4P0AA

Crystal structure of hoip pub domain in complex with p97 pim
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
174
structure length
174
Chain Sequence
b'EEEERAFLVAREELASALRRDSGQAFSLEQLRPLLASSLPLAARYLQLDAARLVRCNAHGEPRNYLNTLSTALNILEKYGRNLLSPQRPRYWRGVKFNNPVFRSTVDAVQGGRDVLRLYGYTEEQPDGLSFPEGQEEPDEHQVATVTLEVLLLRTELSLLLQNTHPRQQALEQL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E3 ubiquitin-protein ligase RNF31
molecule tags Ligase
source organism Homo sapiens
publication title Binding of OTULIN to the PUB domain of HOIP controls NF-kappa B signaling.
pubmed doi rcsb
total genus 62
structure length 174
sequence length 174
chains with identical sequence C
ec nomenclature ec 2.3.2.31: RBR-type E3 ubiquitin transferase.
pdb deposition date 2014-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09409 PUB PUB domain
A PF18486 PUB_1 PNGase/UBA- or UBX-containing domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.2190 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4p0aA00
4P09A 5LJNA 4OYJA 2CM0A 4P0BA 4P0AA 5LJMA 2HPLA 4OYKA 2D5UA 4JUYA 2CCQA 2HPJA
chains in the Genus database with same CATH superfamily
2IIUA 3JC6C 4DR5T 1LRZA 2ZM0A 3AE2A 3MKDA 4HKAA 3N9OA 4G63A 3AE3A 4JBWF 3L09A 2X0HA 2XM2A 3PUQA 4QXBB 2I59A 2L3LA 4P0BA 1LVKA 2E5VA 2LSYA 1L0VA 4AKRB 5BR8T 4H9RC 1FMWA 1HF8A 4WYVA 5HEJA 5HXEA 2XM1A 5JRCA 2OA5A 3CQXC 3KV6A 2MOZA 3LFMA 2V6XA 4EEBA 4DV1T 3J9X1 3X1DA 1V9DA 2LRLA 3AECA 4O4LE 4TZ4C 5HWXA 3E08A 3L8RA 4TNVA 2BG9A 3UUBA 5ABFA 1T98A 1VCTA 3IEEA 2E8IA 3Q9DA 4L9IA 5HEGA 3ZYLA 3ZT7A 4IL4A 4L5GA 4YTNA 3D0TA 2EHOD 3AE7A 3RKGA 2QRXA 3Q5XA 4LF4T 3AE4A 2FJEA 3AA6B 4IGUA 1YD8G 1VOMA 2W4XA 4ZZCA 2WB5A 2W66A 3FBLA 2L9QA 2V8SV 3H3AA 3LK42 4P09A 5FXVA 4AIUA 5L47A 4AKIA 3EAMA 1UK5A 1W9RA 4ZI3D 1JNRA 3NVOA 4F8HA 2WMOA 4UV9B 3K3QC 2XUEA 5FVKA 4O4HE 2RPAA 4QH1A 5DQVA 2W62A 2UXNB 3G06A 4HWHA 2VWAA 3TLWA 4QX7B 4ISSA 3CKDA 2ACXA 1SE7A 2IAKA 3ONXA 4YTPA 1O3XA 1MIYA 4O2AE 2UXCT 4TWHA 3OKQA 2LEHA 3RRCA 5LNKA 2I6HA 2E9XB 4IDQA 4DUZT 4DR4T 2UXBT 3R84B 5M4YA 3FZLB 1IAPA 5HXSA 2WAUA 2UXDT 4PNIA 3I9WA 2XY8B 3UUMA 3EHZA 3VKHA 4IE0A 5JR9C 4UVCB 5LG4A 2BS3A 3VKGA 3VRAA 5L3FB 1HCIA 4YJ2E 2LSGA 2HH7A 1XWMA 2WZIA 3ESLA 1OEDA 3JCFA 3KFWX 4K0UA 4K0KT 2Q9QA 1S35A 2X68A 1D0XA 2WU5A 2KWIB 2YU2A 3NZQA 3FB2A 2WDQA 4ILUA 2DCFA 1HX8A 2VQFT 3CQCB 4P0AA 2E9XA 4OHFA 2FJAA 4HTEA 5AQNB 5FKYA 5HEOA 3R6NA 3WI3A 3JAFA 4XZCA 2ODUA 3JADA 5JRCB 4ILCA 1XNQT 2LRKA 5JR9B 2NOXA 2WS3A 3DP7A 4PK6A 2D0TA 4CQIA 2BKNA 4CXXA 2I0MA 3ANWA 2VKDA 1HNXT 2PTFA 2E9XC 1N34T 2XJ7A 5C8YE 1BR2A 5AQRB 2EHOC 4EEDA 5EK2A 3TKLB 3HI2A 2G0UA 3DTOA 2WBLA 3CX6B 3VR8A 2UXXB 3MZKB 1E7PA 4HFCA 5AQMB 4JI8T 4U3CA 1WYBA 5JR9A 1KNRA 3LSVA 3P7IA 3RI5A 3CK6A 1I6ZA 1WYCA 5HXCA 3WAJA 3UULA 3A8YC 4HN9A 3IHRA 4MBQA 4TUYE 5FY1A 4DV5T 1QUUA 2DI4A 3CMLA 2V7KA 2CPTA 3Q5EA 3T8OA 3UU3A 1XMQT 2X9XA 5HCJA 1OXZA 3UUNA 4HFEA 2K3WA 4KX6A 1UX5A 2C5IT 4EAHA 3EABA 4NXNT 4TV8E 4I55E 4KMCA 1W09A 2D2SA 4PJNA 4BAYB 4CI1B 4KHPT 5FY7A 4U74A 2WU2A 3HL6A 3FXEB 2X9YA 3GWHA 4PFPA 2WY2A 5AQTB 2MBGA 1YQ4A 2FBWA 2CXFA 5AQSB 2HN1A 3PUYF 3ZN0B 2UUAT 5JH7E 5ABFB 3PU3A 2VURA 4YXDA 5CGMA 2C5JA 2WWUA 1Z0PA 2C5KT 3FHNA 3UU6A 3ZSTA 1T8BA 3GMIA 4JI3T 5ETWA 3SFDA 2LLYA 2ACZA 5LHHB 5HWYA 1B7TA 4JEHB 5LBMA 4B3MT 3KV9A 5LXTE 4NIQA 1US7B 3EDUA 5LYJE 1HX1B 3I0QA 3O4XE 3ZKRA 4Z91A 3C50A 3ZCIA 5LMUT 1XNRT 5E0OA 3RHWA 3O1IA 3C98B 3PUWF 3KV4A 4Z8XA 3ABVA 3OTOT 2K9AA 2KWHA 4UVAB 3B13A 2XAJB 3KVAA 3AAAB 4DBRA 2LM2A 2N9DA 4AISA 3QB5A 5JQGE 2WCAA 2NR4A 3LG7A 4H63H 5F3JA 2D9DA 1X79A 3PUVF 2J4GA 2VKJA 1MMDA 2WQYA 4HFIA 2WZHA 4X65T 4IT4A 3AE9A 3N9PA 1XDPA 1OEDC 4EZ4A 3ZMUB 1D1CA 4A97A 4OYJA 4ZZBA 4ILAA 3F57A 2XQ7A 4QWNB 4EYYR 4IE7A 3SOLA 2JQ9A 5J2TE 1WFDA 5EZYE 4CZZB 2W00A 3ZN1B 1VRBA 3KBUA 2LOPA 1JNZA 3PE0A 1XZYA 3I1AA 4LFCT 1UCUA 2WDRA 2V7IA 3SWHA 3EVYA 4Z90A 1W0AA 5AFUL 2IC9A 4H9QC 5J2UE 2CM0A 2PJQA 3K8PC 2M67A 2PG8A 1CUNA 2VL0A 3A5XA 3TLTA 3AEDA 1S94A 2BBJA 3RYFE 1M62A 2K5BB 2L8KA 2XAQB 3W15B 3QB5K 2YDRA 3MA9A 2V7MA 2V5CA 4YLHA 3RIFA 4EB6E 5IUXA 2YINA 2YEVC 1NEKA 2CHOA 4NUUA 4YSYA 4ZI7E 5L4HA 3ZMTB 2XAGB 5L3BB 1FIOA 3OYZA 4E7SA 4O2BE 2H88A 3RQUA 2RP4A 3P4SA 3UU8A 5CJ5A 2CE7A 5FXXA 2BS2A 1NENA 3WAKA 2W63A 4AQGA 1J5WA 2B76A 2BG9C 1UGOA 3RX6A 2EHOB 3AEGA 3P4PA 3Q2MA 1IBLT 3KVBA 2X66A 4H9OC 2A2FX 3RRWA 3AXJB 4EYUA 1XDOA 2QA7A 3AA0B 4IE5A 2X9HA 2KNDA 5IHYA 5EK3A 4LMJA 2JJ9A 4DMWA 3AVSA 4LF7T 5LHGB 2KLQA 2VKHA 3P8CD 1Y01A 1KEYA 2P9BA 3H37A 3PURA 1AJ3A 2CBIA 1HR0T 1WCRA 4MALA 3CQGB 2HPJA 2JMHA 2LKHA 4U7IA 1GQEA 3SS1A 3TLVA 4ADZA 4BA9A 3E0ZA 2OV9A 4X1IE 3PJAJ 4X62T 1XMOT 2PBIA 4DIDB 3O9XA 2A72A 4HE8A 1G8XA 3P4RA 3T1YT 2CWYA 1ZHCA 4AI6A 5AQHB 4HWFA 2DNXA 2X67A 2YDQA 4YJ3E 5CA1E 4JI6T 2DWKA 2K24A 1WRDA 3N9QA 4P1NA 2OLTA 3BQIA 5CFBA 4NPPA 4YFSA 2IHR1 4AKHA 5LGNB 2Y6XA 3LJCA 1HG2A 3IF8B 4FJOA 4YSZA 4LMKA 3L39A 5LA6E 2H7VC 2WSSV 3PUAA 4GYRA 1YXRA 4JI5T 4PJLA 3RKOA 4ASKA 5L3CB 1BR4A 3QOFA 2M6BA 2QYWA 4WZXA 4F6RC 2CCQA 4DUYT 4JYAT 3CPZA 2LJLA 4IIJE 2X51A 2NW7A 2XQ4A 1MMNA 2Q9QD 1OEDB 3N2OA 5JDFA 5L3DB 3HKBE 3K3NA 4H9NC 2V26A 2XAFB 3LK2B 4QXCB 4A56A 1UX4A 3ONLC 1H7CA 1MIWA 3FZHB 4GK5E 2DHRA 5JDHA 2LT3A 3K3OA 4YHJA 4YT0A 2LSKA 2V6YB 3C4XA 4GKJT 3RC8A 4C90A 3M65A 4FI5A 2ES0A 3RYIE 3ZEFB 1KNPA 3ZMZB 4EXTA 1ZKEA 4ZI2D 2Z6EA 1R8IA 2CRBA 3MJXA 2DL1A 1BR0A 2CBJA 3HR0A 3KBTA 2XQYA 3AEAA 3N2GE 5L3EB 2VQET 2V7LA 2H7OA 4IDOA 3SRZA 4TX5A 5JDQA 2K48A 5LMNT 3ETVA 3ZMSB 2CHNA 2XQ6A 2Y8DA 3V5UA 4LF6T 4O8SA 4PW8A 3UQ4A 2XHEB 3FZKB 3CX7B 3SFEA 1W0BA 3VHLA 3ZMVB 4AQFC 1HG5A 2IUBA 4LF5T 2F4VT 3I9YA 4CI2B 3K1SA 1SA0E 2BBHA 3BK9A 3JAEA 2UUCT 4NUVA 2C0SA 4UEMA 2HHHT 1ZP0A 2A9UA 2IC6A 2SPCA 4U72A 3P4WA 3PTRB 4HFHA 5IYZE 4EZHA 2N1GA 4NXMT 4HGAA 3UFGA 4ZI2C 3RYHE 2JRKA 2HN2A 4YSXA 5FL0A 3KINB 3N9MA 2BG9E 5AQLB 4UV8B 2BS4A 4MHCA 2BZBA 5A1LA 1D1AA 2W67A 1YW0A 3HKEE 2A3DA 4KBMB 4QXHB 2FUPA 2NTXA 4DO0A 4OX9T 4MLKA 1U5PA 2CXDA 3C51A 2BKOA 4UF0B 4GOUA 2XSBA 5FNVE 3UUXB 4BJNA 4IL9A 1UURA 5LJMA 2HPLA 5FYMA 2D5UA 5JDGA 2N2NA 3B57A 4X64T 1UUSA 3ZT5A 1LKXA 3U3IA 2KZ7B 5JVDE 4XAXB 3EDVA 2KT9A 3QNUA 2MTQA 1HFAA 5AQIB 2XQ5A 2YN6A 4X20E 1NWMX 2IW5B 1OWAA 2V6YA 2NTYA 5FMNA 4EGWA 3UU4A 2XASB 3CIRA 4CN4A 4QH4A 4UF0A 4JI7T 4ERRA 4EIWA 3H3MA 4X1YE 5HEUA 4IE6A 4A98A 5LJNA 2UU9T 4HWIB 1YKEB 4LMLA 2QVAA 5H6RB 5HEHA 3TLSA 3VRBA 2UUBT 3LBXA 3ZC0A 3PUZF 3U78A 2YKSA 4AKGA 3RF1A 1ZOYA 2XPKA 1OEDE 5AQJB 1N36T 5DABA 5IWAT 1IJ6A 3AE1A 2VL8A 5LB7B 1D0YA 3HA4A 5KDMC 4DV2T 5L4EA 3MK7C 4JI0T 3UQ7A 1QSDA 4ZEYA 3ZJ1A 1Z8UA 3ZT6A 2VKOA 3N9NA 4ZS2A 5JDMA 3GA8A 1D0ZA 5LOVE 2PFVA 4HFVA 2WWVA 4ZS3A 4WBOA 5F5WA 4AXPA 1U4QA 4GKKT 5LCYA 1FEWA 4IDPA 1I94T 5F8PA 2CA5A 2LOSA 4JI4T 2XAHB 4U2ZA 5FVLA 2W61A 4X5TA 3TLUA 4UXNB 1MIVA 2WDVA 4H63V 5DJQC 3ZSSA 1E1HB 2LSIA 4HEAA 1DU2A 1CHUA 3HKCE 2ZM2A 3GN5B 2BG9B 5ABGA 3AE6A 2AE9A 3OJAA 3J7Yq 1IBMT 3C4ZA 3LK3B 2KXPB 2H3RA 2W0GA 3RIAA 1T7SA 2DLRA 2LSJA 4EOZB 5KXJA 4DV0T 2X0YA 5LBQB 1HNZT 4DMVA 5FL1A 4XBFB 5AQVB 3NRYA 4KHZF 2QGSA 4JI2T 1M7KA 4I0UA 3PJAA 3O1HA 3ZPOA 5FY0A 1MMAA 2RA1A 4AKLA 4YHHT 3ONJA 1KK7A 1Y64B 3IA3A 2W2UA 5AQUB 3RLFF 3ZYMA 3N2KE 1SHZC 4ZHQE 3AXJA 5JREA 2MYSA 4OFZA 4CI3B 5JTGA 3RIUA 2MPKA 3EI0A 2XTLA 2GK9A 4U2YA 1IJ5A 3AAEB 4PJJA 4B6XA 5LHIB 3GN5A 4A5XA 4IDZA 2NWBA 4ZXLA 4LFBT 2CEAA 2NW9A 4DR1T 3PDYA 2JMKA 2FJDA 3ZCJA 5HYAA 4DR7T 4IREA 4PK4A 5AQGB 2V7JA 3QK6A 1MNDA 5HCMA 3N5LA 4WBNE 4X66T 2IDOB 2YOEA 2E2AA 4EV6A 3I0OA 4OYKA 5L2LA 2YU1A 2BVLA 3FZMB 3L3PA 4PFOA 3Q5DA 3MXZA 2ZM6T 4DR3T 3VR9A 2FJBA 2JQQA 3BQLA 2X9WA 5C2TA 1N33T 4PAGA 3ZYKA 1T72A 2ZLYA 4AQFA 3T1HT 1HS7A 3HKDE 4Q25A 5LG3A 3AEBA 4J2CA 5ADXL 4DR2T 4M1PA 4L0RA 3M3ZB 4BJMA 4C91A 5ABEA 1HNWT 4JLEA 2M6IA 4E7ZA 3UT5E 1X9BA 3B5MA 4MFRA 3FXDB 4B3RT 1LVFA 4TNWA 1SUMB 3AE5A 4DVDA 2KINB 3PUXF 5GONE 1NAFA 1MNEA 4IDNA 5FP3A 4COFA 3F31A 3KDSE 3PU8A 3OPCA 3CVRA 4N78D 2ODVA 2YK0A 1KF6A 4TWFA 4DV3T 4UELA 2DWGA 4IE4A 2D0UA 2V1DB 2WM9A 3RIUC 4JV5T 5DQWA 4TV9E 2XQ9A 3NKZA 2VASA 3P4QA 3NZPA 3LDQB 4JEUB 2CXLA 4H9PC 4PJMA 4JUYA 2X0LB 4TWDA 4UVBB 4CN1A 3UU5A 4I43B 2AXDS 5J0ZA 2VK9A 2LE8A 2WMNA 3MACA 1D1BA 3ETUA 3QC9A 4UR9A 4DV4T 3AEFA 4WNKA 4G2AA 3NBXX 5H6QB 4IHJE 5HXRA 4O4IE 2VB6A 2LM9A 3EUHA 2NW8A 2CLYB 4QKNA 3AE8A 4ISTA 3C4WA 4GIWA 4UIGA 3PUGA 2Q9QB 1E2AA 4YTMA 3RYCE 5LGTB 3N9LA 2LHRA 4U7YA 4WW0A 5AQKB 1VCSA 3AA1B 5FXWA 1QLBA 3FBZA 3OYXA 4ZOLE 3RQWA 2E5LT 3PUSA 1IZNB 1YQ3A 4O4JE 4GK0E 5FXZA 4H9SE 5CA0E 3AB3B 1YKHB 2YDSA 3FZFB 3Q5WA 3V5SA 5BMVE 5JDNA 3CWZB 4B3TT 3VU7H 3ZLIA 2BKPA 2EHOA 5AQPB 1J1JA 4TN7B 5AQFB 1WR6A 1N32T 2KMFA 2ZMAA 4DR6T 4KP3C 4CXWA 4LF9T 4QHOA 2BDEA 4KI0F 3ZC1A 3C64A 2J62A 5LP6E 2JQKA 2J1DG 4QH5A 2NP9A 1G73A 2H89A 4DBQA 5ABHA 5KX5E 2WP9A 5C3JA 2Y48B 4I4TE 3UTKA 2Q9QC 2IMLA 3IBPA 3A7MA 2CMRA 2KSRA 1MMGA 2CWOA 3AVRA 5HXHA 4HFDA 1FJGT 3QUJA 3E22E 5TAOA 3DJBA 4X1KE 3NWIA 5HAXA 3O1JA 5CB4E 2XQ3A 3RGLA 3P50A 2JIWA 4KUMB 4PK5A 4U33A 3UFEA 5LGUB 1WLXA 2XQ8A 3F2EA 4HWCA 3AEEA 4CN6A 4I50E 4ILBA 1WR0A 4ANJA 2LKGA 2V5DA 3RC3A 4YY3T 1J5ET 1KNZA 1FMVA 2J47A 3RH3A 3CX8B 1ZV4X 5AQQB 2XSAA 2MAWA 3ANWB 3LBXB 1BR1A 3NRXA 4ZI3C 5AQOB 4GYSA 3JC6D 4DV6T 5KMGP 4DNDA 2ZM8A 1HTJF 3AA7B 4QX8B 2E9XD 4JI1T 3PV0F 3AAIA 4U31A 2XZEA 3BQKA 4LF8T 5JDLA 4LFAT 4B3ST 5EK4A 4OK0A 2B1EA 3OVUA 1KFYA 2CLYC 2JQHA 2R6GF 4HWDA 2VVSA 2VVNA 4HFBA 3S4UA 5L3GB 1EZ3A 2BVMA 3ZJ2A 1ZEEA 3KV5A 5J1GA 3OBVE 4CXYA 1IBKT 2XQAA 4DV7T 2LHNA 2JPFA 4AQYT 4V1Av 3RPUA
chains in the Genus database with same CATH topology
3JC6C 1LRZA 2ZM0A 3MKDA 4HKAA 3N9OA 4G63A 3L09A 3PUQA 4QXBB 2I59A 2L3LA 4P0BA 1LVKA 2LSYA 4AKRB 4H9RC 1FMWA 1HF8A 5HXEA 5JRCA 2OA5A 3CQXC 3KV6A 2MOZA 3LFMA 3J9X1 1V9DA 4TZ4C 4O4LE 5HWXA 5LP6E 3E08A 1T98A 3IEEA 3Q9DA 2E8IA 4L9IA 3ZYLA 4L5GA 3D0TA 2EHOD 3Q5XA 3AA6B 4IGUA 1YD8G 1VOMA 4P09A 3FBLA 2L9QA 3LK42 3H3AA 5FXVA 4AKIA 4ZI3D 2WMOA 4UV9B 3K3QC 2XUEA 4O4HE 5DQVA 2W62A 2UXNB 2VWAA 4QX7B 4ISSA 3CKDA 2ACXA 2IAKA 3ONXA 1O3XA 1MIYA 4O2AE 3OKQA 2LEHA 3RRCA 5LNKA 2E9XB 3R84B 5M4YA 1IAPA 5HXSA 2WAUA 4PNIA 3I9WA 3UUMA 3VKHA 3VKGA 4IE0A 5JR9C 4UVCB 5LG4A 5L3FB 1HCIA 4YJ2E 2LSGA 2HH7A 3ESLA 3KFWX 1AJ3A 4K0UA 2Q9QA 1S35A 2X68A 1D0XA 2KWIB 2YU2A 3NZQA 3FB2A 4ILUA 2DCFA 1HX8A 3CQCB 4P0AA 2E9XA 4OHFA 4HTEA 3R6NA 3WI3A 4XZCA 2ODUA 5JRCB 5JR9B 2NOXA 3DP7A 4PK6A 2D0TA 4CQIA 4CXXA 3ANWA 2VKDA 2E9XC 5C8YE 1BR2A 2EHOC 5EK2A 3TKLB 3HI2A 2G0UA 3DTOA 2WBLA 3CX6B 2UXXB 3MZKB 1WYBA 5JR9A 3P7IA 1WYCA 5HXCA 3UULA 4MBQA 4HN9A 3IHRA 4TUYE 5FY1A 1QUUA 2DI4A 3CMLA 2V7KA 3T8OA 2X9XA 1OXZA 3UUNA 1UX5A 2C5IT 4EAHA 4TV8E 4I55E 4KMCA 2D2SA 4PJNA 4CI1B 5FY7A 4U74A 4DBQA 3HL6A 3FXEB 2X9YA 3GWHA 4PFPA 2MBGA 2CXFA 3ZN0B 5JH7E 3PU3A 2C5JA 2WWUA 1Z0PA 2C5KT 3FHNA 3GMIA 5ETWA 5LHHB 5HWYA 1B7TA 4JEHB 5LBMA 3KV9A 5LXTE 1US7B 3EDUA 5LYJE 3I0QA 3O4XE 3C50A 3ZCIA 5E0OA 3O1IA 3C98B 4Z8XA 3KV4A 2K9AA 2KWHA 4UVAB 3B13A 2XAJB 3KVAA 3AAAB 4DBRA 2N9DA 5JQGE 3LG7A 4H63H 5F3JA 1X79A 2VKJA 1MMDA 3N9PA 4EZ4A 3ZMUB 1D1CA 4OYJA 3F57A 4QWNB 4IE7A 3SOLA 5J2TE 5EZYE 4CZZB 2W00A 3ZN1B 1VRBA 3KBUA 2LOPA 3PE0A 3I1AA 1UCUA 3SWHA 2V7IA 3EVYA 5AFUL 2IC9A 4H9QC 5J2UE 2CM0A 2PJQA 3K8PC 2M67A 2PG8A 1CUNA 3A5XA 3RYFE 1S94A 2K5BB 2L8KA 2XAQB 3W15B 4EB6E 3WAJA 3MA9A 4YLHA 2V7MA 2YINA 2YEVC 4ZI7E 4NUUA 3ZMTB 5L3BB 2XAGB 1FIOA 3OYZA 4E7SA 4O2BE 2RP4A 2CE7A 5FXXA 3WAKA 2W63A 4AQGA 3RX6A 2EHOB 3Q2MA 3KVBA 2X66A 4H9OC 2A2FX 3RRWA 4EYUA 3AA0B 2QA7A 4IE5A 2X9HA 2KNDA 5IHYA 5EK3A 2JJ9A 4DMWA 3AVSA 5LHGB 2KLQA 2VKHA 3P8CD 2P9BA 3H37A 3PURA 3SS1A 4MALA 3CQGB 2HPJA 2JMHA 4BA9A 4ADZA 3E0ZA 4X1IE 2PBIA 3O9XA 2A72A 4HE8A 1G8XA 4AI6A 2CWYA 1ZHCA 2DNXA 2X67A 4YJ3E 5CA1E 2DWKA 2K24A 1WRDA 3N9QA 3BQIA 4YFSA 4AKHA 5LGNB 2Y6XA 3LJCA 1HG2A 3IF8B 4FJOA 5LA6E 4EYYR 2H7VC 2WSSV 3PUAA 4GYRA 3RKOA 4ASKA 4PJLA 5L3CB 1BR4A 4F6RC 2CCQA 3CPZA 2LJLA 4IIJE 2X51A 2NW7A 1MMNA 2Q9QD 3N2OA 5JDFA 5L3DB 3HKBE 3K3NA 4H9NC 2V26A 2XAFB 3LK2B 4QXCB 4A56A 1UX4A 1H7CA 1MIWA 4GK5E 2DHRA 5JDHA 2LT3A 3K3OA 4YHJA 2LSKA 3C4XA 4C90A 3M65A 4FI5A 2ES0A 3RYIE 3ZEFB 4EXTA 3ZMZB 1ZKEA 4ZI2D 2Z6EA 3MJXA 1BR0A 3HR0A 3KBTA 3N2GE 2XQYA 5L3EB 2V7LA 2H7OA 3SRZA 5JDQA 4TX5A 2K48A 3ETVA 3ZMSB 2Y8DA 3V5UA 4O8SA 4PW8A 5L3GB 2XHEB 3CX7B 4AQFC 3VHLA 3ZMVB 1HG5A 3I9YA 4CI2B 1SA0E 3BK9A 4NUVA 2C0SA 4UEMA 5IYZE 2SPCA 2IC6A 3RC8A 4U72A 4EZHA 3PTRB 2N1GA 4HGAA 4ZI2C 3RYHE 2JRKA 3KINB 3N9MA 4UV8B 4MHCA 2BZBA 5A1LA 1D1AA 1YW0A 3HKEE 2A3DA 4KBMB 4QXHB 2NTXA 4DO0A 4MLKA 1U5PA 2CXDA 3C51A 3UUXB 4UF0B 4GOUA 5FNVE 5LJMA 4BJNA 2HPLA 5FYMA 2D5UA 5JDGA 2N2NA 3B57A 1LKXA 3U3IA 2KZ7B 5JVDE 4XAXB 3EDVA 2KT9A 2MTQA 1HFAA 4X20E 1NWMX 2IW5B 1OWAA 2NTYA 5FMNA 2XASB 4UF0A 4ERRA 4EIWA 4X1YE 4IE6A 5LJNA 1YKEB 5H6RB 3ZC0A 3LBXA 3U78A 4AKGA 5DABA 1IJ6A 2VL8A 1D0YA 3HA4A 5KDMC 3MK7C 1QSDA 3ZJ1A 2VKOA 3N9NA 4ZS2A 5JDMA 3GA8A 1D0ZA 5LOVE 2PFVA 4HFVA 4ZS3A 4WBOA 4AXPA 1U4QA 5LCYA 1FEWA 5F8PA 2CA5A 2LOSA 2XAHB 2W61A 4UXNB 1MIVA 4H63V 5DJQC 1E1HB 2LSIA 4HEAA 3HKCE 2ZM2A 3GN5B 3OJAA 3J7Yq 3C4ZA 3LK3B 2KXPB 2H3RA 2W0GA 4EOZB 2DLRA 2LSJA 5LBQB 4XBFB 4DMVA 3NRYA 2QGSA 3O1HA 3ZPOA 5FY0A 1MMAA 2RA1A 4AKLA 1KK7A 1Y64B 3ZYMA 3N2KE 1SHZC 5JREA 2MYSA 4OFZA 4CI3B 2XTLA 2GK9A 1IJ5A 3AAEB 4PJJA 4B6XA 5LHIB 3GN5A 4IDZA 2NWBA 2CEAA 2NW9A 3PDYA 2JMKA 5HYAA 3ZCJA 4PK4A 2V7JA 3QK6A 1MNDA 3N5LA 4WBNE 3I0OA 4OYKA 5L2LA 2YU1A 2BVLA 3L3PA 4PFOA 3MXZA 2JQQA 3BQLA 2X9WA 4PAGA 3ZYKA 2ZLYA 4AQFA 1HS7A 3HKDE 5ADXL 4J2CA 4M1PA 4L0RA 4BJMA 4C91A 4JLEA 4E7ZA 3UT5E 4MFRA 3FXDB 1LVFA 4DVDA 2KINB 5GONE 1NAFA 1MNEA 5FP3A 3F31A 3KDSE 3PU8A 3CVRA 4N78D 2ODVA 2YK0A 4UELA 2DWGA 4IE4A 2D0UA 2V1DB 2WM9A 5DQWA 4TV9E 4BAYB 2VASA 4JEUB 3NZPA 4ZHQE 4PJMA 2CXLA 4H9PC 4UVBB 4JUYA 2X0LB 4I43B 2VK9A 2LE8A 2WMNA 3MACA 1D1BA 3ETUA 3QC9A 4WNKA 4G2AA 3NBXX 5H6QB 4IHJE 5HXRA 4O4IE 2VB6A 2LM9A 3EUHA 2NW8A 2CLYB 4QKNA 4ISTA 3C4WA 4GIWA 4UIGA 3PUGA 2Q9QB 3RYCE 5LGTB 3N9LA 2LHRA 4WW0A 3AA1B 5FXWA 3FBZA 3OYXA 4ZOLE 3PUSA 1IZNB 4O4JE 5FXZA 4GK0E 4H9SE 5CA0E 3AB3B 1YKHB 3Q5WA 5BMVE 3V5SA 5JDNA 3CWZB 3VU7H 3ZLIA 2EHOA 4TN7B 1WR6A 2KMFA 2ZMAA 4KP3C 4CXWA 4QHOA 2BDEA 3ZC1A 3C64A 2J1DG 2NP9A 1G73A 5KX5E 2Y48B 4I4TE 3UTKA 2Q9QC 3IBPA 2CMRA 1MMGA 2CWOA 3AVRA 5HXHA 3QUJA 3E22E 5TAOA 3DJBA 4X1KE 5HAXA 3O1JA 5CB4E 4KUMB 4PK5A 3UFEA 5LGUB 1WLXA 3F2EA 4I50E 4ANJA 1KNZA 3RC3A 1FMVA 3RH3A 3CX8B 1ZV4X 3LBXB 3ANWB 3NRXA 1BR1A 4ZI3C 4GYSA 3JC6D 5KMGP 4DNDA 2ZM8A 1HTJF 3AA7B 4QX8B 2E9XD 3AAIA 3BQKA 5JDLA 5EK4A 4OK0A 2B1EA 2CLYC 3S4UA 1EZ3A 2BVMA 3ZJ2A 1ZEEA 3KV5A 5J1GA 3OBVE 4CXYA 2LHNA 2JPFA 4V1Av 3RPUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P09 A;  5LJN A;  4OYJ A;  2CM0 A;  4P0B A;  4P0A A;  5LJM A;  2HPL A;  4OYK A;  2D5U A;  4JUY A;  2CCQ A;  2HPJ A; 
#chains in the Genus database with same CATH topology
 2IIU A;  3JC6 C;  4DR5 T;  1LRZ A;  2ZM0 A;  3AE2 A;  3MKD A;  4HKA A;  3N9O A;  4G63 A;  3AE3 A;  4JBW F;  3L09 A;  2X0H A;  2XM2 A;  3PUQ A;  4QXB B;  2I59 A;  2L3L A;  4P0B A;  1LVK A;  2E5V A;  2LSY A;  1L0V A;  4AKR B;  5BR8 T;  4H9R C;  1FMW A;  1HF8 A;  4WYV A;  5HEJ A;  5HXE A;  2XM1 A;  5JRC A;  2OA5 A;  3CQX C;  3KV6 A;  2MOZ A;  3LFM A;  2V6X A;  4EEB A;  4DV1 T;  3J9X 1;  3X1D A;  1V9D A;  2LRL A;  3AEC A;  4O4L E;  4TZ4 C;  5HWX A;  3E08 A;  3L8R A;  4TNV A;  2BG9 A;  3UUB A;  5ABF A;  1T98 A;  1VCT A;  3IEE A;  2E8I A;  3Q9D A;  4L9I A;  5HEG A;  3ZYL A;  3ZT7 A;  4IL4 A;  4L5G A;  4YTN A;  3D0T A;  2EHO D;  3AE7 A;  3RKG A;  2QRX A;  3Q5X A;  4LF4 T;  3AE4 A;  2FJE A;  3AA6 B;  4IGU A;  1YD8 G;  1VOM A;  2W4X A;  4ZZC A;  2WB5 A;  2W66 A;  3FBL A;  2L9Q A;  2V8S V;  3H3A A;  3LK4 2;  4P09 A;  5FXV A;  4AIU A;  5L47 A;  4AKI A;  3EAM A;  1UK5 A;  1W9R A;  4ZI3 D;  1JNR A;  3NVO A;  4F8H A;  2WMO A;  4UV9 B;  3K3Q C;  2XUE A;  5FVK A;  4O4H E;  2RPA A;  4QH1 A;  5DQV A;  2W62 A;  2UXN B;  3G06 A;  4HWH A;  2VWA A;  3TLW A;  4QX7 B;  4ISS A;  3CKD A;  2ACX A;  1SE7 A;  2IAK A;  3ONX A;  4YTP A;  1O3X A;  1MIY A;  4O2A E;  2UXC T;  4TWH A;  3OKQ A;  2LEH A;  3RRC A;  5LNK A;  2I6H A;  2E9X B;  4IDQ A;  4DUZ T;  4DR4 T;  2UXB T;  3R84 B;  5M4Y A;  3FZL B;  1IAP A;  5HXS A;  2WAU A;  2UXD T;  4PNI A;  3I9W A;  2XY8 B;  3UUM A;  3EHZ A;  3VKH A;  4IE0 A;  5JR9 C;  4UVC B;  5LG4 A;  2BS3 A;  3VKG A;  3VRA A;  5L3F B;  1HCI A;  4YJ2 E;  2LSG A;  2HH7 A;  1XWM A;  2WZI A;  3ESL A;  1OED A;  3JCF A;  3KFW X;  4K0U A;  4K0K T;  2Q9Q A;  1S35 A;  2X68 A;  1D0X A;  2WU5 A;  2KWI B;  2YU2 A;  3NZQ A;  3FB2 A;  2WDQ A;  4ILU A;  2DCF A;  1HX8 A;  2VQF T;  3CQC B;  4P0A A;  2E9X A;  4OHF A;  2FJA A;  4HTE A;  5AQN B;  5FKY A;  5HEO A;  3R6N A;  3WI3 A;  3JAF A;  4XZC A;  2ODU A;  3JAD A;  5JRC B;  4ILC A;  1XNQ T;  2LRK A;  5JR9 B;  2NOX A;  2WS3 A;  3DP7 A;  4PK6 A;  2D0T A;  4CQI A;  2BKN A;  4CXX A;  2I0M A;  3ANW A;  2VKD A;  1HNX T;  2PTF A;  2E9X C;  1N34 T;  2XJ7 A;  5C8Y E;  1BR2 A;  5AQR B;  2EHO C;  4EED A;  5EK2 A;  3TKL B;  3HI2 A;  2G0U A;  3DTO A;  2WBL A;  3CX6 B;  3VR8 A;  2UXX B;  3MZK B;  1E7P A;  4HFC A;  5AQM B;  4JI8 T;  4U3C A;  1WYB A;  5JR9 A;  1KNR A;  3LSV A;  3P7I A;  3RI5 A;  3CK6 A;  1I6Z A;  1WYC A;  5HXC A;  3WAJ A;  3UUL A;  3A8Y C;  4HN9 A;  3IHR A;  4MBQ A;  4TUY E;  5FY1 A;  4DV5 T;  1QUU A;  2DI4 A;  3CML A;  2V7K A;  2CPT A;  3Q5E A;  3T8O A;  3UU3 A;  1XMQ T;  2X9X A;  5HCJ A;  1OXZ A;  3UUN A;  4HFE A;  2K3W A;  4KX6 A;  1UX5 A;  2C5I T;  4EAH A;  3EAB A;  4NXN T;  4TV8 E;  4I55 E;  4KMC A;  1W09 A;  2D2S A;  4PJN A;  4BAY B;  4CI1 B;  4KHP T;  5FY7 A;  4U74 A;  2WU2 A;  3HL6 A;  3FXE B;  2X9Y A;  3GWH A;  4PFP A;  2WY2 A;  5AQT B;  2MBG A;  1YQ4 A;  2FBW A;  2CXF A;  5AQS B;  2HN1 A;  3PUY F;  3ZN0 B;  2UUA T;  5JH7 E;  5ABF B;  3PU3 A;  2VUR A;  4YXD A;  5CGM A;  2C5J A;  2WWU A;  1Z0P A;  2C5K T;  3FHN A;  3UU6 A;  3ZST A;  1T8B A;  3GMI A;  4JI3 T;  5ETW A;  3SFD A;  2LLY A;  2ACZ A;  5LHH B;  5HWY A;  1B7T A;  4JEH B;  5LBM A;  4B3M T;  3KV9 A;  5LXT E;  4NIQ A;  1US7 B;  3EDU A;  5LYJ E;  1HX1 B;  3I0Q A;  3O4X E;  3ZKR A;  4Z91 A;  3C50 A;  3ZCI A;  5LMU T;  1XNR T;  5E0O A;  3RHW A;  3O1I A;  3C98 B;  3PUW F;  3KV4 A;  4Z8X A;  3ABV A;  3OTO T;  2K9A A;  2KWH A;  4UVA B;  3B13 A;  2XAJ B;  3KVA A;  3AAA B;  4DBR A;  2LM2 A;  2N9D A;  4AIS A;  3QB5 A;  5JQG E;  2WCA A;  2NR4 A;  3LG7 A;  4H63 H;  5F3J A;  2D9D A;  1X79 A;  3PUV F;  2J4G A;  2VKJ A;  1MMD A;  2WQY A;  4HFI A;  2WZH A;  4X65 T;  4IT4 A;  3AE9 A;  3N9P A;  1XDP A;  1OED C;  4EZ4 A;  3ZMU B;  1D1C A;  4A97 A;  4OYJ A;  4ZZB A;  4ILA A;  3F57 A;  2XQ7 A;  4QWN B;  4EYY R;  4IE7 A;  3SOL A;  2JQ9 A;  5J2T E;  1WFD A;  5EZY E;  4CZZ B;  2W00 A;  3ZN1 B;  1VRB A;  3KBU A;  2LOP A;  1JNZ A;  3PE0 A;  1XZY A;  3I1A A;  4LFC T;  1UCU A;  2WDR A;  2V7I A;  3SWH A;  3EVY A;  4Z90 A;  1W0A A;  5AFU L;  2IC9 A;  4H9Q C;  5J2U E;  2CM0 A;  2PJQ A;  3K8P C;  2M67 A;  2PG8 A;  1CUN A;  2VL0 A;  3A5X A;  3TLT A;  3AED A;  1S94 A;  2BBJ A;  3RYF E;  1M62 A;  2K5B B;  2L8K A;  2XAQ B;  3W15 B;  3QB5 K;  2YDR A;  3MA9 A;  2V7M A;  2V5C A;  4YLH A;  3RIF A;  4EB6 E;  5IUX A;  2YIN A;  2YEV C;  1NEK A;  2CHO A;  4NUU A;  4YSY A;  4ZI7 E;  5L4H A;  3ZMT B;  2XAG B;  5L3B B;  1FIO A;  3OYZ A;  4E7S A;  4O2B E;  2H88 A;  3RQU A;  2RP4 A;  3P4S A;  3UU8 A;  5CJ5 A;  2CE7 A;  5FXX A;  2BS2 A;  1NEN A;  3WAK A;  2W63 A;  4AQG A;  1J5W A;  2B76 A;  2BG9 C;  1UGO A;  3RX6 A;  2EHO B;  3AEG A;  3P4P A;  3Q2M A;  1IBL T;  3KVB A;  2X66 A;  4H9O C;  2A2F X;  3RRW A;  3AXJ B;  4EYU A;  1XDO A;  2QA7 A;  3AA0 B;  4IE5 A;  2X9H A;  2KND A;  5IHY A;  5EK3 A;  4LMJ A;  2JJ9 A;  4DMW A;  3AVS A;  4LF7 T;  5LHG B;  2KLQ A;  2VKH A;  3P8C D;  1Y01 A;  1KEY A;  2P9B A;  3H37 A;  3PUR A;  1AJ3 A;  2CBI A;  1HR0 T;  1WCR A;  4MAL A;  3CQG B;  2HPJ A;  2JMH A;  2LKH A;  4U7I A;  1GQE A;  3SS1 A;  3TLV A;  4ADZ A;  4BA9 A;  3E0Z A;  2OV9 A;  4X1I E;  3PJA J;  4X62 T;  1XMO T;  2PBI A;  4DID B;  3O9X A;  2A72 A;  4HE8 A;  1G8X A;  3P4R A;  3T1Y T;  2CWY A;  1ZHC A;  4AI6 A;  5AQH B;  4HWF A;  2DNX A;  2X67 A;  2YDQ A;  4YJ3 E;  5CA1 E;  4JI6 T;  2DWK A;  2K24 A;  1WRD A;  3N9Q A;  4P1N A;  2OLT A;  3BQI A;  5CFB A;  4NPP A;  4YFS A;  2IHR 1;  4AKH A;  5LGN B;  2Y6X A;  3LJC A;  1HG2 A;  3IF8 B;  4FJO A;  4YSZ A;  4LMK A;  3L39 A;  5LA6 E;  2H7V C;  2WSS V;  3PUA A;  4GYR A;  1YXR A;  4JI5 T;  4PJL A;  3RKO A;  4ASK A;  5L3C B;  1BR4 A;  3QOF A;  2M6B A;  2QYW A;  4WZX A;  4F6R C;  2CCQ A;  4DUY T;  4JYA T;  3CPZ A;  2LJL A;  4IIJ E;  2X51 A;  2NW7 A;  2XQ4 A;  1MMN A;  2Q9Q D;  1OED B;  3N2O A;  5JDF A;  5L3D B;  3HKB E;  3K3N A;  4H9N C;  2V26 A;  2XAF B;  3LK2 B;  4QXC B;  4A56 A;  1UX4 A;  3ONL C;  1H7C A;  1MIW A;  3FZH B;  4GK5 E;  2DHR A;  5JDH A;  2LT3 A;  3K3O A;  4YHJ A;  4YT0 A;  2LSK A;  2V6Y B;  3C4X A;  4GKJ T;  3RC8 A;  4C90 A;  3M65 A;  4FI5 A;  2ES0 A;  3RYI E;  3ZEF B;  1KNP A;  3ZMZ B;  4EXT A;  1ZKE A;  4ZI2 D;  2Z6E A;  1R8I A;  2CRB A;  3MJX A;  2DL1 A;  1BR0 A;  2CBJ A;  3HR0 A;  3KBT A;  2XQY A;  3AEA A;  3N2G E;  5L3E B;  2VQE T;  2V7L A;  2H7O A;  4IDO A;  3SRZ A;  4TX5 A;  5JDQ A;  2K48 A;  5LMN T;  3ETV A;  3ZMS B;  2CHN A;  2XQ6 A;  2Y8D A;  3V5U A;  4LF6 T;  4O8S A;  4PW8 A;  3UQ4 A;  2XHE B;  3FZK B;  3CX7 B;  3SFE A;  1W0B A;  3VHL A;  3ZMV B;  4AQF C;  1HG5 A;  2IUB A;  4LF5 T;  2F4V T;  3I9Y A;  4CI2 B;  3K1S A;  1SA0 E;  2BBH A;  3BK9 A;  3JAE A;  2UUC T;  4NUV A;  2C0S A;  4UEM A;  2HHH T;  1ZP0 A;  2A9U A;  2IC6 A;  2SPC A;  4U72 A;  3P4W A;  3PTR B;  4HFH A;  5IYZ E;  4EZH A;  2N1G A;  4NXM T;  4HGA A;  3UFG A;  4ZI2 C;  3RYH E;  2JRK A;  2HN2 A;  4YSX A;  5FL0 A;  3KIN B;  3N9M A;  2BG9 E;  5AQL B;  4UV8 B;  2BS4 A;  4MHC A;  2BZB A;  5A1L A;  1D1A A;  2W67 A;  1YW0 A;  3HKE E;  2A3D A;  4KBM B;  4QXH B;  2FUP A;  2NTX A;  4DO0 A;  4OX9 T;  4MLK A;  1U5P A;  2CXD A;  3C51 A;  2BKO A;  4UF0 B;  4GOU A;  2XSB A;  5FNV E;  3UUX B;  4BJN A;  4IL9 A;  1UUR A;  5LJM A;  2HPL A;  5FYM A;  2D5U A;  5JDG A;  2N2N A;  3B57 A;  4X64 T;  1UUS A;  3ZT5 A;  1LKX A;  3U3I A;  2KZ7 B;  5JVD E;  4XAX B;  3EDV A;  2KT9 A;  3QNU A;  2MTQ A;  1HFA A;  5AQI B;  2XQ5 A;  2YN6 A;  4X20 E;  1NWM X;  2IW5 B;  1OWA A;  2V6Y A;  2NTY A;  5FMN A;  4EGW A;  3UU4 A;  2XAS B;  3CIR A;  4CN4 A;  4QH4 A;  4UF0 A;  4JI7 T;  4ERR A;  4EIW A;  3H3M A;  4X1Y E;  5HEU A;  4IE6 A;  4A98 A;  5LJN A;  2UU9 T;  4HWI B;  1YKE B;  4LML A;  2QVA A;  5H6R B;  5HEH A;  3TLS A;  3VRB A;  2UUB T;  3LBX A;  3ZC0 A;  3PUZ F;  3U78 A;  2YKS A;  4AKG A;  3RF1 A;  1ZOY A;  2XPK A;  1OED E;  5AQJ B;  1N36 T;  5DAB A;  5IWA T;  1IJ6 A;  3AE1 A;  2VL8 A;  5LB7 B;  1D0Y A;  3HA4 A;  5KDM C;  4DV2 T;  5L4E A;  3MK7 C;  4JI0 T;  3UQ7 A;  1QSD A;  4ZEY A;  3ZJ1 A;  1Z8U A;  3ZT6 A;  2VKO A;  3N9N A;  4ZS2 A;  5JDM A;  3GA8 A;  1D0Z A;  5LOV E;  2PFV A;  4HFV A;  2WWV A;  4ZS3 A;  4WBO A;  5F5W A;  4AXP A;  1U4Q A;  4GKK T;  5LCY A;  1FEW A;  4IDP A;  1I94 T;  5F8P A;  2CA5 A;  2LOS A;  4JI4 T;  2XAH B;  4U2Z A;  5FVL A;  2W61 A;  4X5T A;  3TLU A;  4UXN B;  1MIV A;  2WDV A;  4H63 V;  5DJQ C;  3ZSS A;  1E1H B;  2LSI A;  4HEA A;  1DU2 A;  1CHU A;  3HKC E;  2ZM2 A;  3GN5 B;  2BG9 B;  5ABG A;  3AE6 A;  2AE9 A;  3OJA A;  3J7Y q;  1IBM T;  3C4Z A;  3LK3 B;  2KXP B;  2H3R A;  2W0G A;  3RIA A;  1T7S A;  2DLR A;  2LSJ A;  4EOZ B;  5KXJ A;  4DV0 T;  2X0Y A;  5LBQ B;  1HNZ T;  4DMV A;  5FL1 A;  4XBF B;  5AQV B;  3NRY A;  4KHZ F;  2QGS A;  4JI2 T;  1M7K A;  4I0U A;  3PJA A;  3O1H A;  3ZPO A;  5FY0 A;  1MMA A;  2RA1 A;  4AKL A;  4YHH T;  3ONJ A;  1KK7 A;  1Y64 B;  3IA3 A;  2W2U A;  5AQU B;  3RLF F;  3ZYM A;  3N2K E;  1SHZ C;  4ZHQ E;  3AXJ A;  5JRE A;  2MYS A;  4OFZ A;  4CI3 B;  5JTG A;  3RIU A;  2MPK A;  3EI0 A;  2XTL A;  2GK9 A;  4U2Y A;  1IJ5 A;  3AAE B;  4PJJ A;  4B6X A;  5LHI B;  3GN5 A;  4A5X A;  4IDZ A;  2NWB A;  4ZXL A;  4LFB T;  2CEA A;  2NW9 A;  4DR1 T;  3PDY A;  2JMK A;  2FJD A;  3ZCJ A;  5HYA A;  4DR7 T;  4IRE A;  4PK4 A;  5AQG B;  2V7J A;  3QK6 A;  1MND A;  5HCM A;  3N5L A;  4WBN E;  4X66 T;  2IDO B;  2YOE A;  2E2A A;  4EV6 A;  3I0O A;  4OYK A;  5L2L A;  2YU1 A;  2BVL A;  3FZM B;  3L3P A;  4PFO A;  3Q5D A;  3MXZ A;  2ZM6 T;  4DR3 T;  3VR9 A;  2FJB A;  2JQQ A;  3BQL A;  2X9W A;  5C2T A;  1N33 T;  4PAG A;  3ZYK A;  1T72 A;  2ZLY A;  4AQF A;  3T1H T;  1HS7 A;  3HKD E;  4Q25 A;  5LG3 A;  3AEB A;  4J2C A;  5ADX L;  4DR2 T;  4M1P A;  4L0R A;  3M3Z B;  4BJM A;  4C91 A;  5ABE A;  1HNW T;  4JLE A;  2M6I A;  4E7Z A;  3UT5 E;  1X9B A;  3B5M A;  4MFR A;  3FXD B;  4B3R T;  1LVF A;  4TNW A;  1SUM B;  3AE5 A;  4DVD A;  2KIN B;  3PUX F;  5GON E;  1NAF A;  1MNE A;  4IDN A;  5FP3 A;  4COF A;  3F31 A;  3KDS E;  3PU8 A;  3OPC A;  3CVR A;  4N78 D;  2ODV A;  2YK0 A;  1KF6 A;  4TWF A;  4DV3 T;  4UEL A;  2DWG A;  4IE4 A;  2D0U A;  2V1D B;  2WM9 A;  3RIU C;  4JV5 T;  5DQW A;  4TV9 E;  2XQ9 A;  3NKZ A;  2VAS A;  3P4Q A;  3NZP A;  3LDQ B;  4JEU B;  2CXL A;  4H9P C;  4PJM A;  4JUY A;  2X0L B;  4TWD A;  4UVB B;  4CN1 A;  3UU5 A;  4I43 B;  2AXD S;  5J0Z A;  2VK9 A;  2LE8 A;  2WMN A;  3MAC A;  1D1B A;  3ETU A;  3QC9 A;  4UR9 A;  4DV4 T;  3AEF A;  4WNK A;  4G2A A;  3NBX X;  5H6Q B;  4IHJ E;  5HXR A;  4O4I E;  2VB6 A;  2LM9 A;  3EUH A;  2NW8 A;  2CLY B;  4QKN A;  3AE8 A;  4IST A;  3C4W A;  4GIW A;  4UIG A;  3PUG A;  2Q9Q B;  1E2A A;  4YTM A;  3RYC E;  5LGT B;  3N9L A;  2LHR A;  4U7Y A;  4WW0 A;  5AQK B;  1VCS A;  3AA1 B;  5FXW A;  1QLB A;  3FBZ A;  3OYX A;  4ZOL E;  3RQW A;  2E5L T;  3PUS A;  1IZN B;  1YQ3 A;  4O4J E;  4GK0 E;  5FXZ A;  4H9S E;  5CA0 E;  3AB3 B;  1YKH B;  2YDS A;  3FZF B;  3Q5W A;  3V5S A;  5BMV E;  5JDN A;  3CWZ B;  4B3T T;  3VU7 H;  3ZLI A;  2BKP A;  2EHO A;  5AQP B;  1J1J A;  4TN7 B;  5AQF B;  1WR6 A;  1N32 T;  2KMF A;  2ZMA A;  4DR6 T;  4KP3 C;  4CXW A;  4LF9 T;  4QHO A;  2BDE A;  4KI0 F;  3ZC1 A;  3C64 A;  2J62 A;  5LP6 E;  2JQK A;  2J1D G;  4QH5 A;  2NP9 A;  1G73 A;  2H89 A;  4DBQ A;  5ABH A;  5KX5 E;  2WP9 A;  5C3J A;  2Y48 B;  4I4T E;  3UTK A;  2Q9Q C;  2IML A;  3IBP A;  3A7M A;  2CMR A;  2KSR A;  1MMG A;  2CWO A;  3AVR A;  5HXH A;  4HFD A;  1FJG T;  3QUJ A;  3E22 E;  5TAO A;  3DJB A;  4X1K E;  3NWI A;  5HAX A;  3O1J A;  5CB4 E;  2XQ3 A;  3RGL A;  3P50 A;  2JIW A;  4KUM B;  4PK5 A;  4U33 A;  3UFE A;  5LGU B;  1WLX A;  2XQ8 A;  3F2E A;  4HWC A;  3AEE A;  4CN6 A;  4I50 E;  4ILB A;  1WR0 A;  4ANJ A;  2LKG A;  2V5D A;  3RC3 A;  4YY3 T;  1J5E T;  1KNZ A;  1FMV A;  2J47 A;  3RH3 A;  3CX8 B;  1ZV4 X;  5AQQ B;  2XSA A;  2MAW A;  3ANW B;  3LBX B;  1BR1 A;  3NRX A;  4ZI3 C;  5AQO B;  4GYS A;  3JC6 D;  4DV6 T;  5KMG P;  4DND A;  2ZM8 A;  1HTJ F;  3AA7 B;  4QX8 B;  2E9X D;  4JI1 T;  3PV0 F;  3AAI A;  4U31 A;  2XZE A;  3BQK A;  4LF8 T;  5JDL A;  4LFA T;  4B3S T;  5EK4 A;  4OK0 A;  2B1E A;  3OVU A;  1KFY A;  2CLY C;  2JQH A;  2R6G F;  4HWD A;  2VVS A;  2VVN A;  4HFB A;  3S4U A;  5L3G B;  1EZ3 A;  2BVM A;  3ZJ2 A;  1ZEE A;  3KV5 A;  5J1G A;  3OBV E;  4CXY A;  1IBK T;  2XQA A;  4DV7 T;  2LHN A;  2JPF A;  4AQY T;  4V1A v;  3RPU A; 
#chains in the Genus database with same CATH homology
 3JC6 C;  1LRZ A;  2ZM0 A;  3MKD A;  4HKA A;  3N9O A;  4G63 A;  3L09 A;  3PUQ A;  4QXB B;  2I59 A;  2L3L A;  4P0B A;  1LVK A;  2LSY A;  4AKR B;  4H9R C;  1FMW A;  1HF8 A;  5HXE A;  5JRC A;  2OA5 A;  3CQX C;  3KV6 A;  2MOZ A;  3LFM A;  3J9X 1;  1V9D A;  4TZ4 C;  4O4L E;  5HWX A;  5LP6 E;  3E08 A;  1T98 A;  3IEE A;  3Q9D A;  2E8I A;  4L9I A;  3ZYL A;  4L5G A;  3D0T A;  2EHO D;  3Q5X A;  3AA6 B;  4IGU A;  1YD8 G;  1VOM A;  4P09 A;  3FBL A;  2L9Q A;  3LK4 2;  3H3A A;  5FXV A;  4AKI A;  4ZI3 D;  2WMO A;  4UV9 B;  3K3Q C;  2XUE A;  4O4H E;  5DQV A;  2W62 A;  2UXN B;  2VWA A;  4QX7 B;  4ISS A;  3CKD A;  2ACX A;  2IAK A;  3ONX A;  1O3X A;  1MIY A;  4O2A E;  3OKQ A;  2LEH A;  3RRC A;  5LNK A;  2E9X B;  3R84 B;  5M4Y A;  1IAP A;  5HXS A;  2WAU A;  4PNI A;  3I9W A;  3UUM A;  3VKH A;  3VKG A;  4IE0 A;  5JR9 C;  4UVC B;  5LG4 A;  5L3F B;  1HCI A;  4YJ2 E;  2LSG A;  2HH7 A;  3ESL A;  3KFW X;  1AJ3 A;  4K0U A;  2Q9Q A;  1S35 A;  2X68 A;  1D0X A;  2KWI B;  2YU2 A;  3NZQ A;  3FB2 A;  4ILU A;  2DCF A;  1HX8 A;  3CQC B;  4P0A A;  2E9X A;  4OHF A;  4HTE A;  3R6N A;  3WI3 A;  4XZC A;  2ODU A;  5JRC B;  5JR9 B;  2NOX A;  3DP7 A;  4PK6 A;  2D0T A;  4CQI A;  4CXX A;  3ANW A;  2VKD A;  2E9X C;  5C8Y E;  1BR2 A;  2EHO C;  5EK2 A;  3TKL B;  3HI2 A;  2G0U A;  3DTO A;  2WBL A;  3CX6 B;  2UXX B;  3MZK B;  1WYB A;  5JR9 A;  3P7I A;  1WYC A;  5HXC A;  3UUL A;  4MBQ A;  4HN9 A;  3IHR A;  4TUY E;  5FY1 A;  1QUU A;  2DI4 A;  3CML A;  2V7K A;  3T8O A;  2X9X A;  1OXZ A;  3UUN A;  1UX5 A;  2C5I T;  4EAH A;  4TV8 E;  4I55 E;  4KMC A;  2D2S A;  4PJN A;  4CI1 B;  5FY7 A;  4U74 A;  4DBQ A;  3HL6 A;  3FXE B;  2X9Y A;  3GWH A;  4PFP A;  2MBG A;  2CXF A;  3ZN0 B;  5JH7 E;  3PU3 A;  2C5J A;  2WWU A;  1Z0P A;  2C5K T;  3FHN A;  3GMI A;  5ETW A;  5LHH B;  5HWY A;  1B7T A;  4JEH B;  5LBM A;  3KV9 A;  5LXT E;  1US7 B;  3EDU A;  5LYJ E;  3I0Q A;  3O4X E;  3C50 A;  3ZCI A;  5E0O A;  3O1I A;  3C98 B;  4Z8X A;  3KV4 A;  2K9A A;  2KWH A;  4UVA B;  3B13 A;  2XAJ B;  3KVA A;  3AAA B;  4DBR A;  2N9D A;  5JQG E;  3LG7 A;  4H63 H;  5F3J A;  1X79 A;  2VKJ A;  1MMD A;  3N9P A;  4EZ4 A;  3ZMU B;  1D1C A;  4OYJ A;  3F57 A;  4QWN B;  4IE7 A;  3SOL A;  5J2T E;  5EZY E;  4CZZ B;  2W00 A;  3ZN1 B;  1VRB A;  3KBU A;  2LOP A;  3PE0 A;  3I1A A;  1UCU A;  3SWH A;  2V7I A;  3EVY A;  5AFU L;  2IC9 A;  4H9Q C;  5J2U E;  2CM0 A;  2PJQ A;  3K8P C;  2M67 A;  2PG8 A;  1CUN A;  3A5X A;  3RYF E;  1S94 A;  2K5B B;  2L8K A;  2XAQ B;  3W15 B;  4EB6 E;  3WAJ A;  3MA9 A;  4YLH A;  2V7M A;  2YIN A;  2YEV C;  4ZI7 E;  4NUU A;  3ZMT B;  5L3B B;  2XAG B;  1FIO A;  3OYZ A;  4E7S A;  4O2B E;  2RP4 A;  2CE7 A;  5FXX A;  3WAK A;  2W63 A;  4AQG A;  3RX6 A;  2EHO B;  3Q2M A;  3KVB A;  2X66 A;  4H9O C;  2A2F X;  3RRW A;  4EYU A;  3AA0 B;  2QA7 A;  4IE5 A;  2X9H A;  2KND A;  5IHY A;  5EK3 A;  2JJ9 A;  4DMW A;  3AVS A;  5LHG B;  2KLQ A;  2VKH A;  3P8C D;  2P9B A;  3H37 A;  3PUR A;  3SS1 A;  4MAL A;  3CQG B;  2HPJ A;  2JMH A;  4BA9 A;  4ADZ A;  3E0Z A;  4X1I E;  2PBI A;  3O9X A;  2A72 A;  4HE8 A;  1G8X A;  4AI6 A;  2CWY A;  1ZHC A;  2DNX A;  2X67 A;  4YJ3 E;  5CA1 E;  2DWK A;  2K24 A;  1WRD A;  3N9Q A;  3BQI A;  4YFS A;  4AKH A;  5LGN B;  2Y6X A;  3LJC A;  1HG2 A;  3IF8 B;  4FJO A;  5LA6 E;  4EYY R;  2H7V C;  2WSS V;  3PUA A;  4GYR A;  3RKO A;  4ASK A;  4PJL A;  5L3C B;  1BR4 A;  4F6R C;  2CCQ A;  3CPZ A;  2LJL A;  4IIJ E;  2X51 A;  2NW7 A;  1MMN A;  2Q9Q D;  3N2O A;  5JDF A;  5L3D B;  3HKB E;  3K3N A;  4H9N C;  2V26 A;  2XAF B;  3LK2 B;  4QXC B;  4A56 A;  1UX4 A;  1H7C A;  1MIW A;  4GK5 E;  2DHR A;  5JDH A;  2LT3 A;  3K3O A;  4YHJ A;  2LSK A;  3C4X A;  4C90 A;  3M65 A;  4FI5 A;  2ES0 A;  3RYI E;  3ZEF B;  4EXT A;  3ZMZ B;  1ZKE A;  4ZI2 D;  2Z6E A;  3MJX A;  1BR0 A;  3HR0 A;  3KBT A;  3N2G E;  2XQY A;  5L3E B;  2V7L A;  2H7O A;  3SRZ A;  5JDQ A;  4TX5 A;  2K48 A;  3ETV A;  3ZMS B;  2Y8D A;  3V5U A;  4O8S A;  4PW8 A;  5L3G B;  2XHE B;  3CX7 B;  4AQF C;  3VHL A;  3ZMV B;  1HG5 A;  3I9Y A;  4CI2 B;  1SA0 E;  3BK9 A;  4NUV A;  2C0S A;  4UEM A;  5IYZ E;  2SPC A;  2IC6 A;  3RC8 A;  4U72 A;  4EZH A;  3PTR B;  2N1G A;  4HGA A;  4ZI2 C;  3RYH E;  2JRK A;  3KIN B;  3N9M A;  4UV8 B;  4MHC A;  2BZB A;  5A1L A;  1D1A A;  1YW0 A;  3HKE E;  2A3D A;  4KBM B;  4QXH B;  2NTX A;  4DO0 A;  4MLK A;  1U5P A;  2CXD A;  3C51 A;  3UUX B;  4UF0 B;  4GOU A;  5FNV E;  5LJM A;  4BJN A;  2HPL A;  5FYM A;  2D5U A;  5JDG A;  2N2N A;  3B57 A;  1LKX A;  3U3I A;  2KZ7 B;  5JVD E;  4XAX B;  3EDV A;  2KT9 A;  2MTQ A;  1HFA A;  4X20 E;  1NWM X;  2IW5 B;  1OWA A;  2NTY A;  5FMN A;  2XAS B;  4UF0 A;  4ERR A;  4EIW A;  4X1Y E;  4IE6 A;  5LJN A;  1YKE B;  5H6R B;  3ZC0 A;  3LBX A;  3U78 A;  4AKG A;  5DAB A;  1IJ6 A;  2VL8 A;  1D0Y A;  3HA4 A;  5KDM C;  3MK7 C;  1QSD A;  3ZJ1 A;  2VKO A;  3N9N A;  4ZS2 A;  5JDM A;  3GA8 A;  1D0Z A;  5LOV E;  2PFV A;  4HFV A;  4ZS3 A;  4WBO A;  4AXP A;  1U4Q A;  5LCY A;  1FEW A;  5F8P A;  2CA5 A;  2LOS A;  2XAH B;  2W61 A;  4UXN B;  1MIV A;  4H63 V;  5DJQ C;  1E1H B;  2LSI A;  4HEA A;  3HKC E;  2ZM2 A;  3GN5 B;  3OJA A;  3J7Y q;  3C4Z A;  3LK3 B;  2KXP B;  2H3R A;  2W0G A;  4EOZ B;  2DLR A;  2LSJ A;  5LBQ B;  4XBF B;  4DMV A;  3NRY A;  2QGS A;  3O1H A;  3ZPO A;  5FY0 A;  1MMA A;  2RA1 A;  4AKL A;  1KK7 A;  1Y64 B;  3ZYM A;  3N2K E;  1SHZ C;  5JRE A;  2MYS A;  4OFZ A;  4CI3 B;  2XTL A;  2GK9 A;  1IJ5 A;  3AAE B;  4PJJ A;  4B6X A;  5LHI B;  3GN5 A;  4IDZ A;  2NWB A;  2CEA A;  2NW9 A;  3PDY A;  2JMK A;  5HYA A;  3ZCJ A;  4PK4 A;  2V7J A;  3QK6 A;  1MND A;  3N5L A;  4WBN E;  3I0O A;  4OYK A;  5L2L A;  2YU1 A;  2BVL A;  3L3P A;  4PFO A;  3MXZ A;  2JQQ A;  3BQL A;  2X9W A;  4PAG A;  3ZYK A;  2ZLY A;  4AQF A;  1HS7 A;  3HKD E;  5ADX L;  4J2C A;  4M1P A;  4L0R A;  4BJM A;  4C91 A;  4JLE A;  4E7Z A;  3UT5 E;  4MFR A;  3FXD B;  1LVF A;  4DVD A;  2KIN B;  5GON E;  1NAF A;  1MNE A;  5FP3 A;  3F31 A;  3KDS E;  3PU8 A;  3CVR A;  4N78 D;  2ODV A;  2YK0 A;  4UEL A;  2DWG A;  4IE4 A;  2D0U A;  2V1D B;  2WM9 A;  5DQW A;  4TV9 E;  4BAY B;  2VAS A;  4JEU B;  3NZP A;  4ZHQ E;  4PJM A;  2CXL A;  4H9P C;  4UVB B;  4JUY A;  2X0L B;  4I43 B;  2VK9 A;  2LE8 A;  2WMN A;  3MAC A;  1D1B A;  3ETU A;  3QC9 A;  4WNK A;  4G2A A;  3NBX X;  5H6Q B;  4IHJ E;  5HXR A;  4O4I E;  2VB6 A;  2LM9 A;  3EUH A;  2NW8 A;  2CLY B;  4QKN A;  4IST A;  3C4W A;  4GIW A;  4UIG A;  3PUG A;  2Q9Q B;  3RYC E;  5LGT B;  3N9L A;  2LHR A;  4WW0 A;  3AA1 B;  5FXW A;  3FBZ A;  3OYX A;  4ZOL E;  3PUS A;  1IZN B;  4O4J E;  5FXZ A;  4GK0 E;  4H9S E;  5CA0 E;  3AB3 B;  1YKH B;  3Q5W A;  5BMV E;  3V5S A;  5JDN A;  3CWZ B;  3VU7 H;  3ZLI A;  2EHO A;  4TN7 B;  1WR6 A;  2KMF A;  2ZMA A;  4KP3 C;  4CXW A;  4QHO A;  2BDE A;  3ZC1 A;  3C64 A;  2J1D G;  2NP9 A;  1G73 A;  5KX5 E;  2Y48 B;  4I4T E;  3UTK A;  2Q9Q C;  3IBP A;  2CMR A;  1MMG A;  2CWO A;  3AVR A;  5HXH A;  3QUJ A;  3E22 E;  5TAO A;  3DJB A;  4X1K E;  5HAX A;  3O1J A;  5CB4 E;  4KUM B;  4PK5 A;  3UFE A;  5LGU B;  1WLX A;  3F2E A;  4I50 E;  4ANJ A;  1KNZ A;  3RC3 A;  1FMV A;  3RH3 A;  3CX8 B;  1ZV4 X;  3LBX B;  3ANW B;  3NRX A;  1BR1 A;  4ZI3 C;  4GYS A;  3JC6 D;  5KMG P;  4DND A;  2ZM8 A;  1HTJ F;  3AA7 B;  4QX8 B;  2E9X D;  3AAI A;  3BQK A;  5JDL A;  5EK4 A;  4OK0 A;  2B1E A;  2CLY C;  3S4U A;  1EZ3 A;  2BVM A;  3ZJ2 A;  1ZEE A;  3KV5 A;  5J1G A;  3OBV E;  4CXY A;  2LHN A;  2JPF A;  4V1A v;  3RPU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...