4YL 1KJ2L 2F54B 4XMWA 4O2FA 4QXGH 4ZFZB 1NCTA 3TLRA 2TRYA 4JFDB 5EUOB 3ULUH 2DM4A 3KPRA 8FABB 2Z35A 1AIZA 4JCLA 2CNZA 4QXVA 1SJMA 2PWDA 3TVMD 5DMIH 2E8YA 5A3ID 5JIHA 4C4KO 1PW3A 5K9JL 2D0GA 1B6UA 5GGUA 2BOBA 3GYRA 4F3FA 1R3JA 4U31A 3IAGC 2XPZA 4UANA 1D5BB 1SY6A 2NW2A 1DQDL 3FQTB 4RMUA 3WTVA 4J3OH 1XHHA 1NH6A 4K8RD 3JV4B 3C5XA 3EHBD 2IADB 4EE2A 3AM8C 4XN7A 4HSAC 1ZEAH 2NDFA 4W6YB 4FCAA 3SY0B 3V4VB 5JXAH 3EXJA 1N19A 4CJ0A 4CJ1A 2WLLA 4PJ9C 3T09A 4ALAL 3NFNA 3QDGB 4OIIL 4HK0B 2VDOH 1NFAA 3T08A 2W5PA 5H35A 2Q76B 2Q9OA 2CDFA 4LPWA 1L9SA 1YEFL 3OMZA 1UGKA 2WTPA 7FABH 2QFRA 2VXQH 1ZLWK 4MZIA 1G4MA 1MXDA 3WFBH 1XF2A 3L5JA 5BS0E 2NXZB 4O2EB 4ODXB 3ZDYF 1DUYA 2I60L 3MUUA 3P30L 4C56E 4AE1A 3LNFA 4MJ5A 4N85A 4CAGA 2QQKL 4QXWA 1M7IB 4A7UA 2GJ6A 1Z1WA 3W0WD 2OCFD 2IANE 2HUHA 1PG7W 3EH5B 2K9UA 4JL1A 3MNVB 4ZW6A 1R3IH 2QELA 1T5XB 2ZG1A 4LKCA 3HS0A 4CVUA 3T0EA 1RH8A 1XIWB 3TEZA 1ZVNA 3MRPB 5F0PB 5I1AA 2EUVA 4YSRA 3MUHL 2F61A 5IHZA 5JQ6H 2B4CC 1LTXA 3MKKA 4N26A 3TFKC 3MV7B 5DJ2A 1N8ZB 3NIGB 1TFHA 4N68A 4LB8A 2JIXA 4RBPK 3ZL4L 1PBYA 1SMOA 4AGLA 4RGND 4GSQA 4JZJB 2OK0H 3IU4H 3TN0A 4XXCA 3ATFA 4C4UA 4Y19D 3O4LD 2HJLB 2O72A 1BQLH 5I30H 1YSOA 5LXGL 2IH1B 3OAZK 4HJGA 4W81A 2PTTA 2FUQA 3F85A 5FA3A 1Y7VA 1A4JB 1ZHLA 4OM1L 3X3GH 1YEFH 3LKQB 4GFTB 5HDQL 3STZA 3QCTL 4MSWA 3SQOL 1E3ZA 3KPRE 1C5BL 3IDXH 5E9DB 4K9EH 1KIQA 2CR3A 2KHAA 2Y72A 1I82A 1MNUL 2E9IA 2PN5A 2WO2B 4ENEC 4KQ3H 3QHTC 3P3UA 4OCWH 4ZUSB 4IEFB 4AGNA 3L9RB 3FQWB 4HFUH 4XP1L 6PAZA 4KRLB 5E00B 4UQ9A 4PJXE 4XX1E 2IH9A 5ABDE 4IGBD 2ITCB 1AR1B 1HYRC 2ICWI 5E6UB 4AIZA 4AXWB 2EVFA 5F7YC 4HIQA 2DQHH 4GI9A 2CO7A 1FL5A 4TMPA 2H3KA 5D71H 1UD6A 4KDWA 4XBPB 3T8MA 2ZSVA 4HIEB 5JPNB 5KYYA 2QSCL 2Q1EA 3IT8D 3N6YA 2AJZA 3VD3A 4DGVL 4ZNCD 3RFZB 2HKFL 1DJZA 2IEPA 4YLBA 3SDAC 1CDJA 1XCQB 4Z1PA 1ES0A 2O6CA 3PHSA 5INCB 3F7YA 3A6BH 3PP4H 3TJHD 2WNKA 3OSVA 3DJ9A 5D1ZA 3D0VA 5PAZA 3UAJD 1AZBA 4JPIB 2DDQL 1HKLL 1NGYA 3CXDL 1E5YA 5D7HA 3IGKA 5EU5A 5HGHB 4XVJH 1XT5A 4FXLA 3UH8A 1EHAA 5IQNA 2ZWLT 5C0IB 2VC2L 3CBRA 5GS2D 5AOJA 1PX4A 3MU3A 3FB6A 2FBJH 2G75B 5EZJA 1YDPA 3VJ6B 2QFPA 3BMVA 3O8XA 3TTSA 5IWLC 5F6HJ 2R0WH 4JN2A 2H9GB 2GJ6E 1VCBC 4HXBH 3IDGA 3T2LA 1A3LH 3BE1L 2GK0A 3U9UB 1IKFH 5JXEA 3QQDA 4KBPA 2C4FU 1I3VA 2D9CA 1BM7A 2X42A 1NMCC 3P3YA 3SDCB 2DH3A 2VLKA 1I8AA 4GI8A 5HYSB 2OSYA 2C3WA 3T0EE 2F8VA 2EUXA 3QI9B 5D4QA 5JW4R 2A2QT 3KJ6H 3HZVB 2AEQL 3UOAB 1S9KC 3IMUA 4FAAB 4UMSA 2AV7A 2AEWA 2DLGA 5I1EH 1IIKA 1OE2A 4YHML 3BAKA 5T1DH 4GO6B 1X9QA 1AZUA 2ZP0T 2BMKA 4TSAL 3ZGHA 4OAWB 4KRMB 1LP9B 1FZOB 4F93B 1R5VA 3RIFF 5I1KL 1R5WB 1P6AB 1DBAH 3N43F 5TH2B 1KTRL 4YIQA 1PEZA 2IOOA 4YL9A 5TDPB 4JQXC 3TBWB 1BBJB 1M71B 4X7TA 1OF0A 1CXLA 1RP8A 1I7RA 1X4XA 1WC7A 3IF1A 4FL4B 2H45A 4PR5B 4HHGA 2H4EA 3WI9A 2PP8A 1HXYB 1I3RB 2ZOKB 3NZ8A 5IMMA 1I1AD 1PZ5A 2ICES 3PDGA 4J3BA 4J8RB 3LJ3A 4G9DB 5ICUA 4H8QA 4QHUA 4E36A 4LOUC 4YX2H 4F5CA 3B9EA 3W38A 3RIAK 2NNAA 4M5YH 5E6IA 5CSZA 3ESVF 5JA8B 1J1OH 5JHBA 3L48A 4JVWA 1SYSB 3U4EB 4TVPD 4Y4HB 5F1SA 3K4DA 4NRZA 3DGGB 2Y7MA 5F6IC 5B3NA 3C6EA 1EX0A 3K6IA 4LQ1A 4Y1AD 4Q9RL 4K5NA 3BZ5A 3EJYD 1N2RB 2DQJH 2HG0A 4BSVB 4CDGC 3BP7B 5KVDL 2H8PA 4OLYH 1EAPB 3AW5A 5DI8A 2V2WB 4A7TA 5EZLA 1BPLB 2N0MA 2EDHA 5ALCH 1GGBL 4IRSB 2FLMA 2OMVB 1BYOA 5INDB 4KHTH 5EMYA 3ZKNC 1PYWA 3P2BA 3I2CH 4NZJA 5BUGA 3LZFL 1OAZL 3ABKB 2WP3O 3ZTNH 4GSUA 4MCYB 2X4NA 2PWHA 2X89D 5TF0A 1RZKC 5HYFA 4ERSL 4MJID 1O6SB 4UILL 3V5KA 2A74C 4N2DA 2WXNA 1DSYA 4H0LC 4L3CA 1K4DB 4QTFA 4R0LA 2NLJA 4M48H 5I6NA 1X5FA 5TFSH 3RUGE 1B4JH 2VLKE 3SGKC 1UWGH 2ZP8A 4UT6A 4H1LB 3JTBA 3ZW3A 3HAEH 3KPQB 3WNOA 2G9HA 3LPGA 4JM4H 4LEBA 2VR5A 3NIDB 3E6FA 5B39A 4G8FA 1MFUA 3EGSA 2Z65C 1EGJH 3IJHA 3TIEB 3TH2T 1NEUA 4Z77B 5EF2A 3U82B 4PJXF 3MLVH 5F9JA 2DAVA 3W1ZA 4NQDD 1E8XA 1TZIA 1JI1A 3KDMA 4I8DA 4LCCC 2G3NA 3ALXA 4PLKC 3VTTA 4K5MA 3MHZA 1MCSA 1T6VN 5CD5C 3ARDC 4PJAB 1HESA 3DTUB 4MQSB 2KLRA 1KCSH 4NO3A 2VB5A 3G6JB 1H15A 1SJEB 4LSUH 4O51A 2HH0L 1J1PL 2BNUA 2WUBH 4H0GA 1CE6A 5D96B 5E03A 1P2CB 3RZCA 3MRRB 1E65A 2FNWA 1HHJB 2XA8L 3QXAA 3ZYIA 1KTJA 1PAZA 4DKFH 4F5CE 4L2YA 5C9JB 4HHWA 4LHUB 1YPZA 2R1WB 4M93C 4FA8A 2WCSA 4OI9A 2MOQA 1GH7A 5E2UL 1KB5A 3LQZA 2ZQKA 1A65A 4HFWA 4Z3HA 2EDDA 2TAAA 5HHOB 3VI3B 4F57H 2Y23A 3CJJA 3QJHB 2CH8A 2AJSH 1F11A 1ZGLB 3WELA 1ETJA 1FLTX 4YEFA 1MHCA 3Q0HA 2ATPB 4G1EA 5E1QA 1MIMH 4UV4L 2VUKA 1PZUB 4P2QB 1IQWL 2OMWA 2BSED 2W81C 1QBLH 2X9XA 4Q6KA 3ULAB 4KMLB 4F1ZA 3I3DA 4MBRA 3K0WA 2ATKB 4I3RL 4PSRA 3FS9A 4ZMLA 1YEHL 5JO5A 4L8BB 5GGQH 1QWHA 3NABH 3BPOB 3PWPB 4XWOD 3SE4C 1A02N 1Q72L 6FABH 3H42H 5IOPA 2A83A 1HK6A 4JPQA 2TSBA 3V7MA 3VSTA 1KT2B 5GZNC 4QRSA 1JXDA 5ID0B 1N8OE 4HAFA 2G2RA 2J1XA 2GFBA 4U6TA 5J12C 1FPTH 1G6VK 1QQDA 3NH7H 3IJYA 3BP5B 4QCIB 1ZHBA 3R06B 1EHLH 2CDGB 4L9LC 1A6VL 3QQ9D 5L6YH 5I6XB 1T1YA 3PL6C 4TVUA 3QPXH 4ETQB 5IHUL 1SLVA 2WHVA 3CU1A 4HJTA 4R96A 3RGHA 4FQLL 4G5ZL 3ULSA 4EF3A 1A22B 4PD4J 5GJSH 1H5BA 2JJTC 5CS7A 1F1GA 1G1OA 2XWTB 3BFQG 4XAKD 5JHMA 3BZFA 2L0DA 5KANG 2X5PA 3TJEH 3L5XH 4YBHA 4YPGB 4BGLA 1FQ9C 1UA6H 3AFLA 3IJSA 1NIBA 2UXGA 3C60D 1U93B 5TQ2L 3UBXB 1T03L 5TF1L 3KL0A 1NGWB 1FBIH 3FQRB 1F3JA 1RIHH 4AMXA 1IQWH 4KJWC 3BVTA 2B5IC 2EE9A 4B27A 2OR9H 3TV3H 4Y9GA 2BHZA 1DLFH 4F7TB 3MLZH 1OK0A 3WN5B 4YHZL 2R0KH 3HRZB 4XVTH 2YGPA 1Q9LB 3RKPA 4F8OA 3QUXC 5LB1A 1DQLH 1BFVH 1T22B 3DLQR 5DZOA 4Q4IA 1YPZE 1G7MA 1P6WA 3BEVA 3DROA 5FWRA 1JD7A 4BFIA 1E30A 2E3VA 1EZVX 2YKKA 4NQQA 3K6DA 3QT2A 3FUIA 4MJ4A 2J8OA 3LQAC 4MVBD 1YMHA 3N5AA 3PJLA 3M17B 1EEYA 4AM0Q 3BWAA 1FWXA 2VN6A 1YY9D 5EBLB 5GHWL 3TESA 4Y4FB 4DO4A 4R7NA 3R0MA 4X4ME 3RUGF 1JGIA 1J1XH 1JCKA 5CHNB 2P26A 5IROD 4HWBA 2GJRA 3KPMB 1QVOB 3AM8A 3QUYB 3OPUA 1NAML 4UU9A 2OV0A 4YHOH 1C12A 5J5EA 3V5DB 4PJ9A 3RGBA 4X99B 4JS7A 4LRIC 1A14H 3F7VB 4KGLA 4PVMA 1LQSR 2AQ3A 1NDGB 4FABL 4JANB 4YDJB 2IV8A 2LU4A 1A66A 2Y7QB 4B9YA 3RIKA 5B7FA 5TE7L 1LO2L 3N85H 2VKWA 5T5FL 4KTYA 1QP1A 2VGLM 2XG4A 4V2CB 3I6KA 3UBGA 1F97A 4GG6A 3E8VA 4PG9B 1TYRA 4HC1H 4RZCB 1DVFD 1S78C 2W91A 3RI5K 4DGWC 4IBUA 3MNWA 4U7SA 2XKUA 5IB5B 5FR3A 4PRDA 2XBTA 3S3SA 3P77A 4JFSA 1H6EA 1XGTA 4HLEA 3F64A 3IFLH 5F44A 2AKRB 4HDIB 4JFQA 2JJUA 4PLJC 5MEQB 4YGAB 1R47A 1E5UI 5F1OB 2XLLA 3QXDA 4PJCA 4QO1A 4KY2A 3CUPB 2JCCB 3AAZB 2JI2A 2V5YA 3U30C 5JHLH 3GXFA 4JDEB 3V4UH 1MJ7L 4BK5C 1SEBA 1NL0L 4N5ED 5D7SH 5HHNB 5C2UB 1AGEA 4A6YH 4TLKA 1MPAH 1KBBA 4HKBB 2K70A 2Q86A 1DBKH 4OGAC 3TBBA 5D1XC 5EO1A 2IWEA 2A6JA 4QHPA 4FERA 2VJXA 3HMWL 3JWNG 1F56A 5E7BA 3EUDA 4QWWC 4XP5L 4U1GB 2Y2TA 3P3SA 2EYTB 2HTKC 5FB8B 3GLEA 4HA1A 2AXGA 4LSQH 1S3RA 4QEGA 1JHLL 4BQCA 2EXWC 5FGRA 1F4YH 1HE7A 1HDMA 3WTSA 2CO3A 3MRMA 3ZO0A 1CE1H 1Z7JA 3S2AA 4R6UA 5T1KD 3V8CA 4E42A 5DLLA 1FL3A 1M9SA 1UKQA 1S9XB 4FXKB 1XF4A 1E9PB 3KPOB 4ZMNA 4WQOA 4POZC 3O6MH 5EBGA 4FQ1L 4XN9A 4AYGA 4ZUUB 1GGIH 2EIDA 3ALPA 2X4UB 1YNLL 2R0LL 2COQA 3GPEA 4XMKH 3DGDA 5M7QA 3DRQA 2YMXL 4H2CA 1F02I 4LCIL 5CSGA 1C9SA 4IMLB 1CDIA 1YY8B 4MYPA 2N3JA 3LEYH 3QFJD 3B9KD 2QQLL 3LHAA 3NJGA 2JH2A 2BHFA 1BVZA 4MD4B 3CX5K 3NEEA 4YL4A 1CLZH 3MCKA 3WEXB 4RMWA 1YEWA 5DGRA 3RBSA 1MJ7H 4MA3B 3ECBA 1U30A 1ZIBA 1AQDB 3GJFB 4E5XA 5LAXB 1MLCB 1MH5B 4JM2D 1X9UA 4KY1H 1LO0L 3Q6FA 1FNEB 3WNKA 1AACA 4WCYL 2C3HA 4LPUA 3MI6A 5HVFB 4ONHA 5I8OL 1UZ8B 2ADGA 3T2NH 5IWLA 4GG6E 4FEMA 3DDFA 4MRBA 4AEFA 2OKMA 4QYAA 3HR5A 1NMBL 4YHNB 3CN0A 1MQ8A 4KKCC 3FTZA 2OP4H 4X9FA 4WEMB 3LVTA 4XMLL 4OD1L 1E50A 3B3BA 2GC4C 4GXUM 4MAYA 1A7BA 1KC5H 3B43A 5EC2A 3EO1A 1Z3GH 1AQKH 5LQBL 5HI4C 2QZ5A 3O2DL 5D1ZI 2NY6D 3PHOB 4B96A 4PJCE 1QHOA 1U8CA 1TOXA 1YPZF 3MLPA 4N2KA 1CBVH 2C9SA 2ZSWB 4ODWA 5FECB 5CKAA 4P4KC 1G84A 2Y6TE 4HCGA 3SKMB 4R26L 4QGYA 3BFWA 3VXRE 3GGWA 4OZIA 5DQ9B 4ZMPA 2HT2C 5CJQL 1N5AA 1FE8L 4KZEL 1QRKA 1U9KA 4PV1C 4QY8B 4GIPD 4NQUA 2Q7NA 1EQWA 1QFPA 3X3FL 4JQXA 3CXHK 5I66B 1Q9OA 3QFGA 1TCRA 1F00I 1BZDA 1UTDA 1NEZG 4FF9A 4E41A 4UUJA 4LCUB 4QF1A 1CFMA 2VLJA 3CVHL 1KJ3H 1LO5B 4XI5C 4N0FB 4MMYB 4LSVL 2BIPA 5FUOH 4BZ2H 1GOHA 3S35X 4FI7A 1SUHA 1LK3H 5AW9B 1BAFH 1JYVA 1OGTB 5C0GB 2PYFB 1JNHA 3AZUA 2YXVA 1V7NL 2GUOA 4FOMA 2IGLA 3FJTA 1RZPA 1E8WA 2PCFB 2NXYC 1YEDA 3HE7D 3UO1L 5B38B 3QORC 4NQSA 3IFNL 1LK2B 2Z3FA 3S35H 5L2JA 2OMZA 2P5EE 3NJFA 4M3HA 3UJIH 4NQVA 2BP0A 2VT0A 1QKZH 2BOLA 5FHBL 4H88L 4OZGE 2GAZB 4Y2DB 4IKLA 3U1SL 5EOQL 3I6LD 4CGTA 1IM9A 2AF2A 1K6QH 2Z93A 1BOYA 2UWEB 3BMWA 3D08A 2YA2A 4ONGL 4TUOA 5DRXB 5EO0A 4N90D 5FA4A 4OLVH 2FSEB 3K6FA 4R90L 2F68X 2YA0A 4NWTL 1I1YA 3EFDH 1IGJA 3P02A 4U0QB 3AVEA 3LNDA 1KGXA 2P43B 5K9OB 2RFXB 1DE4A 5LJYH 1H9VA 1KCUL 2ZJSL 3WUWG 3SDXA 2XFGB 3LKOB 1IC7H 4HSQA 3FFOA 2L3BA 1A25A 5EIIA 2BY2A 1LEKB 3VXPB 4WNJA 1JPGA 2QT6A 5LNEA 2D03H 1KJ2B 2A74A 4J23A 4P9HH 1NGPH 5DJDB 4J3UA 1U3HD 4PFEA 1E3FA 2X6BA 3PABB 1UGNA 4YGVA 4GEJA 4X5WA 4V33A 3KVDD 2V17H 2RD0A 3F2LA 4NKMA 4LBEA 3SGKA 4GUPB 4FI6A 3O3AA 4G82A 3LRGA 5JZ7D 1W6WA 1OWWA 5DS8B 1UKSA 4JW3A 4OGXL 2FLBT 4PBXA 3UPAA 5IR1B 4W93A 1J11A 4WHYG 4FKKA 4AGPA 3ZMEA 4JKPL 4DQOL 1CG9A 5EZIH 1K4CA 2VABB 1D5XB 2APXA 2JV6A 3AABA 1XH3A 2GTWB 4KKAC 4XMVA 3ZRFC 4OZIE 4PUBL 4IKIA 1KCVL 3S36L 1K5NA 3BP6B 4LCCA 5AOIA 5H94B 3N42F 3NP4A 3FSZA 5SWZD 2DLEA 2E6QA 4U6HA 3RGVC 2HMID 3ARDA 4I77H 4R8WH 2H2PD 1QACA 4HJUA 2YOAA 1KFGA 2HZHA 4NIYE 4PG2C 3DO7B 5IVZA 1KF9B 4E41E 2DYPD 1T6BX 2D7MA 4FNQA 4MDIA 5AZEH 2VLJE 3KR3L 5F88B 2HRHA 1I8IB 3FOLB 5I17B 2ZG2A 4CU7A 5E95B 4NUGH 4PVNA 2NSMA 3EYOA 3IVKB 2OR8A 3HZKB 2BY1A 1AXIB 1MREL 4HIJA 4JZOA 3V4PA 3ZYZA 2VL4A 3DUHA 1QR4A 4LARH 1CI3M 2AP2A 2CLRA 1YNTA 3R7QA 1P5VA 2X40A 4GYBA 5C0BB 1N6QL 5IG7A 3LH2H 2EO1A 4GG6F 3D39A 1I1FB 2X3CA 2XN9A 4ZOEA 4WU7A 4Z7QB 3EJQA 1C16A 1MAML 4NKOA 3DXAD 5DJ6B 1L0PA 2H5UA 3W9EA 2VRQA 4IOIB 1W0WB 4GW5A 3ZDZE 4CILA 2VERA 2Z8RA 2J25A 2NTFA 2I5YH 3HC4L 4V2BA 1UVQB 3MBEC 3BPLB 1S7SB 1S4IA 3QCVL 4W1TA 3OHXB 4EI5B 2OZNA 5ID1A 2VITB 5HJ3A 3GSQB 4PJCF 1SXZA 4NZUL 4DSYA 2KPWA 2P42B 2X4QB 3BH8B 4JQIH 3FO1B 4P46C 3INUL 3HC0A 3RWCA 3G5YB 2QV2A 5FYKE 3MNZB 5JIMA 2BSCA 2FX8H 4NP4L 1X7SA 2X0WA 1KPVB 2I07A 1WAAF 5LGKA 4JRXA 4XVOA 5L9DL 1LNUB 4ABVA 1IGYB 2VRAA 1OPGL 1V55B 2NYKA 4KK9D 5GZND 5C0CB 4OJAA 1BQ5A 2XQ0A 3BKMH 2X6MA 1CD0A 2QQNH 2D0FA 3PV7A 4ODVL 4PW9A 1HJCA 5IGXH 2Z9TA 4M7LL 3S88L 4OCSL 5HP5A 1BCIA 1KBGL 2EQDA 2J8HA 3BUYB 5EHFA 2VLLA 4OI7A 4L9LA 2AXJA 4YE4L 1BVNT 4BH8A 1MZZA 4NM8H 2LVEA 4AC4A 2JELH 3ZHKA 2ZKWA 2NY4C 3PL6A 4JO1H 5AVTB 2CJSA 4RX4A 3SPVB 5B8CC 2VR3A 3VH8B 5BRZB 5ESVA 4DP2X 4OW6A 2JJTA 2N59A 4YR6A 3WD5L 1DZ0A 2ERJB 5DDHA 3L3IB 3E6HB 2I32A 3PWLB 1XTLA 1C5CH 1CFTA 3GDBA 3QNFA 3W5NA 1YAIA 4LLDB 2WINB 2VDMH 1BYPA 4U3CA 4EO5A 4OZGF 2HLAA 2Z91B 3KG5A 4F8NA 4KK6D 2BVTA 4RLDA 3VG9B 1ZV5A 4F8TA 1RVFL 2VO8A 1RZ8A 2VQ4A 3NRFA 3EYFA 4HXAL 5EU3B 1ZA3A 2AJVH 2R23B 4ZUVB 4LSPH 5J11B 3BRGC 4QOKB 2EO7A 2ZCKH 3CDCA 5E7FA 4P5TB 3TC9A 4YBQD 3QG6A 3QWNA 4LEOA 4Y4KD 1LEIA 1TLMA 5DJYA 1NKOA 2XOTA 2VC2B 3BKYL 4RAVA 4FG2A 4G70B 5HHXH 1SXCA 3DURA 4ONFL 3IJEB 3QUXA 2QSVA 5AD0A 1YMMA 2ICWJ 5J06A 1BF5A 2EC8A 4N0UB 1H3VA 4J5VA 5HDBB 5T3ZH 4ANUA 1AS8A 1AY1H 5FF6B 3S3BB 4FHJA 3D39E 2IPTL 2XN9E 4OCSH 3MRJA 2KLTA 4CN4A 3NCJL 3JV5A 2FX9H 4N8CH 3BD4A 3DX0A 4JFFB 4Y7OC 1A4CA 1KIRA 3S34L 1CZ8L 2XKNB 2DBJA 1CI5A 4MA1B 4CMMB 1L9OA 1OTTC 3BIBX 4DQAA 2VXTH 1J8SA 4OCMC 3T65B 2VW7A 1LWRA 1BFOB 3HG1B 3FTWA 2H1PH 4JGNA 1P7QA 1RHFA 2FHFA 4FTVA 1Y6KR 2NY5H 3U2SB 1YQ2A 2HAZA 5LCVH 3K6SA 4LRIA 4JFTA 3FZUC 1KYAA 2PO6D 4TOYH 4FQXB 4KKQA 2ENQA 3C8DA 4OZFA 4OZIF 1IBFA 1WQVT 3LZRA 5C8JB 3QYNA 2TSAA 5I5RA 3EYUL 4JRXE 5IEHB 3CN4A 3NVQA 4N9OB 4LPTA 4ORGA 4PJ7A 5AYTA 1RVFH 4WWKC 1S9WB 1B0WA 1XH2A 4YDIH 2CJ3A 4Z7UB 4R4FH 1KYFA 2ZCLL 1FFNB 1HU8A 1U21A 4JNXA 4ZODA 4PGBB 4XBEL 5ENWB 4K8RL 4RVBA 2MCMA 4JEGB 4K2UH 3CPLA 4NENA 1RURL 4MXWH 1SJXA 5D4JA 4B5ZA 4DP8X 3W9DA 1XF1A 3V9FA 3BUPA 4GPVA 3RL2B 4GLRH 4KMTL 3HB3D 3C6SA 5IBUB 3S34H 5BZDB 4OGAD 1AR2A 5D1XA 2N1KA 4HGKC 4OH2A 5J8OA 3N44B 3ZDZF 1T1ZA 6PCYA 3VW3H 4IBVA 4HF5L 4K5OA 4G43B 2YAOA 1AHMA 1OKEA 2R4SH 4CNIB 1SOQA 1UT9A 2F08A 1NC4B 4EZLA 3BOVA 5D1QB 3D30A 1XGUB 2VUOA 3G9AB 4FS0A 1MVFA 3DMMD 4HS6B 1H0DA 4RBPH 2GIYA 3CWGA 5F96L 3PWUB 2DQEH 5IFHL 1A6TA 3ARED 3KXFD 1YMME 3L3KB 3QZMA 4MDJA 4PTTB 3UTZB 4WTQA 2MHAB 1WBYB 3AY4C 5EBMA 5C08D 1FJ1B 2N7AA 5ADOH 2V7NB 4Q9QH 3O11A 3WLBA 3SBPA 3MLXH 2EH8L 1B2YA 2EDJA 1UYWL 3GHBH 2EKSB 2WTRB 1MFBH 1GJIA 4PRBA 5C0FA 3DX1A 3ZDWA 3KPLA 5E08H 4GSDH 4PRPD 1RK1B 1WGOA 4ZPVA 4U1MA 1JIBA 3AWEA 3NTCH 4FNLH 2CMRL 4P2RA 1K72A 2FQGA 4AIXA 2YK1H 1U8QB 3CFCL 5CILH 1X5IA 1UD8A 4R4NC 2YD9A 4ZT1A 4DP0X 5F9WC 2CUIA 2CXGA 2VMEA 5ESAA 1FV1B 1UD5A 3QJZA 3G04A 3II1A 3NCFB 2BCKB 1OAQL 5BZWA 1HCFX 2Y7OA 1ADQL 2BZ7A 3OKLB 4S10A 2DKMA 2DIJA 3EYQD 3MLTA 1WSST 2MJWA 1WZKA 3X2QB 4X8JA 4PJ7E 5GS3A 2B2XH 2E7BA 1G7QB 1Q8MA 2ZOUA 3O41A 1FGVH 5DFVC 4FD0A 4PJEA 4G6MH 3K71B 1SHXA 2VQ1A 1K8IB 4FQHA 2C7FA 2CO6A 1GZQA 1G1KA 1T7ZA 4FFWC 4U3HA 4KOBA 1CICC 5J12B 1I1RA 1Q38A 1AGFA 2OJZL 3ATDA 3KYMA 1G9MC 3BYYA 3U6RA 4KVNL 5FS5A 4RETB 3GNMH 2R8SL 5L8KB 4GY4A 1MCJA 4NX0A 1YNTF 2CRMA 3L45A 4XHJD 4P4KA 2NY2B 3BH9B 3PQYD 5CZRA 4DEPB 3DA0A 3VFVA 2VXVH 1TJGH 4GRWH 4BUHA 3MLRH 1Q0YH 5D1XE 5GJTH 2G2PA 4S0HA 3UJTL 5JPMB 3PDDA 2DI7A 1PX3A 4LZKA 1NPUA 3C6LD 3APCA 2SODB 1BLNB 3RWEA 4BFEA 4KTEH 4YSSA 4QRPD 1QSEA 2OX5B 4X9IA 5B22A 1KEGH 1PKQB 3NRPA 5FAAA 2FIRT 5BV7L 3S5ZA 4EQ2A 3AG4B 1G0XA 2NY3D 4YQXH 1KIUA 4L23A 1E67A 4IOSD 3EOYG 4NN6C 2RTTA 2X88A 1RUPH 3CN1A 3LDBC 3D4ZA 2DM7A 4NDMA 4UYPA 1INDH 1MVUA 5J56B 2G60L 5IK3A 1CC3A 3QORA 1BQHG 3K4AA 3DVNB 1GYAA 2J4WH 4M1GL 5GRZA 3L1EA 4Z95H 4LSDA 3GSNL 3FTVA 3VSUA 4P2RE 3MA9H 4JZJC 1JYXA 3S8FB 2OL3H 1ZV2A 1UACH 2WVVB 4BCYA 1RD6A 15C8L 4JDVB 1XZ0B 4L4VD 1AD9B 1NMAL 5GRXG 4X7DC 5I76B 3B7UX 1TETH 2D7OA 2APVA 2BRQA 2WCPA 1SVZA 4HUUB 3ZTEA 3H0TA 3QR2A 4WTZG 4PJ6A 1WIOA 1ZS8B 2WSPA 4UDUB 5LAPA 2QEJA 2VZTA 5GS2H 1IARB 3V5HA 3QJSB 1NUGA 2DQDL 1UH4A 1L9NA 2XZQH 4Z7NB 3V0HA 5IF0A 3CV5A 2Y36H 5IJKC 1OCWH 4PJEE 4MCZA 1A1OB 4BDVB 1IGFH 1UCTA 3POHA 2HCZX 4ODTL 4XOCA 1SOKA 3GWJA 1IX2A 2O6DA 1MRFH 4IU2A 4MZ2A 5DVKA 2P5WB 3ABMB 3MTXA 4AT6A 1T66C 3ULVD 1ZT7A 3JUYA 5JPNC 4RNRB 3GBMH 3GM8A 2IBGA 3EO0B 5ICZA 1I9EA 3BQUD 1KLFA 4GP4B 3GI8L 4IQHA 3EGXB 3FMGL 4JKKA 4X4KA 3T0AA 1W16A 2X28A 3MXWH 4PJ8C 5CBAB 3RX5A 5KYXA 1RZFL 3QR1A 3FQ1A 2EDNA 4AM0B 2B8OT 4YHPA 5HHVL 2AXFA 4KKAD 5GIRB 5HGBA 2XWBB 3UBHA 2EE6A 3KM1A 3EJPA 1OQOA 5D93C 4QRQB 1NAMB 4X9YA 3TA3D 1BSIA 4ZMVA 2A0LC 3RGVA 4QYOB 4AYBA 3BPCA 4PG2A 4QJ3B 1XV8A 4AKOA 3IDJA 4WO0A 5EPMA 2BVPB 3ZVVA 1QSEE 1OCCB 3GRWA 1N0XL 4LMQE 4X5XB 1IT9L 2QADB 3D5OF 3HG4A 4I0PC 5DO2D 5F7DA 5KBDA 3CZEA 2CKBH 5IB1A 2RB8A 1BVKA 1EZVY 1PIFA 2UZIH 3EADA 3LH9A 5TQ0H 5KVEE 3WY4A 2A77L 1LMIA 2YPVA 3VFSB 5A43C 4L29A 3MGOB 4PJ7F 2GHWB 3RB7A 3MV11 4TVPH 4XP4H 3ESUF 3TCTA 2Z92A 1AKJB 1HSAB 4HOMA 3BO8A 1B4RA 2WBJC 4PJBA 1OY3B 5I16B 3RIFK 4F33B 4OV6F 3SDDD 5CIPB 5FFGA 4WDIA 4ABUA 1NAKH 3MBED 3QAQA 5ITBL 3L6FB 4HUXA 4MD0A 4KRNA 4AUJA 3MLUL 4KXBA 2APFA 2EUWA 1B6DA 4APQA 4JDZB 2E7DA 1A4BA 3QG7L 3QP3A 3F5WB 1IJNA 1FNGA 1JK8B 1IKNC 2PR4H 1D6VH 3ILPA 4FL4C 5ISZB 2CE6A 5D7KE 4JHZA 1SXSA 4Z7VB 3S4SB 3VFMB 5HYIA 1E2VA 1RLBA 1O7DC 1S7TB 2RR3A 4JLRB 5D7LB 2G2NA 2FD6H 4KDTC 1K2DA 2WGNB 4H8PA 3K2KA 1DVYA 2JCWA 4DPAX 3VWJB 4XH2A 2Z4QB 4S2SA 1KB5L 1NPJA 5B1KA 3T3ME 3DBXB 4MS6A 5H4YA 4Y4HC 1QFWH 4BWUA 3D2UB 5T1LB 3TWCH 4YSQA 2IIJA 2X38A 5CD3B 1MFDH 3IFPB 3MSPA 4W9LC 3F8UB 1XEDA 3OKDA 1FO0H 2B59B 2CWRA 3P9WB 4HBCL 1S7RA 4YXHL 3SJVB 5JOPD 3SO5A 5IREA 2IDCA 2EEXA 3VXNB 1OSYA 5B8CA 3ERXA 4H0HB 1WV7T 4YNYB 3OPZH 3C5ZC 4L05A 1T04B 5I1CH 1QRNB 3JWNH 5DRWB 4B6ZA 1K5WA 4WI4A 1HT6A 4OFPA 5DGQA 4JZNB 5KVGE 3RFRA 3UX9B 1JGVH 2P8MB 3DTXA 3H4HA 3LRSB 3VA2C 3WFDL 2ICWB 3P3TA 2OYPA 3QEHB 4LSRL 2BVOB 1R17A 1I8MA 3R8QA 5KSAD 4DESA 4QD2E 4TUUA 4XWGH 3DJTA 3O2WH 5JW5B 2V5MA 2ZCHL 1RJZB 4GIOA 1SXNA 1XZWA 4ZAKD 3RWIB 4KQ4L 3GLZA 5D9SB 3GLAA 1IM3A 2VJ8A 4QLWA 1CYWA 2R0ZL 4QMEA 5C7XL 5I6KA 4U7KA 2BNRB 3IEAA 1PGRB 1PZCA 1LWHA 1KENL 5GS1C 5I1LA 3SE9H 1T2QH 3Q3GB 5E8PA 3VI4A 3BW9B 3QNYB 4WI0B 5F3HA 2IPKB 1P84K 2YEQA 3AMLA 2A6DB 2FATH 3L2NA 3QJUB 4WFFE 1ONQB 4PJBE 4PJEF 2WCGA 3C9NB 1HZHL 1P4BH 3ESOA 4PS8A 4XN5A 2VLRD 3VFUB 2PCPA 2XPGB 4PJHA 2ED6A 4M8QB 1CQYA 2AEPH 4ANKA 1E4XH 2MNJB 1KXQA 5ECGA 4OF8A 3WL9B 5J6HA 2F8XC 1A5FL 5E9NA 4S0SD 2ENJA 5CWSA 4M8VA 3APNA 5AW5B 2V3EA 4LKXA 4XNQB 4QT5B 2MQ0A 1RZIB 1L9RA 2YXFA 3ZIYA 5K33A 1OIOA 2DJUA 2B0SL 4GXFA 1BF2A 3V6OC 3T04D 1IVTA 3VCLA 4OUUA 5D96C 5FPIA 3UTSB 1FNHA 5AWNL 1Q4NX 4JMNA 4OT1H 2XN2A 2XPYA 3GTTA 2Z31A 1QFWM 3QJQB 5D6CB 4UDTA 4WWKA 3C8KB 4LBAA 1IVLA 5C09D 3MRHB 3IAPA 1BOGA 1ZOXA 3L3HA 3F62A 4GB9A 5E2WH 4NWUL 3CVHB 3AB0B 4DTGL 4TSBL 4PWKA 2RJMA 1RULH 4MHHG 5CKGA 3UZVB 5JMRA 1U3ZA 1YZZA 1HNFA 1D7BA 2QZQA 3WO4B 1Z3RA 3U9WA 3B5HA 4Y5XB 4FQIL 4JFZH 2YKLH 1SJHA 1URLA 3MUY1 4HD5A 4WV1C 4WEEA 1TTGA 5D2NC 2VH5L 2Z34A 1AOHA 5KEZA 4OV5A 4ZXBA 1JWSA 2A6KA 3NZHL 1UJTA 3ZN6A 1KXTA 3MLYH 4O02L 4LLUA 3OF6A 5AYQA 1NGXA 4O9HL 1FHGA 3N1FC 3VDAA 2VSDA 1P0SE 3VFTA 3VFNB 3ABLB 4X5QA 2QGDA 1SDDB 5JDJA 2JTYA 2DIBA 3RWDA 1KTCA 3E3QE 4GSRA 3JWOC 4OCRL 4R83A 1RUAH 1FH5H 1M56B 4IU3B 3EJTA 1JRHI 5F93C 3HUJE 2VLMD 4UINH 3VYOA 2ARJA 3PDOA 3K80A 5DF0A 3C08H 4PGCB 4GBXC 1T0MA 3CLFH 3TONA 4H13C 4APXA 2QPSA 3AY4A 2XTJD 5SX5K 5GRVK 3UL4A 1Q9WB 2Q3AA 4RFEA 1DL7L 1J9TA 1E6OL 1TJMA 1YEEL 43CAB 2B4CL 3L4CA 1F18A 3QJTB 2CIIB 3T3MF 1OALA 5IM7B 1DEEB 2BW4A 2HJKB 1F3DH 3BT0A 4YFLF 5ETUB 1D9KD 2IOMA 1U91A 4PJHE 5KSBA 4GQZA 3WS3B 3WIIH 3KAAA 2WQWA 1KXQE 2CGRH 3D8MA 3T4AC 2AZAA 3QZWB 2CAKA 4AQ1B 2VXSL 2WKLA 1A7PL 5KVFH 5DR5L 5E1GA 3DSNB 4HX1A 2Q10A 3LSOA 3D1MC 3SCMB 3L1GA 4N6RB 3PWJA 4MNHB 1CXKA 3HC2A 4UQEA 4L3EA 1HZKA 3HTLX 2PP9A 1YEJL 4MQXD 1F42A 4L1DA 4ZFZA 5I8EA 4OZHB 4X8CA 4JFDA 3F7KA 4ZOBA 8FABA 4DPBX 1JV5A 1T5WB 2H41A 3OZLA 4MZRA 1W0VA 1XGZA 4MNQD 2CGZA 2O5ZH 4FC3E 2NQ3A 4OCRH 2DQTL 1IIIA 3NACH 2DWSA 4KUCF 4WHYH 5TE4L 1XGQB 1OEZW 1UM5H 1VEMA 3HI6H 4D3CL 1DFBL 1D5BA 1CICA 3FQTA 4N2GA 4NNYA 4UTAA 3ZUNC 3CZLA 2VQUA 3ARXA 3RILA 2W0KA 1PEWA 1DBMH 2FECI 4HJIA 4AEEA 3V0IA 1JUFB 4AE0A 1OLZA 3QUYC 1TUPA 3N40F 5A40E 2DEXX 4HS8H 3LS5H 4M5ZH 3RTQC 2F53A 2K0RA 4HK0A 1R3LB 3ARFB 4B3EA 1CGXA 2M8XA 3FONB 4PJBF 2N56A 3RLSA 4N28A 4DETA 3L3JB 5HD8D 1TVBB 2AABH 4ENZA 4JY4A 4ADJA 1DJWA 2FJGB 1AJ7L 1AO7A 2ZOTA 3BEWB 2APWA 4O2EA 4ODXA 4NRYB 3ARYA 5DJCB 2HRLA 5I74B 2NQDA 4AQ8C 1NIEA 2ARWA 3KPPA 3ES6A 1M7IA 3HG5A 4XXDB 1U95A 5SX4I 4X0KB 2ZYHA 5KOVC 3MNVA 3QZPA 4BFGA 4XCCH 1JPTH 4GAYB 1T5XA 1X5YA 2EUZA 2B9AA 2ZXBA 3BGFB 12E8H 3D07A 2YC1A 4G3YL 1JF1B 5T3XE 2DM3A 2X1QA 1VACB 4XN2A 4EDXB 5L88H 4UTBA 5HHQB 3FCTA 3CMGA 1AGDA 1MFCL 1EH9A 5E4OA 2DL2A 3QZOA 4XMUA 1JPSL 1ZAGA 1B2WL 2LLGA 3PAUA 1QSFA 4KRPD 2FEJA 3VD4A 4K7PL 3RZCD 4QRRD 5DK0A 3U7WL 4U1LA 3GUTB 4JZJA 3HNTL 3IMBA 4PCYA 5E51A 4NKIH 4AEIL 3VWKD 1A0QL 2VO5A 4LMQI 5L2KA 3KDPB 1XB6A 4U1GC 3CH8A 2IH1A 2XVKA 3KW7A 3FU9A 1QUPA 3O9WC 4L3EE 5C0AD 1A4JA 1T0NA 1MF2L 1GC1C 3L4YA 3QQ3B 4RFNC 4U1NB 5I8KL 4AWJC 4D9LL 1I7UA 2EE3A 5C1MB 4BK4A 1D6EB 1QFOA 4JFDE 4CSZA 2D7QA 2ORBH 3APFA 3U4BH 5E9DA 4TPRH 5HDOA 5HYJA 2JNZA 1INEL 2Q8BH 2DWDB 3GINA 3LRLA 4AZUA 5IJKA 4U49A 3L95B 4ZUSA 3HNSH 4IEFA 3L9RA 4FNTA 5AFAA 3STLB 1EBPA 1RSYA 1CXHA 1DJSA 1UB5B 5E00A 2CA4A 1LQBC 4RAUB 3LN9A 3LEXB 1FVCB 3E2HB 3UPRA 2ITCA 4FFVC 1KTKE 3NN8A 5F7WC 4X6FB 3HUJF 5DJZA 3SEPA 4AXWA 1X5KA 4DP5X 2BWIA 4WO4D 3T9WA 1NCOA 3F7PC 4AQAB 1A21A 5JPNA 2OCJA 3S7GA 5ADPL 1MJJB 3CQPA 3RVTC 3TEWA 3KS0H 4KJQD 4M56A 4PJ8A 5EOCL 4P5KA 3QXUA 5J7CC 2F53E 4YWGH 5INCA 4D8OA 5I1JL 3HBZA 1A3QA 2CA3A 4UT9H 1NGQH 5FYKL 3CAFA 3WAJA 1EZSA 1BP3B 4JPIA 3CK0L 2A9ML 3E9TA 3NMEA 4LVHB 3M1OA 2Z7YA 4M29A 3DX8B 1AO7E 1I75A 5GGSB 4A7VA 3MV01 1RZKL 4H8WC 4R2GB 2G75A 3FTSA 3VJ6A 3UJJH 3CIQA 3F83A 4GXVH 1EWHA 4O2FB 1E4HA 4X7EC 3CDFA 3KPRB 3CZKA 4I0PA 3L17A 3RA7L 4MJ6B 4NCDA 2QHRL 3MACH 3RVWD 3TVMB 1PIGA 3O2VL 1H6UA 2NT1A 4PJIF 5GGUB 5H2BA 3KPNA 4F3FB 3ZYJA 4ABWA 1R3JB 3D69B 3HZVA 4MDRA 3US0A 1JL8A 4F9PC 3EFOA 4ATTA 3COOA 2NW2B 3MRQB 4L0YA 3FUEA 1QSFE 4EDWH 4FG0A 3OL2A 3OR7B 4FN0A 1MCHA 4PCTA 2R69H 2GYSA 4P49A 1MDAA 4OB5H 4UT7L 5FYJE 2WLLB 3VXTA 5L2KE 2FH8A 3CVIH 5TDPA 4KROD 5H35B 2ZONA 2CDFB 3TBWA 1W0YT 3WGVB 1IKNA 1J9SA 3IFOA 1AHWC 3JSSA 4P23C 4PR5A 3K8LA 5FO7A 3WJLC 1XF2B 4ZTPL 3ZLQC 2W94A 1HXYA 1F3DJ 1I3RA 1RL1A 3CFTA 3ULUC 2G5UA 1S5IH 1G7JA 1KXVA 5E9DE 1ZV9A 3Q9PA 4MJ5B 4UNIA 4PLOB 4J8RA 4KDTA 5HYJE 4JFPA 3MODH 4G9DA 2XN0A 3U4BL 2MPVA 1NLBL 3LIZA 4GQ9L 3W0WB 3D0LA 3N3EA 3UGXA 2VR6A 4XMZA 3WIFA 3H54A 4KAQL 3U4EA 3N55A 4Y4HA 3QHFL 1RP9A 2BM3A 5AB9A 2N1TE 2CRZA 3RAJH 3SPJA 3AG3B 3I9GH 3AU1B 1HCVA 3T0EB 1N6VA 3A67H 4J3OC 4N2EA 5F89A 4M9OA 3BSZH 3A21A 3PHAA 1AP2B 2GSIA 4BSVA 1TEGA 1DQTA 3WXWL 3BP7A 3B7YA 1EAPA 2PR9A 2Z8WC 3C5ZA 2V2WA 3FSWA 4XPHL 1WIPA 2A38A 1NFDA 1MG3C 2IQAB 4ZPTA 4IRSA 1ZANL 2OMVA 2F18A 3WDHA 1VKXA 1V3KA 3DJZA 3QIUD 4HT1L 3TN0B 35C8H 4GKZA 5IVNA 2BH0A 3UG3A 4Y19B 4WUUA 5LWYL 2O6EA 1DSFH 4PU2A 3EYSH 1F4XH 2ADJB 2PTTB 1WIUA 4QDGA 5ANMA 3OJDA 3H7BA 3QUMH 3ZTCC 1RZ7L 3STZB 1KB9J 1DO6A 1O6SA 2VERN 3ARQA 1ZPLA 3DUSB 3VXRD 4GRLC 1A6ZA 4IBYA 4QUOA 5E6ZA 5FV1L 1JZ2A 1K4DA 1NOAA 5B4MD 2OTUA 1JGLH 2NY0D 5FIEA 3AJ7A 4HU2A 4X9BA 4ZFGL 5EUOF 3TCLB 3U6XA 3ARSA 3MCG1 4HUMB 4DW2H 1GGCL 1PFOA 2Y07L 2K6ZA 5EORL 3N41B 3KPQA 5AZUA 1NBCA 3Q2NA 4WW2B 1BM3H 4LEEA 1KYOK 2D4FA 5AEAA 4AIZB 5DVNA 3TIEA 4L1LA 2FEDC 1PD0A 2AERT 1TQCC 1U8IA 4LSSH 3OAUL 1JTPA 4OFIA 2ZSVB 4BUGA 5DSCA 2BJMH 4X6BB 1RAMA 1K3IA 3SYPA 1NFKA 2ESVA 3LN4A 1WZLA 1P4LA 4I18B 3MJ6A 1IEHA 4HIIB 1USZA 2H6UA 2HT3D 3D0VB 2YOCA 2P5ED 1NGYB 3VFPB 1HTYA 2PCYA 2XT1B 5EU5B 3QH3B 4B5EA 4CVXB 1FAIH 3G6JA 1SJEA 2PPEA 5AZ2L 5B1AB 9CGTA 1IGCL 3V6OA 1AZRA 3ZO9A 1EDHA 2XCMC 3FB6B 1O7DE 4K9EC 5EZJB 1P2CA 1KACB 2ZUQB 4GW1B 3MRRA 1IZJA 3GHEH 4NQCD 3VVWA 4JN2B 1I4FB 4N20A 3IDGB 5C9JA 4P5SA 1LD9A 2R1WA 1N5YH 1WCQA 4J3SA 4KFZC 5MHSD 2DQUH 2XXMB 1NA8A 1WYJA 3LQAL 3VB8A 5BV7B 2FLRT 2OZ4A 2VLKB 3SOBH 5D6DC 2NNFA 4QHNB 1DJGA 2D7TL 4TNVF 1NBYA 1P1VA 2KYIA 4FMKA 3CC5A 4B53A 3QJHA 5ABZA 1GIGH 1R34A 4LNRB 5GGVH 5C3LD 3MPCA 2Q0ZX 3GSXA 3KVQA 1DQVA 3DOSA 2ATPA 1BJ8A 2FDBP 2AV7B 4K5PA 3BPNB 2DMBA 1E2ZA 5CUSL 4B95C 1NFDE 3JUZA 1FC2D 4WV1A 4YDKH 5D2NA 3GSNB 1N64L 2J88L 1R5VB 4PRNB 3U0PA 1N7ML 4MAYD 2HTLC 1DO5A 3NIGF 3MV9A 5ERWA 4HIXL 5BUPA 4NJ9L 4D9RD 3HJEA 1S3KL 2GY7B 2ROYA 3ILEA 3KYKH 3MFFA 5T1MB 5ESQA 3PWPA 1JHKL 4X7TB 5BO0D 3ZKXB 5ANME 2Y2YA 1HXMA 1NDTA 3VXUD 3IF1B 1QABA 1CYXA 3IKCB 1KT2A 4DOHB 3N06B 2J1YA 3NZ8B 4R7XA 5IMMB 4PJ5D 5HVHC 3RQ3A 1I1AB 3FQXA 3SD5A 4EXPX 4NKQB 5CF3A 3BP5A 2BFVH 2CKBB 1F6AB 4HW6A 3R06A 4QCIA 4N0YL 4TUJB 3QIBD 5E2VH 3GJEA 1MQKL 4EOWL 3AWGA 4DGYH 4DVRH 4NC1C 1JRHL 1KV7A 3QDMD 4PP1D 5DWUL 5E6IB 3V0EA 1U36A 5I5MA 1ZDQA 4O5LH 1OM3H 3O4OC 2Y25A 4MB3A 1MY7A 3MV8A 5FGBC 3ZKMC 4ETQA 1K8DB 3X17A 4JY5L 2HJFA 2R29A 4NN7C 1NCHA 2D8KA 4OD2A 4NJAL 4XPFL 4AMWA 1NCJA 3MRLB 2J5LC 4FQJL 5CXPA 2WQSA 4PIRF 1BJ1H 4ICWA 5KUKA 2YRPA 4YXLH 1BVLB 1QI4A 1VZIA 2EIZA 4H25A 2HFEA 2BZCA 2PXYC 4XOAA 2BC4A 4ZK8A 1A9EA 5FYLE