4P0AA

Crystal structure of hoip pub domain in complex with p97 pim
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
174
structure length
174
Chain Sequence
EEEERAFLVAREELASALRRDSGQAFSLEQLRPLLASSLPLAARYLQLDAARLVRCNAHGEPRNYLNTLSTALNILEKYGRNLLSPQRPRYWRGVKFNNPVFRSTVDAVQGGRDVLRLYGYTEEQPDGLSFPEGQEEPDEHQVATVTLEVLLLRTELSLLLQNTHPRQQALEQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E3 ubiquitin-protein ligase RNF31
publication title Binding of OTULIN to the PUB domain of HOIP controls NF-kappa B signaling.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 62
structure length 174
sequence length 174
chains with identical sequence C
ec nomenclature ec 2.3.2.31: RBR-type E3 ubiquitin transferase.
pdb deposition date 2014-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09409 PUB PUB domain
A PF18486 PUB_1 PNGase/UBA- or UBX-containing domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.2190 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4p0aA00
4P09A 4P0AA 2HPLA 2CM0A 2HPJA 4OYJA 2D5UA 5LJNA 5LJMA 4OYKA 4JUYA 2CCQA 4P0BA
chains in the Genus database with same CATH superfamily
3PJAJ 5EK2A 4KI0F 2XAJB 4O2BE 1D0XA 2HH7A 2E9XD 2ODUA 3BQKA 5JDHA 3C4WA 2IAKA 3J7Yq 4IE5A 4U72A 2XQYA 4A97A 2XUEA 4O4IE 5FMNA 2J4GA 3ZMTB 4YXDA 3ZT7A 2BBJA 4UV8B 4KHZF 1BR1A 4EIWA 1XZYA 4F6RC 3E0ZA 2CWYA 4ZI7E 4N78D 3SFEA 3ZT6A 4H9SE 3NRXA 5LYJE 4JI6T 4JBWF 2XQ8A 3CX6B 3RIUA 2C0SA 3K3QC 3ZC0A 3C4ZA 3O9XA 3PUYF 5JQGE 3ZSTA 2N2NA 4AI6A 3KVAA 3DP7A 3HA4A 3LDQB 4ILAA 5L47A 2LHNA 2XASB 5JDQA 3CKDA 2FJDA 3ZCIA 4UVAB 3N9LA 3T8OA 2VVNA 3O1HA 4WBNE 3AE9A 4X66T 1KK7A 3ZLIA 2CM0A 3TKLB 2CA5A 3SFDA 4JI7T 1W9RA 5HEGA 2B76A 5LHIB 2K24A 4NPPA 2VVSA 1YQ3A 3GWHA 2YKSA 4HTEA 4GKJT 3ZMZB 2AXDS 4NXNT 5HEJA 2QRXA 2UU9T 3W15B 5DJQC 3FBZA 4TUYE 4EXTA 1VOMA 5J2UE 1S94A 4TNWA 5AQNB 3ZJ1A 1UCUA 3EHZA 3AEFA 2X0LB 2UXNB 3KDSE 4EEDA 3KV4A 3MJXA 3Q2MA 5FXVA 4YSYA 4BA9A 4JV5T 3ZC1A 1HNXT 3RF1A 2VL8A 1YQ4A 5KDMC 3FZLB 4U74A 3QB5A 2G0UA 3TLUA 2D9DA 1M62A 2XQAA 3A7MA 1NWMX 5LMNT 2YU1A 3I9YA 5HXHA 5ABEA 2W61A 2Q9QC 3RRCA 3BQIA 2WDRA 2WMOA 3HR0A 3CX8B 2WU5A 4ZS3A 4EOZB 5HXRA 3TLSA 5L3CB 4K0KT 1BR2A 2CCQA 4B3TT 3ETVA 4HKAA 5JR9C 4HFBA 3K3NA 3VR9A 3PUZF 2BG9A 4YHHT 1N34T 3FZKB 3UUBA 2K9AA 2BZBA 4LF8T 3ZJ2A 4K0UA 3S4UA 3AE2A 1XMQT 2AE9A 2ACXA 2ODVA 4GKKT 5LCYA 2H89A 4C91A 2L3LA 4DR4T 2HPJA 5L4HA 2Y6XA 3F31A 4YJ3E 2KLQA 4DBRA 4CI3B 3UU6A 1Z0PA 2CBIA 2PBIA 3F57A 4ADZA 4DIDB 3SOLA 4PK5A 2KWIB 4JYAT 2LKGA 2X9HA 3ZCJA 4B6XA 2LSIA 2VKOA 2XPKA 2X9XA 5FNVE 5AQIB 4EV6A 1D1AA 1HNWT 3L39A 5JVDE 4ANJA 4TWDA 2EHOB 3N9OA 4I4TE 1E2AA 4LF5T 5LP6E 4HEAA 2E8IA 2OA5A 4JI2T 5L3GB 1LVKA 3N2GE 2CWOA 3T1HT 2W4XA 3AAAB 4QX7B 2CLYC 2HHHT 3P7IA 3PUXF 4HFDA 2DLRA 3AXJB 2W66A 4WBOA 1ZP0A 2VB6A 5FXZA 4ILBA 4U31A 4IDZA 4G63A 3FXEB 2EHOA 2CMRA 3EABA 3ETUA 1MMGA 4HFIA 4PJMA 2NTXA 2LEHA 3RIFA 4I50E 4QHOA 5H6QB 3PUSA 4DUYT 4TZ4C 2E5VA 2BDEA 3RYCE 5AQOB 1R8IA 2CRBA 3VHLA 4P0BA 2DCFA 2Q9QD 2LM2A 4H63H 3PUAA 5LXTE 2JMHA 1YXRA 2KZ7B 3IF8B 2W63A 5AQVB 2MTQA 4AQFA 3NVOA 1NEKA 2VWAA 2K3WA 4O8SA 4X1IE 2LSGA 2VK9A 3TLWA 4Z8XA 4EYUA 4HFHA 2YK0A 5HEOA 1U5PA 5AQGB 1H7CA 3KINB 3UUXB 2W00A 2DWGA 2V1DB 5FL1A 4Z90A 3QC9A 3UUMA 3RIUC 3PE0A 1YW0A 4I43B 3LK2B 1WYBA 2ZMAA 2LT3A 1L0VA 3IHRA 5CFBA 1LKXA 4P09A 1MMDA 3C4XA 4JI8T 2LRLA 2NTYA 5IWAT 3P8CD 3AE1A 4TV9E 2VKDA 2JQ9A 4ZEYA 3PUVF 3OYZA 1D0YA 1NENA 4I0UA 4V1Av 1KNZA 4IHJE 2BVMA 3UQ4A 3C98B 3EI0A 2H7OA 3KBTA 4WZXA 3N9PA 5LG4A 2X0YA 2H7VC 2CXFA 3FBLA 2W0GA 3PUQA 5GONE 3OPCA 1CHUA 4UVBB 3I9WA 2V6YB 4QH5A 4UEMA 3O1IA 4OK0A 4EZHA 4Z91A 1WCRA 4LMKA 3MA9A 2W67A 3CX7B 5JRCB 4AKHA 2V5DA 3CIRA 3MK7C 4X1YE 4IE0A 1QUUA 3AA1B 2KMFA 5ABHA 3SWHA 3E08A 4IDOA 5AQLB 2LLYA 1LVFA 2V7MA 4CN6A 3KV5A 4NIQA 2UXDT 2MAWA 4DO0A 1IZNB 2K48A 4LMJA 2LOPA 3HKDE 2V6YA 4H9QC 2YINA 3WI3A 2IMLA 5LA6E 1XDOA 2DWKA 4LF9T 2BG9E 5JRCA 3OVUA 3AE6A 2WWVA 1Y64B 2XAGB 4DV6T 3VKHA 3R84B 2H3RA 2YDSA 3WAKA 2BS4A 3FB2A 4NXMT 3HL6A 1G73A 3M65A 4ZOLE 1Y01A 2R6GF 2VKJA 2WDVA 3G06A 1I94T 3N5LA 4UELA 2CPTA 3L3PA 1QLBA 2UXBT 1Z8UA 2BG9C 4UXNB 3NBXX 5LBMA 2CXLA 2XAQB 5TAOA 2WU2A 2KNDA 1GQEA 3UULA 4JEHB 2QGSA 5ADXL 2Y8DA 2J1DG 4L5GA 4AKGA 2M67A 2N9DA 3PURA 1XNRT 2W2UA 3RC8A 2HN2A 3C64A 4ILUA 5M4YA 4HWFA 1ZHCA 3RIAA 3UU3A 4IREA 3AE5A 4XZCA 3BK9A 1W09A 2V7LA 2WB5A 5HXSA 1XNQT 5HCMA 4AKIA 2I0MA 4DNDA 5HEHA 4IE4A 4J2CA 5BR8T 2ES0A 3AVSA 4JLEA 3P4PA 1WFDA 3C50A 4L0RA 4HE8A 4PJNA 2ZM6T 4KHPT 1UGOA 4OFZA 2BS3A 2YDQA 4LF6T 3P50A 4H9NC 1V9DA 4B3RT 4IIJE 2NWBA 3MACA 2BG9B 2A72A 3N9QA 1OEDB 3U78A 2BKPA 2RA1A 4GIWA 3AEAA 5AQMB 3NKZA 2JJ9A 4TN7B 4GYRA 2VURA 2EHOC 4MLKA 3A5XA 1WRDA 2VASA 4YSZA 2V26A 4PJJA 4CN4A 5H6RB 1JNRA 3QUJA 4COFA 3FZMB 2YU2A 4JEUB 4MBQA 4DBQA 3ZYMA 4KUMB 2XTLA 2X68A 1T8BA 3VRAA 1O3XA 1OEDA 4UF0B 4CI1B 4X1KE 3LK3B 5AQTB 5C8YE 4X20E 4EYYR 3H37A 4XBFB 2IC9A 4F8HA 3HI2A 4HFEA 4OHFA 4CZZB 1MIVA 2OV9A 3JAFA 3QB5K 1D1CA 4KP3C 4DVDA 2NW8A 3K8PC 3P4SA 5AQHB 4AKLA 3KV9A 5L4EA 5E0OA 5C2TA 2X67A 4YSXA 5JDNA 4AQFC 1ZOYA 5AQUB 2Z6EA 3ZEFB 4DV3T 1YKEB 4UF0A 4B3ST 2CE7A 2LJLA 5DABA 4DUZT 4O4LE 3NRYA 1ZEEA 4QXBB 4UVCB 3GMIA 5ABFA 1J5ET 5L3EB 3P4WA 1ZKEA 2XSAA 2VL0A 1HX1B 3RKGA 4BJMA 4PFPA 2C5KT 3K1SA 3ZMSB 5LHGB 4UV9B 3RGLA 5KXJA 4ZHQE 5LJNA 5BMVE 4WYVA 1HS7A 2QVAA 4U7IA 2WCAA 4JI0T 5LBQB 4X64T 5FYMA 1VRBA 4HGAA 2SPCA 1UURA 2KINB 2RPAA 5EK4A 2QYWA 2JQQA 3H3MA 4NUUA 4EZ4A 1M7KA 4O2AE 5AQJB 2WAUA 4X5TA 5EZYE 5HWXA 4ISTA 3JAEA 4IDPA 5FXXA 3JC6C 3CK6A 2FJBA 3VKGA 1J5WA 2BBHA 3RH3A 4YLHA 1UK5A 1US7B 2DI4A 3I0OA 1KNPA 3EDVA 2L8KA 3QK6A 4H9RC 1W0BA 1AJ3A 2Q9QA 1HF8A 5AFUL 3AVRA 1YD8G 5J0ZA 2D5UA 4GK5E 3RYHE 2WP9A 2ZM2A 1N32T 5JR9A 5F3JA 4LF4T 3UFEA 2EHOD 1N33T 4LFBT 2IIUA 3PUWF 3Q9DA 3PV0F 1HG2A 3KBUA 1X79A 3CMLA 2CBJA 3F2EA 4DV0T 5FVLA 4YTMA 3RHWA 4CXWA 1MMNA 4CXYA 3P4RA 1U4QA 3WAJA 2N1GA 1N36T 3O1JA 3D0TA 4HFCA 1E1HB 3AEEA 3LBXA 3Q5WA 4UIGA 1OXZA 4LF7T 1WLXA 3CQCB 2BKNA 4M1PA 4U2ZA 2ZLYA 3Q5EA 2X9YA 2WDQA 3TLTA 2DHRA 2KXPB 3MKDA 2MBGA 4DR2T 5JH7E 4JI5T 2XQ6A 4MFRA 1WR6A 2LRKA 2ZM0A 2V5CA 2CEAA 2CXDA 4ZI3C 5LOVE 3ZKRA 2XAFB 2Y48B 2XHEB 1WR0A 3NZQA 1JNZA 5L3FB 3AEGA 2E9XB 1EZ3A 2LKHA 3R6NA 4ZXLA 2YOEA 1MNDA 2V7JA 1FMVA 4DR3T 5KMGP 2WM9A 1T7SA 2WSSV 3JCFA 2OLTA 4YJ2E 4E7SA 4HWHA 5LJMA 4DR6T 4CXXA 5HWYA 5LGNB 3UT5E 4EAHA 3ZYLA 2JRKA 4A5XA 4DV1T 2E9XA 2WZHA 4ZI2C 2XSBA 2LOSA 3MZKB 3HKCE 2CHOA 4E7ZA 4B3MT 2NP9A 3ZN0B 1VCSA 4A56A 5IUXA 1YKHB 2NW7A 2PFVA 3CVRA 1IJ6A 3JC6D 4NUVA 4H9PC 3ZMUB 3ONJA 2LSKA 2JMKA 3X1DA 4TWFA 5CJ5A 4BJNA 4LMLA 5IYZE 4FJOA 1HR0T 4OYKA 1FIOA 2D0TA 5L3BB 2IC6A 4GK0E 2LSJA 5CA0E 2W62A 4QH4A 3HKBE 2J62A 1XWMA 1BR0A 1E7PA 1MIWA 1QSDA 2YN6A 2HN1A 5JDFA 1KFYA 2WMNA 4TX5A 2BVLA 4IGUA 5CB4E 1MNEA 1OEDE 3GA8A 4ERRA 4ASKA 2UUAT 2XQ5A 4YTNA 4WW0A 4GOUA 2MPKA 1IAPA 2ACZA 2XM2A 3HKEE 4P1NA 4EGWA 1UX5A 3ONLC 5LMUT 3QNUA 4CN1A 4EEBA 2YDRA 3OBVE 5HAXA 4GYSA 3I0QA 2LHRA 4IL4A 1IBMT 3ZYKA 4TNVA 5DQWA 1MMAA 1OEDC 4MHCA 2LSYA 4QXHB 2IHR1 5AQSB 2DNXA 3ZN1B 5FXWA 1IJ5A 3AE7A 3ZSSA 3OKQA 4ZI3D 4BAYB 2A3DA 5FY0A 3VR8A 5J1GA 5F5WA 3Q5XA 2K5BB 3CWZB 4WNKA 5HYAA 4KMCA 2PJQA 1LRZA 3UUNA 3B13A 4LFCT 1ZV4X 4ILCA 3GN5B 4U7YA 3FZFB 1NAFA 4IT4A 4JI1T 2IW5B 4X65T 3B57A 4Q25A 3ZPOA 5JDLA 3ONXA 1XMOT 4HWDA 5ABGA 2XQ4A 5HCJA 4IDNA 2CHNA 3V5UA 3RQUA 3VRBA 4PW8A 4QKNA 4CQIA 4KBMB 3N9NA 4DV4T 4U2YA 4ZI2D 2MYSA 1DU2A 1D0ZA 3M3ZB 3GN5A 3CQXC 4DMVA 2UXCT 2FJEA 5JDGA 2I59A 4AIUA 3ZMVB 3UQ7A 4DR7T 2WQYA 3OYXA 5HEUA 4UR9A 2M6IA 4PNIA 3U3IA 4IDQA 2WY2A 2XJ7A 5HXEA 1MIYA 3C51A 3RYIE 2D2SA 2C5IT 2VKHA 2E5LT 3J9X1 1HNZT 3N2OA 2KSRA 1S35A 2E2AA 3L09A 3LJCA 2LE8A 5C3JA 3KFWX 2H88A 2BKOA 2A2FX 2V7IA 4DR5T 3IEEA 2DL1A 3AE4A 5F8PA 3H3AA 5LHHB 3EUHA 4A98A 2NR4A 3EDUA 2HPLA 4HWIB 2MOZA 3Q5DA 3LFMA 4KX6A 3EAMA 2WS3A 4I55E 5ABFB 4FI5A 2XZEA 4ZZCA 5FKYA 4H63V 2BS2A 5FY1A 3SS1A 4PFOA 1KF6A 4AKRB 1D1BA 2X51A 2XM1A 4DMWA 1KEYA 3UTKA 4JI4T 2KT9A 3TLVA 1T98A 1T72A 2WWUA 5AQRB 1WYCA 3VU7H 2V8SV 4PAGA 2D0UA 3CPZA 4EB6E 5EK3A 2V7KA 2VQFT 2XAHB 4AQGA 4IL9A 4DR1T 2WZIA 1G8XA 2UXXB 4IE6A 3RI5A 5JTGA 1BR4A 2L9QA 5L2LA 1OWAA 1J1JA 3K3OA 2KWHA 2PTFA 3UU4A 1HG5A 1HX8A 2Q9QB 2JQKA 3LSVA 1FJGT 4PJLA 1UUSA 2NOXA 3A8YC 4AXPA 4QX8B 4DV5T 3AE8A 5FVKA 1IBLT 5JR9B 4U33A 4IE7A 3RLFF 2FJAA 3UU5A 4HN9A 5LGTB 5HXCA 3AA7B 2X9WA 5JDMA 1SE7A 1HTJF 3IBPA 4DV2T 3NWIA 2JPFA 4ZS2A 3T1YT 4YHJA 3OTOT 1FEWA 2XQ7A 2IUBA 2E9XC 3PTRB 3LBXB 2X66A 3L8RA 3BQLA 1SHZC 3PU8A 2X0HA 2J47A 5L3DB 2FBWA 2PG8A 3AXJA 2I6HA 3MXZA 4L9IA 3NZPA 4YTPA 3UFGA 5LGUB 3ANWB 3RPUA 1SUMB 5J2TE 3AEBA 4OYJA 3AA0B 3LK42 3KV6A 3EVYA 2RP4A 2A9UA 3FZHB 5A1LA 2V6XA 2GK9A 2JIWA 5CA1E 3PU3A 4PK6A 5JREA 4QXCB 4MALA 3AB3B 1I6ZA 3KVBA 4C90A 3SRZA 3DJBA 4AISA 4AQYT 2XQ3A 3O4XE 3QOFA 4G2AA 4LFAT 2F4VT 4TWHA 2CLYB 3RQWA 3LG7A 5FL0A 2C5JA 2ZM8A 3ANWA 4YT0A 3AAIA 4XAXB 2FUPA 5LNKA 3B5MA 4U3CA 4QWNB 5AQKB 3I1AA 5LG3A 3RX6A 4O4HE 3AE3A 2XQ9A 1SA0E 3E22E 2YEVC 2VQET 3ESLA 3IA3A 2XY8B 4O4JE 4TV8E 3AEDA 5KX5E 4OX9T 3ZT5A 2B1EA 1VCTA 5FP3A 1KNRA 2M6BA 4QH1A 4X62T 4ZZBA 3ABVA 4YFSA 3PUGA 1UX4A 5FY7A 2UUBT 2JQHA 4H9OC 1IBKT 2UUCT 3RYFE 3JADA 1CUNA 3PJAA 5DQVA 5AQPB 2NW9A 3P4QA 1HCIA 2QA7A 1FMWA 3FHNA 4ISSA 1W0AA 3UU8A 2P9BA 4JI3T 2LM9A 3AECA 4DV7T 3OJAA 5CGMA 3DTOA 1B7TA 3N9MA 3RKOA 3PDYA 3RC3A 5AQQB 2WBLA 3N2KE 3V5SA 3AA6B 5AQFB 4HFVA 4HWCA 5LB7B 4P0AA 3AAEB 3CQGB 3RRWA 4JUYA 1HFAA 2IDOB 4CI2B 4YY3T 4PK4A 3FXDB 5ETWA 1XDPA 5IHYA 1X9BA
chains in the Genus database with same CATH topology
2MTQA 2CE7A 5JDLA 3ONXA 2LJLA 5DABA 4AQFA 5EK2A 2XAJB 4O2BE 1D0XA 2HH7A 2E9XD 2VWAA 2ODUA 3BQKA 3NRYA 4O4LE 4O8SA 1ZEEA 3C4WA 4QXBB 2LSGA 4X1IE 2IAKA 4UVCB 2VK9A 3V5UA 3J7Yq 4IE5A 4U72A 2XQYA 4PW8A 4QKNA 4CQIA 4KBMB 4Z8XA 3N9NA 4EYUA 2XUEA 3GMIA 4ZI2D 4O4IE 5FMNA 5L3EB 1ZKEA 3ZMTB 2YK0A 2MYSA 1U5PA 1D0ZA 4BJMA 4PFPA 2C5KT 3GN5A 4UV8B 1H7CA 3ZMSB 3CQXC 4DMVA 5LHGB 1BR1A 3KINB 4UV9B 5JDGA 4EIWA 4ZHQE 2I59A 5BMVE 5LJNA 3ZMVB 3UUXB 1HS7A 4F6RC 2W00A 2DWGA 3OYXA 2V1DB 5LBQB 3E0ZA 4PNIA 3U3IA 5FYMA 2CWYA 4ZI7E 1VRBA 3QC9A 4N78D 4HGAA 5HXEA 4H9SE 3UUMA 1MIYA 3C51A 3PE0A 1YW0A 2SPCA 3NRXA 4I43B 5LYJE 3LK2B 3RYIE 1WYBA 2ZMAA 2D2SA 2KINB 2C5IT 2VKHA 3CX6B 5EK4A 3J9X1 2LT3A 2C0SA 2JQQA 3K3QC 3ZC0A 3N2OA 1S35A 3C4ZA 3IHRA 4NUUA 4EZ4A 3O9XA 4O2AE 2WAUA 3L09A 3LJCA 5EZYE 5HWXA 2LE8A 4ISTA 1LKXA 4P09A 5JQGE 1MMDA 3KFWX 5FXXA 3C4XA 3JC6C 2N2NA 4AI6A 2NTYA 3VKGA 2A2FX 2V7IA 3P8CD 3IEEA 3KVAA 3DP7A 4YLHA 4TV9E 3RH3A 1US7B 2VKDA 2DI4A 3HA4A 3I0OA 3OYZA 5F8PA 3H3AA 5LHHB 1D0YA 3EUHA 3EDVA 2L8KA 4V1Av 2LHNA 3QK6A 1KNZA 4IHJE 2XASB 4H9RC 3EDUA 2Q9QA 1AJ3A 2BVMA 2HPLA 3C98B 1HF8A 5AFUL 5JDQA 3CKDA 3AVRA 2H7OA 1YD8G 3KBTA 3ZCIA 4UVAB 2MOZA 3N9LA 2D5UA 4GK5E 3T8OA 3N9PA 3O1HA 3RYHE 5LG4A 2H7VC 3LFMA 4WBNE 1KK7A 2ZM2A 3ZLIA 2CM0A 2CXFA 3FBLA 3TKLB 2CA5A 4I55E 2W0GA 3PUQA 5GONE 5JR9A 4FI5A 5F3JA 3UFEA 2EHOD 4H63V 4UVBB 5LHIB 2K24A 5FY1A 3Q9DA 1HG2A 3KBUA 1X79A 3CMLA 3F2EA 3SS1A 3I9WA 4PFOA 3GWHA 4AKRB 4UEMA 3O1IA 4CXWA 1MMNA 4OK0A 4EZHA 4HTEA 4CXYA 1D1BA 3ZMZB 2X51A 3MA9A 1U4QA 3ZPOA 4DMWA 3CX7B 3WAJA 5JRCB 4AKHA 3UTKA 2N1GA 3MK7C 2KT9A 4X1YE 4IE0A 1T98A 3O1JA 3D0TA 1E1HB 1QUUA 2WWUA 3VU7H 1WYCA 4PAGA 3W15B 3AA1B 3LBXA 2D0UA 3Q5WA 5DJQC 2KMFA 4UIGA 3FBZA 1OXZA 4TUYE 4EXTA 1WLXA 3CQCB 4M1PA 1VOMA 3CPZA 5J2UE 3SWHA 5EK3A 2V7KA 2XAHB 2ZLYA 4AQGA 4EB6E 3E08A 2X9YA 1S94A 2DHRA 2KXPB 1G8XA 2UXXB 3MKDA 3ZJ1A 1LVFA 2V7MA 1UCUA 4IE6A 2MBGA 3KV5A 2X0LB 4DO0A 1BR4A 2UXNB 2L9QA 5JH7E 5L2LA 1IZNB 2K48A 1OWAA 2LOPA 3HKDE 3KDSE 4H9QC 3K3OA 2KWHA 2YINA 1WR6A 4MFRA 3KV4A 1HG5A 3WI3A 1HX8A 5LA6E 2ZM0A 2Q9QB 3MJXA 2DWKA 2CEAA 3Q2MA 4PJLA 5JRCA 5FXVA 2CXDA 1Y64B 4ZI3C 4BA9A 5LOVE 3ZC1A 2XAGB 2NOXA 2VL8A 2XAFB 5KDMC 4AXPA 4QX8B 4U74A 3VKHA 3R84B 2Y48B 2XHEB 2H3RA 3WAKA 3FB2A 3NZQA 5JR9B 5L3FB 2E9XB 1EZ3A 2G0UA 4IE7A 4HN9A 3HL6A 3R6NA 1G73A 3M65A 5LGTB 5HXCA 3AA7B 4ZOLE 1NWMX 2YU1A 3I9YA 5HXHA 2VKJA 2W61A 2Q9QC 2X9WA 3RRCA 3BQIA 5JDMA 1HTJF 1MNDA 2V7JA 3IBPA 1FMVA 5KMGP 2WM9A 2WMOA 3N5LA 2WSSV 3HR0A 4UELA 3CX8B 3L3PA 4YJ2E 4E7SA 4ZS3A 4EOZB 5LJMA 2JPFA 5HXRA 4ZS2A 5L3CB 4CXXA 1BR2A 4YHJA 5HWYA 1FEWA 4UXNB 5LGNB 3NBXX 2CCQA 3UT5E 5LBMA 3ETVA 4HKAA 5JR9C 2CXLA 3K3NA 2E9XC 4EAHA 3ZYLA 2XAQB 3PTRB 3LBXB 2JRKA 5TAOA 2X66A 3BQLA 1SHZC 3PU8A 2KNDA 3UULA 2E9XA 4JEHB 4ZI2C 2QGSA 5L3DB 2LOSA 5ADXL 2Y8DA 2PG8A 2J1DG 3MZKB 3HKCE 4L5GA 2K9AA 3MXZA 4L9IA 2NP9A 4E7ZA 4AKGA 3NZPA 3ZN0B 2M67A 2BZBA 5LGUB 3ZJ2A 4A56A 2N9DA 3PURA 3ANWB 1YKHB 4K0UA 3S4UA 3RPUA 5J2TE 3RC8A 2NW7A 3C64A 2ACXA 3AA0B 2ODVA 3LK42 3KV6A 4ILUA 2PFVA 3CVRA 3EVYA 4OYJA 5LCYA 5M4YA 1IJ6A 3JC6D 4NUVA 4C91A 2L3LA 4H9PC 2HPJA 2RP4A 5A1LA 2Y6XA 3ZMUB 3F31A 4YJ3E 2GK9A 1ZHCA 2KLQA 4CI3B 4DBRA 5CA1E 3PU3A 1Z0PA 4PK6A 5JREA 2PBIA 2LSKA 4QXCB 2JMKA 4MALA 3AB3B 3KVBA 4XZCA 3F57A 4ADZA 3BK9A 4C90A 4BJNA 5IYZE 3SRZA 3SOLA 3DJBA 4FJOA 4PK5A 2V7LA 2KWIB 5HXSA 4AKIA 2X9HA 3ZCJA 4B6XA 2LSIA 4OYKA 2VKOA 1FIOA 2D0TA 3O4XE 4DNDA 4G2AA 5L3BB 2X9XA 4IE4A 2IC6A 5FNVE 4GK0E 2CLYB 2LSJA 2W62A 3LG7A 4J2CA 5CA0E 5JDHA 2C5JA 2ZM8A 3ANWA 2ES0A 3AVSA 1D1AA 3HKBE 3AAIA 4JLEA 1BR0A 4XAXB 5LNKA 1MIWA 3C50A 4L0RA 4HE8A 4PJNA 5JVDE 4ANJA 1QSDA 4QWNB 5JDFA 2EHOB 3N9OA 4OFZA 4I4TE 3I1AA 3RX6A 4O4HE 2WMNA 5LP6E 4TX5A 4HEAA 2BVLA 1SA0E 2E8IA 4IGUA 5CB4E 2OA5A 4H9NC 3E22E 1V9DA 1MNEA 4IIJE 5L3GB 1LVKA 2YEVC 2NWBA 3ESLA 3MACA 3N2GE 4O4JE 4TV8E 2CWOA 5KX5E 3GA8A 4ERRA 4ASKA 2A72A 4QX7B 3AAAB 2B1EA 2CLYC 5FP3A 3N9QA 3P7IA 3U78A 2RA1A 4GIWA 4WW0A 2DLRA 4WBOA 4YFSA 4GOUA 3PUGA 2JJ9A 4TN7B 1UX4A 4GYRA 1IAPA 2VB6A 2EHOC 5FY7A 5FXZA 4MLKA 3HKEE 4IDZA 4H9OC 4G63A 3A5XA 1WRDA 1UX5A 3FXEB 2VASA 3RYFE 2EHOA 2V26A 4PJJA 1CUNA 2CMRA 3OBVE 5DQVA 2NW9A 5H6RB 5HAXA 4GYSA 3I0QA 2LHRA 1HCIA 3ETUA 1MMGA 3QUJA 2QA7A 3ZYKA 1FMWA 3FHNA 4ISSA 4PJMA 2YU2A 4JEUB 4MBQA 5DQWA 2NTXA 1MMAA 4MHCA 4DBQA 3ZYMA 2LSYA 4QXHB 2P9BA 4KUMB 2DNXA 2LEHA 3ZN1B 2XTLA 2X68A 5FXWA 1IJ5A 2LM9A 4I50E 4QHOA 5H6QB 1O3XA 4UF0B 4CI1B 3OKQA 4X1KE 4ZI3D 4BAYB 3LK3B 3OJAA 5C8YE 2A3DA 4X20E 3PUSA 4TZ4C 3DTOA 5FY0A 4EYYR 3H37A 2BDEA 4XBFB 1B7TA 2IC9A 3N9MA 5J1GA 3RYCE 3RKOA 3PDYA 3HI2A 3Q5XA 4OHFA 3RC3A 2K5BB 4CZZB 1MIVA 3CWZB 4WNKA 5HYAA 2WBLA 3N2KE 4KMCA 3V5SA 2PJQA 1LRZA 3UUNA 3AA6B 3B13A 4HFVA 3VHLA 1D1CA 1ZV4X 4KP3C 4P0BA 3GN5B 2NW8A 4DVDA 2DCFA 3AAEB 3CQGB 2Q9QD 3K8PC 4P0AA 3RRWA 4AKLA 3KV9A 4JUYA 5E0OA 1HFAA 4CI2B 2X67A 1NAFA 4H63H 3PUAA 5LXTE 2JMHA 4PK4A 4AQFC 5JDNA 3FXDB 2IW5B 2KZ7B 3IF8B 5ETWA 2Z6EA 2W63A 3ZEFB 3B57A 5IHYA 1YKEB 4UF0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P09 A;  4P0A A;  2HPL A;  2CM0 A;  2HPJ A;  4OYJ A;  2D5U A;  5LJN A;  5LJM A;  4OYK A;  4JUY A;  2CCQ A;  4P0B A; 
#chains in the Genus database with same CATH topology
 3PJA J;  5EK2 A;  4KI0 F;  2XAJ B;  4O2B E;  1D0X A;  2HH7 A;  2E9X D;  2ODU A;  3BQK A;  5JDH A;  3C4W A;  2IAK A;  3J7Y q;  4IE5 A;  4U72 A;  2XQY A;  4A97 A;  2XUE A;  4O4I E;  5FMN A;  2J4G A;  3ZMT B;  4YXD A;  3ZT7 A;  2BBJ A;  4UV8 B;  4KHZ F;  1BR1 A;  4EIW A;  1XZY A;  4F6R C;  3E0Z A;  2CWY A;  4ZI7 E;  4N78 D;  3SFE A;  3ZT6 A;  4H9S E;  3NRX A;  5LYJ E;  4JI6 T;  4JBW F;  2XQ8 A;  3CX6 B;  3RIU A;  2C0S A;  3K3Q C;  3ZC0 A;  3C4Z A;  3O9X A;  3PUY F;  5JQG E;  3ZST A;  2N2N A;  4AI6 A;  3KVA A;  3DP7 A;  3HA4 A;  3LDQ B;  4ILA A;  5L47 A;  2LHN A;  2XAS B;  5JDQ A;  3CKD A;  2FJD A;  3ZCI A;  4UVA B;  3N9L A;  3T8O A;  2VVN A;  3O1H A;  4WBN E;  3AE9 A;  4X66 T;  1KK7 A;  3ZLI A;  2CM0 A;  3TKL B;  2CA5 A;  3SFD A;  4JI7 T;  1W9R A;  5HEG A;  2B76 A;  5LHI B;  2K24 A;  4NPP A;  2VVS A;  1YQ3 A;  3GWH A;  2YKS A;  4HTE A;  4GKJ T;  3ZMZ B;  2AXD S;  4NXN T;  5HEJ A;  2QRX A;  2UU9 T;  3W15 B;  5DJQ C;  3FBZ A;  4TUY E;  4EXT A;  1VOM A;  5J2U E;  1S94 A;  4TNW A;  5AQN B;  3ZJ1 A;  1UCU A;  3EHZ A;  3AEF A;  2X0L B;  2UXN B;  3KDS E;  4EED A;  3KV4 A;  3MJX A;  3Q2M A;  5FXV A;  4YSY A;  4BA9 A;  4JV5 T;  3ZC1 A;  1HNX T;  3RF1 A;  2VL8 A;  1YQ4 A;  5KDM C;  3FZL B;  4U74 A;  3QB5 A;  2G0U A;  3TLU A;  2D9D A;  1M62 A;  2XQA A;  3A7M A;  1NWM X;  5LMN T;  2YU1 A;  3I9Y A;  5HXH A;  5ABE A;  2W61 A;  2Q9Q C;  3RRC A;  3BQI A;  2WDR A;  2WMO A;  3HR0 A;  3CX8 B;  2WU5 A;  4ZS3 A;  4EOZ B;  5HXR A;  3TLS A;  5L3C B;  4K0K T;  1BR2 A;  2CCQ A;  4B3T T;  3ETV A;  4HKA A;  5JR9 C;  4HFB A;  3K3N A;  3VR9 A;  3PUZ F;  2BG9 A;  4YHH T;  1N34 T;  3FZK B;  3UUB A;  2K9A A;  2BZB A;  4LF8 T;  3ZJ2 A;  4K0U A;  3S4U A;  3AE2 A;  1XMQ T;  2AE9 A;  2ACX A;  2ODV A;  4GKK T;  5LCY A;  2H89 A;  4C91 A;  2L3L A;  4DR4 T;  2HPJ A;  5L4H A;  2Y6X A;  3F31 A;  4YJ3 E;  2KLQ A;  4DBR A;  4CI3 B;  3UU6 A;  1Z0P A;  2CBI A;  2PBI A;  3F57 A;  4ADZ A;  4DID B;  3SOL A;  4PK5 A;  2KWI B;  4JYA T;  2LKG A;  2X9H A;  3ZCJ A;  4B6X A;  2LSI A;  2VKO A;  2XPK A;  2X9X A;  5FNV E;  5AQI B;  4EV6 A;  1D1A A;  1HNW T;  3L39 A;  5JVD E;  4ANJ A;  4TWD A;  2EHO B;  3N9O A;  4I4T E;  1E2A A;  4LF5 T;  5LP6 E;  4HEA A;  2E8I A;  2OA5 A;  4JI2 T;  5L3G B;  1LVK A;  3N2G E;  2CWO A;  3T1H T;  2W4X A;  3AAA B;  4QX7 B;  2CLY C;  2HHH T;  3P7I A;  3PUX F;  4HFD A;  2DLR A;  3AXJ B;  2W66 A;  4WBO A;  1ZP0 A;  2VB6 A;  5FXZ A;  4ILB A;  4U31 A;  4IDZ A;  4G63 A;  3FXE B;  2EHO A;  2CMR A;  3EAB A;  3ETU A;  1MMG A;  4HFI A;  4PJM A;  2NTX A;  2LEH A;  3RIF A;  4I50 E;  4QHO A;  5H6Q B;  3PUS A;  4DUY T;  4TZ4 C;  2E5V A;  2BDE A;  3RYC E;  5AQO B;  1R8I A;  2CRB A;  3VHL A;  4P0B A;  2DCF A;  2Q9Q D;  2LM2 A;  4H63 H;  3PUA A;  5LXT E;  2JMH A;  1YXR A;  2KZ7 B;  3IF8 B;  2W63 A;  5AQV B;  2MTQ A;  4AQF A;  3NVO A;  1NEK A;  2VWA A;  2K3W A;  4O8S A;  4X1I E;  2LSG A;  2VK9 A;  3TLW A;  4Z8X A;  4EYU A;  4HFH A;  2YK0 A;  5HEO A;  1U5P A;  5AQG B;  1H7C A;  3KIN B;  3UUX B;  2W00 A;  2DWG A;  2V1D B;  5FL1 A;  4Z90 A;  3QC9 A;  3UUM A;  3RIU C;  3PE0 A;  1YW0 A;  4I43 B;  3LK2 B;  1WYB A;  2ZMA A;  2LT3 A;  1L0V A;  3IHR A;  5CFB A;  1LKX A;  4P09 A;  1MMD A;  3C4X A;  4JI8 T;  2LRL A;  2NTY A;  5IWA T;  3P8C D;  3AE1 A;  4TV9 E;  2VKD A;  2JQ9 A;  4ZEY A;  3PUV F;  3OYZ A;  1D0Y A;  1NEN A;  4I0U A;  4V1A v;  1KNZ A;  4IHJ E;  2BVM A;  3UQ4 A;  3C98 B;  3EI0 A;  2H7O A;  3KBT A;  4WZX A;  3N9P A;  5LG4 A;  2X0Y A;  2H7V C;  2CXF A;  3FBL A;  2W0G A;  3PUQ A;  5GON E;  3OPC A;  1CHU A;  4UVB B;  3I9W A;  2V6Y B;  4QH5 A;  4UEM A;  3O1I A;  4OK0 A;  4EZH A;  4Z91 A;  1WCR A;  4LMK A;  3MA9 A;  2W67 A;  3CX7 B;  5JRC B;  4AKH A;  2V5D A;  3CIR A;  3MK7 C;  4X1Y E;  4IE0 A;  1QUU A;  3AA1 B;  2KMF A;  5ABH A;  3SWH A;  3E08 A;  4IDO A;  5AQL B;  2LLY A;  1LVF A;  2V7M A;  4CN6 A;  3KV5 A;  4NIQ A;  2UXD T;  2MAW A;  4DO0 A;  1IZN B;  2K48 A;  4LMJ A;  2LOP A;  3HKD E;  2V6Y A;  4H9Q C;  2YIN A;  3WI3 A;  2IML A;  5LA6 E;  1XDO A;  2DWK A;  4LF9 T;  2BG9 E;  5JRC A;  3OVU A;  3AE6 A;  2WWV A;  1Y64 B;  2XAG B;  4DV6 T;  3VKH A;  3R84 B;  2H3R A;  2YDS A;  3WAK A;  2BS4 A;  3FB2 A;  4NXM T;  3HL6 A;  1G73 A;  3M65 A;  4ZOL E;  1Y01 A;  2R6G F;  2VKJ A;  2WDV A;  3G06 A;  1I94 T;  3N5L A;  4UEL A;  2CPT A;  3L3P A;  1QLB A;  2UXB T;  1Z8U A;  2BG9 C;  4UXN B;  3NBX X;  5LBM A;  2CXL A;  2XAQ B;  5TAO A;  2WU2 A;  2KND A;  1GQE A;  3UUL A;  4JEH B;  2QGS A;  5ADX L;  2Y8D A;  2J1D G;  4L5G A;  4AKG A;  2M67 A;  2N9D A;  3PUR A;  1XNR T;  2W2U A;  3RC8 A;  2HN2 A;  3C64 A;  4ILU A;  5M4Y A;  4HWF A;  1ZHC A;  3RIA A;  3UU3 A;  4IRE A;  3AE5 A;  4XZC A;  3BK9 A;  1W09 A;  2V7L A;  2WB5 A;  5HXS A;  1XNQ T;  5HCM A;  4AKI A;  2I0M A;  4DND A;  5HEH A;  4IE4 A;  4J2C A;  5BR8 T;  2ES0 A;  3AVS A;  4JLE A;  3P4P A;  1WFD A;  3C50 A;  4L0R A;  4HE8 A;  4PJN A;  2ZM6 T;  4KHP T;  1UGO A;  4OFZ A;  2BS3 A;  2YDQ A;  4LF6 T;  3P50 A;  4H9N C;  1V9D A;  4B3R T;  4IIJ E;  2NWB A;  3MAC A;  2BG9 B;  2A72 A;  3N9Q A;  1OED B;  3U78 A;  2BKP A;  2RA1 A;  4GIW A;  3AEA A;  5AQM B;  3NKZ A;  2JJ9 A;  4TN7 B;  4GYR A;  2VUR A;  2EHO C;  4MLK A;  3A5X A;  1WRD A;  2VAS A;  4YSZ A;  2V26 A;  4PJJ A;  4CN4 A;  5H6R B;  1JNR A;  3QUJ A;  4COF A;  3FZM B;  2YU2 A;  4JEU B;  4MBQ A;  4DBQ A;  3ZYM A;  4KUM B;  2XTL A;  2X68 A;  1T8B A;  3VRA A;  1O3X A;  1OED A;  4UF0 B;  4CI1 B;  4X1K E;  3LK3 B;  5AQT B;  5C8Y E;  4X20 E;  4EYY R;  3H37 A;  4XBF B;  2IC9 A;  4F8H A;  3HI2 A;  4HFE A;  4OHF A;  4CZZ B;  1MIV A;  2OV9 A;  3JAF A;  3QB5 K;  1D1C A;  4KP3 C;  4DVD A;  2NW8 A;  3K8P C;  3P4S A;  5AQH B;  4AKL A;  3KV9 A;  5L4E A;  5E0O A;  5C2T A;  2X67 A;  4YSX A;  5JDN A;  4AQF C;  1ZOY A;  5AQU B;  2Z6E A;  3ZEF B;  4DV3 T;  1YKE B;  4UF0 A;  4B3S T;  2CE7 A;  2LJL A;  5DAB A;  4DUZ T;  4O4L E;  3NRY A;  1ZEE A;  4QXB B;  4UVC B;  3GMI A;  5ABF A;  1J5E T;  5L3E B;  3P4W A;  1ZKE A;  2XSA A;  2VL0 A;  1HX1 B;  3RKG A;  4BJM A;  4PFP A;  2C5K T;  3K1S A;  3ZMS B;  5LHG B;  4UV9 B;  3RGL A;  5KXJ A;  4ZHQ E;  5LJN A;  5BMV E;  4WYV A;  1HS7 A;  2QVA A;  4U7I A;  2WCA A;  4JI0 T;  5LBQ B;  4X64 T;  5FYM A;  1VRB A;  4HGA A;  2SPC A;  1UUR A;  2KIN B;  2RPA A;  5EK4 A;  2QYW A;  2JQQ A;  3H3M A;  4NUU A;  4EZ4 A;  1M7K A;  4O2A E;  5AQJ B;  2WAU A;  4X5T A;  5EZY E;  5HWX A;  4IST A;  3JAE A;  4IDP A;  5FXX A;  3JC6 C;  3CK6 A;  2FJB A;  3VKG A;  1J5W A;  2BBH A;  3RH3 A;  4YLH A;  1UK5 A;  1US7 B;  2DI4 A;  3I0O A;  1KNP A;  3EDV A;  2L8K A;  3QK6 A;  4H9R C;  1W0B A;  1AJ3 A;  2Q9Q A;  1HF8 A;  5AFU L;  3AVR A;  1YD8 G;  5J0Z A;  2D5U A;  4GK5 E;  3RYH E;  2WP9 A;  2ZM2 A;  1N32 T;  5JR9 A;  5F3J A;  4LF4 T;  3UFE A;  2EHO D;  1N33 T;  4LFB T;  2IIU A;  3PUW F;  3Q9D A;  3PV0 F;  1HG2 A;  3KBU A;  1X79 A;  3CML A;  2CBJ A;  3F2E A;  4DV0 T;  5FVL A;  4YTM A;  3RHW A;  4CXW A;  1MMN A;  4CXY A;  3P4R A;  1U4Q A;  3WAJ A;  2N1G A;  1N36 T;  3O1J A;  3D0T A;  4HFC A;  1E1H B;  3AEE A;  3LBX A;  3Q5W A;  4UIG A;  1OXZ A;  4LF7 T;  1WLX A;  3CQC B;  2BKN A;  4M1P A;  4U2Z A;  2ZLY A;  3Q5E A;  2X9Y A;  2WDQ A;  3TLT A;  2DHR A;  2KXP B;  3MKD A;  2MBG A;  4DR2 T;  5JH7 E;  4JI5 T;  2XQ6 A;  4MFR A;  1WR6 A;  2LRK A;  2ZM0 A;  2V5C A;  2CEA A;  2CXD A;  4ZI3 C;  5LOV E;  3ZKR A;  2XAF B;  2Y48 B;  2XHE B;  1WR0 A;  3NZQ A;  1JNZ A;  5L3F B;  3AEG A;  2E9X B;  1EZ3 A;  2LKH A;  3R6N A;  4ZXL A;  2YOE A;  1MND A;  2V7J A;  1FMV A;  4DR3 T;  5KMG P;  2WM9 A;  1T7S A;  2WSS V;  3JCF A;  2OLT A;  4YJ2 E;  4E7S A;  4HWH A;  5LJM A;  4DR6 T;  4CXX A;  5HWY A;  5LGN B;  3UT5 E;  4EAH A;  3ZYL A;  2JRK A;  4A5X A;  4DV1 T;  2E9X A;  2WZH A;  4ZI2 C;  2XSB A;  2LOS A;  3MZK B;  3HKC E;  2CHO A;  4E7Z A;  4B3M T;  2NP9 A;  3ZN0 B;  1VCS A;  4A56 A;  5IUX A;  1YKH B;  2NW7 A;  2PFV A;  3CVR A;  1IJ6 A;  3JC6 D;  4NUV A;  4H9P C;  3ZMU B;  3ONJ A;  2LSK A;  2JMK A;  3X1D A;  4TWF A;  5CJ5 A;  4BJN A;  4LML A;  5IYZ E;  4FJO A;  1HR0 T;  4OYK A;  1FIO A;  2D0T A;  5L3B B;  2IC6 A;  4GK0 E;  2LSJ A;  5CA0 E;  2W62 A;  4QH4 A;  3HKB E;  2J62 A;  1XWM A;  1BR0 A;  1E7P A;  1MIW A;  1QSD A;  2YN6 A;  2HN1 A;  5JDF A;  1KFY A;  2WMN A;  4TX5 A;  2BVL A;  4IGU A;  5CB4 E;  1MNE A;  1OED E;  3GA8 A;  4ERR A;  4ASK A;  2UUA T;  2XQ5 A;  4YTN A;  4WW0 A;  4GOU A;  2MPK A;  1IAP A;  2ACZ A;  2XM2 A;  3HKE E;  4P1N A;  4EGW A;  1UX5 A;  3ONL C;  5LMU T;  3QNU A;  4CN1 A;  4EEB A;  2YDR A;  3OBV E;  5HAX A;  4GYS A;  3I0Q A;  2LHR A;  4IL4 A;  1IBM T;  3ZYK A;  4TNV A;  5DQW A;  1MMA A;  1OED C;  4MHC A;  2LSY A;  4QXH B;  2IHR 1;  5AQS B;  2DNX A;  3ZN1 B;  5FXW A;  1IJ5 A;  3AE7 A;  3ZSS A;  3OKQ A;  4ZI3 D;  4BAY B;  2A3D A;  5FY0 A;  3VR8 A;  5J1G A;  5F5W A;  3Q5X A;  2K5B B;  3CWZ B;  4WNK A;  5HYA A;  4KMC A;  2PJQ A;  1LRZ A;  3UUN A;  3B13 A;  4LFC T;  1ZV4 X;  4ILC A;  3GN5 B;  4U7Y A;  3FZF B;  1NAF A;  4IT4 A;  4JI1 T;  2IW5 B;  4X65 T;  3B57 A;  4Q25 A;  3ZPO A;  5JDL A;  3ONX A;  1XMO T;  4HWD A;  5ABG A;  2XQ4 A;  5HCJ A;  4IDN A;  2CHN A;  3V5U A;  3RQU A;  3VRB A;  4PW8 A;  4QKN A;  4CQI A;  4KBM B;  3N9N A;  4DV4 T;  4U2Y A;  4ZI2 D;  2MYS A;  1DU2 A;  1D0Z A;  3M3Z B;  3GN5 A;  3CQX C;  4DMV A;  2UXC T;  2FJE A;  5JDG A;  2I59 A;  4AIU A;  3ZMV B;  3UQ7 A;  4DR7 T;  2WQY A;  3OYX A;  5HEU A;  4UR9 A;  2M6I A;  4PNI A;  3U3I A;  4IDQ A;  2WY2 A;  2XJ7 A;  5HXE A;  1MIY A;  3C51 A;  3RYI E;  2D2S A;  2C5I T;  2VKH A;  2E5L T;  3J9X 1;  1HNZ T;  3N2O A;  2KSR A;  1S35 A;  2E2A A;  3L09 A;  3LJC A;  2LE8 A;  5C3J A;  3KFW X;  2H88 A;  2BKO A;  2A2F X;  2V7I A;  4DR5 T;  3IEE A;  2DL1 A;  3AE4 A;  5F8P A;  3H3A A;  5LHH B;  3EUH A;  4A98 A;  2NR4 A;  3EDU A;  2HPL A;  4HWI B;  2MOZ A;  3Q5D A;  3LFM A;  4KX6 A;  3EAM A;  2WS3 A;  4I55 E;  5ABF B;  4FI5 A;  2XZE A;  4ZZC A;  5FKY A;  4H63 V;  2BS2 A;  5FY1 A;  3SS1 A;  4PFO A;  1KF6 A;  4AKR B;  1D1B A;  2X51 A;  2XM1 A;  4DMW A;  1KEY A;  3UTK A;  4JI4 T;  2KT9 A;  3TLV A;  1T98 A;  1T72 A;  2WWU A;  5AQR B;  1WYC A;  3VU7 H;  2V8S V;  4PAG A;  2D0U A;  3CPZ A;  4EB6 E;  5EK3 A;  2V7K A;  2VQF T;  2XAH B;  4AQG A;  4IL9 A;  4DR1 T;  2WZI A;  1G8X A;  2UXX B;  4IE6 A;  3RI5 A;  5JTG A;  1BR4 A;  2L9Q A;  5L2L A;  1OWA A;  1J1J A;  3K3O A;  2KWH A;  2PTF A;  3UU4 A;  1HG5 A;  1HX8 A;  2Q9Q B;  2JQK A;  3LSV A;  1FJG T;  4PJL A;  1UUS A;  2NOX A;  3A8Y C;  4AXP A;  4QX8 B;  4DV5 T;  3AE8 A;  5FVK A;  1IBL T;  5JR9 B;  4U33 A;  4IE7 A;  3RLF F;  2FJA A;  3UU5 A;  4HN9 A;  5LGT B;  5HXC A;  3AA7 B;  2X9W A;  5JDM A;  1SE7 A;  1HTJ F;  3IBP A;  4DV2 T;  3NWI A;  2JPF A;  4ZS2 A;  3T1Y T;  4YHJ A;  3OTO T;  1FEW A;  2XQ7 A;  2IUB A;  2E9X C;  3PTR B;  3LBX B;  2X66 A;  3L8R A;  3BQL A;  1SHZ C;  3PU8 A;  2X0H A;  2J47 A;  5L3D B;  2FBW A;  2PG8 A;  3AXJ A;  2I6H A;  3MXZ A;  4L9I A;  3NZP A;  4YTP A;  3UFG A;  5LGU B;  3ANW B;  3RPU A;  1SUM B;  5J2T E;  3AEB A;  4OYJ A;  3AA0 B;  3LK4 2;  3KV6 A;  3EVY A;  2RP4 A;  2A9U A;  3FZH B;  5A1L A;  2V6X A;  2GK9 A;  2JIW A;  5CA1 E;  3PU3 A;  4PK6 A;  5JRE A;  4QXC B;  4MAL A;  3AB3 B;  1I6Z A;  3KVB A;  4C90 A;  3SRZ A;  3DJB A;  4AIS A;  4AQY T;  2XQ3 A;  3O4X E;  3QOF A;  4G2A A;  4LFA T;  2F4V T;  4TWH A;  2CLY B;  3RQW A;  3LG7 A;  5FL0 A;  2C5J A;  2ZM8 A;  3ANW A;  4YT0 A;  3AAI A;  4XAX B;  2FUP A;  5LNK A;  3B5M A;  4U3C A;  4QWN B;  5AQK B;  3I1A A;  5LG3 A;  3RX6 A;  4O4H E;  3AE3 A;  2XQ9 A;  1SA0 E;  3E22 E;  2YEV C;  2VQE T;  3ESL A;  3IA3 A;  2XY8 B;  4O4J E;  4TV8 E;  3AED A;  5KX5 E;  4OX9 T;  3ZT5 A;  2B1E A;  1VCT A;  5FP3 A;  1KNR A;  2M6B A;  4QH1 A;  4X62 T;  4ZZB A;  3ABV A;  4YFS A;  3PUG A;  1UX4 A;  5FY7 A;  2UUB T;  2JQH A;  4H9O C;  1IBK T;  2UUC T;  3RYF E;  3JAD A;  1CUN A;  3PJA A;  5DQV A;  5AQP B;  2NW9 A;  3P4Q A;  1HCI A;  2QA7 A;  1FMW A;  3FHN A;  4ISS A;  1W0A A;  3UU8 A;  2P9B A;  4JI3 T;  2LM9 A;  3AEC A;  4DV7 T;  3OJA A;  5CGM A;  3DTO A;  1B7T A;  3N9M A;  3RKO A;  3PDY A;  3RC3 A;  5AQQ B;  2WBL A;  3N2K E;  3V5S A;  3AA6 B;  5AQF B;  4HFV A;  4HWC A;  5LB7 B;  4P0A A;  3AAE B;  3CQG B;  3RRW A;  4JUY A;  1HFA A;  2IDO B;  4CI2 B;  4YY3 T;  4PK4 A;  3FXD B;  5ETW A;  1XDP A;  5IHY A;  1X9B A; 
#chains in the Genus database with same CATH homology
 2MTQ A;  2CE7 A;  5JDL A;  3ONX A;  2LJL A;  5DAB A;  4AQF A;  5EK2 A;  2XAJ B;  4O2B E;  1D0X A;  2HH7 A;  2E9X D;  2VWA A;  2ODU A;  3BQK A;  3NRY A;  4O4L E;  4O8S A;  1ZEE A;  3C4W A;  4QXB B;  2LSG A;  4X1I E;  2IAK A;  4UVC B;  2VK9 A;  3V5U A;  3J7Y q;  4IE5 A;  4U72 A;  2XQY A;  4PW8 A;  4QKN A;  4CQI A;  4KBM B;  4Z8X A;  3N9N A;  4EYU A;  2XUE A;  3GMI A;  4ZI2 D;  4O4I E;  5FMN A;  5L3E B;  1ZKE A;  3ZMT B;  2YK0 A;  2MYS A;  1U5P A;  1D0Z A;  4BJM A;  4PFP A;  2C5K T;  3GN5 A;  4UV8 B;  1H7C A;  3ZMS B;  3CQX C;  4DMV A;  5LHG B;  1BR1 A;  3KIN B;  4UV9 B;  5JDG A;  4EIW A;  4ZHQ E;  2I59 A;  5BMV E;  5LJN A;  3ZMV B;  3UUX B;  1HS7 A;  4F6R C;  2W00 A;  2DWG A;  3OYX A;  2V1D B;  5LBQ B;  3E0Z A;  4PNI A;  3U3I A;  5FYM A;  2CWY A;  4ZI7 E;  1VRB A;  3QC9 A;  4N78 D;  4HGA A;  5HXE A;  4H9S E;  3UUM A;  1MIY A;  3C51 A;  3PE0 A;  1YW0 A;  2SPC A;  3NRX A;  4I43 B;  5LYJ E;  3LK2 B;  3RYI E;  1WYB A;  2ZMA A;  2D2S A;  2KIN B;  2C5I T;  2VKH A;  3CX6 B;  5EK4 A;  3J9X 1;  2LT3 A;  2C0S A;  2JQQ A;  3K3Q C;  3ZC0 A;  3N2O A;  1S35 A;  3C4Z A;  3IHR A;  4NUU A;  4EZ4 A;  3O9X A;  4O2A E;  2WAU A;  3L09 A;  3LJC A;  5EZY E;  5HWX A;  2LE8 A;  4IST A;  1LKX A;  4P09 A;  5JQG E;  1MMD A;  3KFW X;  5FXX A;  3C4X A;  3JC6 C;  2N2N A;  4AI6 A;  2NTY A;  3VKG A;  2A2F X;  2V7I A;  3P8C D;  3IEE A;  3KVA A;  3DP7 A;  4YLH A;  4TV9 E;  3RH3 A;  1US7 B;  2VKD A;  2DI4 A;  3HA4 A;  3I0O A;  3OYZ A;  5F8P A;  3H3A A;  5LHH B;  1D0Y A;  3EUH A;  3EDV A;  2L8K A;  4V1A v;  2LHN A;  3QK6 A;  1KNZ A;  4IHJ E;  2XAS B;  4H9R C;  3EDU A;  2Q9Q A;  1AJ3 A;  2BVM A;  2HPL A;  3C98 B;  1HF8 A;  5AFU L;  5JDQ A;  3CKD A;  3AVR A;  2H7O A;  1YD8 G;  3KBT A;  3ZCI A;  4UVA B;  2MOZ A;  3N9L A;  2D5U A;  4GK5 E;  3T8O A;  3N9P A;  3O1H A;  3RYH E;  5LG4 A;  2H7V C;  3LFM A;  4WBN E;  1KK7 A;  2ZM2 A;  3ZLI A;  2CM0 A;  2CXF A;  3FBL A;  3TKL B;  2CA5 A;  4I55 E;  2W0G A;  3PUQ A;  5GON E;  5JR9 A;  4FI5 A;  5F3J A;  3UFE A;  2EHO D;  4H63 V;  4UVB B;  5LHI B;  2K24 A;  5FY1 A;  3Q9D A;  1HG2 A;  3KBU A;  1X79 A;  3CML A;  3F2E A;  3SS1 A;  3I9W A;  4PFO A;  3GWH A;  4AKR B;  4UEM A;  3O1I A;  4CXW A;  1MMN A;  4OK0 A;  4EZH A;  4HTE A;  4CXY A;  1D1B A;  3ZMZ B;  2X51 A;  3MA9 A;  1U4Q A;  3ZPO A;  4DMW A;  3CX7 B;  3WAJ A;  5JRC B;  4AKH A;  3UTK A;  2N1G A;  3MK7 C;  2KT9 A;  4X1Y E;  4IE0 A;  1T98 A;  3O1J A;  3D0T A;  1E1H B;  1QUU A;  2WWU A;  3VU7 H;  1WYC A;  4PAG A;  3W15 B;  3AA1 B;  3LBX A;  2D0U A;  3Q5W A;  5DJQ C;  2KMF A;  4UIG A;  3FBZ A;  1OXZ A;  4TUY E;  4EXT A;  1WLX A;  3CQC B;  4M1P A;  1VOM A;  3CPZ A;  5J2U E;  3SWH A;  5EK3 A;  2V7K A;  2XAH B;  2ZLY A;  4AQG A;  4EB6 E;  3E08 A;  2X9Y A;  1S94 A;  2DHR A;  2KXP B;  1G8X A;  2UXX B;  3MKD A;  3ZJ1 A;  1LVF A;  2V7M A;  1UCU A;  4IE6 A;  2MBG A;  3KV5 A;  2X0L B;  4DO0 A;  1BR4 A;  2UXN B;  2L9Q A;  5JH7 E;  5L2L A;  1IZN B;  2K48 A;  1OWA A;  2LOP A;  3HKD E;  3KDS E;  4H9Q C;  3K3O A;  2KWH A;  2YIN A;  1WR6 A;  4MFR A;  3KV4 A;  1HG5 A;  3WI3 A;  1HX8 A;  5LA6 E;  2ZM0 A;  2Q9Q B;  3MJX A;  2DWK A;  2CEA A;  3Q2M A;  4PJL A;  5JRC A;  5FXV A;  2CXD A;  1Y64 B;  4ZI3 C;  4BA9 A;  5LOV E;  3ZC1 A;  2XAG B;  2NOX A;  2VL8 A;  2XAF B;  5KDM C;  4AXP A;  4QX8 B;  4U74 A;  3VKH A;  3R84 B;  2Y48 B;  2XHE B;  2H3R A;  3WAK A;  3FB2 A;  3NZQ A;  5JR9 B;  5L3F B;  2E9X B;  1EZ3 A;  2G0U A;  4IE7 A;  4HN9 A;  3HL6 A;  3R6N A;  1G73 A;  3M65 A;  5LGT B;  5HXC A;  3AA7 B;  4ZOL E;  1NWM X;  2YU1 A;  3I9Y A;  5HXH A;  2VKJ A;  2W61 A;  2Q9Q C;  2X9W A;  3RRC A;  3BQI A;  5JDM A;  1HTJ F;  1MND A;  2V7J A;  3IBP A;  1FMV A;  5KMG P;  2WM9 A;  2WMO A;  3N5L A;  2WSS V;  3HR0 A;  4UEL A;  3CX8 B;  3L3P A;  4YJ2 E;  4E7S A;  4ZS3 A;  4EOZ B;  5LJM A;  2JPF A;  5HXR A;  4ZS2 A;  5L3C B;  4CXX A;  1BR2 A;  4YHJ A;  5HWY A;  1FEW A;  4UXN B;  5LGN B;  3NBX X;  2CCQ A;  3UT5 E;  5LBM A;  3ETV A;  4HKA A;  5JR9 C;  2CXL A;  3K3N A;  2E9X C;  4EAH A;  3ZYL A;  2XAQ B;  3PTR B;  3LBX B;  2JRK A;  5TAO A;  2X66 A;  3BQL A;  1SHZ C;  3PU8 A;  2KND A;  3UUL A;  2E9X A;  4JEH B;  4ZI2 C;  2QGS A;  5L3D B;  2LOS A;  5ADX L;  2Y8D A;  2PG8 A;  2J1D G;  3MZK B;  3HKC E;  4L5G A;  2K9A A;  3MXZ A;  4L9I A;  2NP9 A;  4E7Z A;  4AKG A;  3NZP A;  3ZN0 B;  2M67 A;  2BZB A;  5LGU B;  3ZJ2 A;  4A56 A;  2N9D A;  3PUR A;  3ANW B;  1YKH B;  4K0U A;  3S4U A;  3RPU A;  5J2T E;  3RC8 A;  2NW7 A;  3C64 A;  2ACX A;  3AA0 B;  2ODV A;  3LK4 2;  3KV6 A;  4ILU A;  2PFV A;  3CVR A;  3EVY A;  4OYJ A;  5LCY A;  5M4Y A;  1IJ6 A;  3JC6 D;  4NUV A;  4C91 A;  2L3L A;  4H9P C;  2HPJ A;  2RP4 A;  5A1L A;  2Y6X A;  3ZMU B;  3F31 A;  4YJ3 E;  2GK9 A;  1ZHC A;  2KLQ A;  4CI3 B;  4DBR A;  5CA1 E;  3PU3 A;  1Z0P A;  4PK6 A;  5JRE A;  2PBI A;  2LSK A;  4QXC B;  2JMK A;  4MAL A;  3AB3 B;  3KVB A;  4XZC A;  3F57 A;  4ADZ A;  3BK9 A;  4C90 A;  4BJN A;  5IYZ E;  3SRZ A;  3SOL A;  3DJB A;  4FJO A;  4PK5 A;  2V7L A;  2KWI B;  5HXS A;  4AKI A;  2X9H A;  3ZCJ A;  4B6X A;  2LSI A;  4OYK A;  2VKO A;  1FIO A;  2D0T A;  3O4X E;  4DND A;  4G2A A;  5L3B B;  2X9X A;  4IE4 A;  2IC6 A;  5FNV E;  4GK0 E;  2CLY B;  2LSJ A;  2W62 A;  3LG7 A;  4J2C A;  5CA0 E;  5JDH A;  2C5J A;  2ZM8 A;  3ANW A;  2ES0 A;  3AVS A;  1D1A A;  3HKB E;  3AAI A;  4JLE A;  1BR0 A;  4XAX B;  5LNK A;  1MIW A;  3C50 A;  4L0R A;  4HE8 A;  4PJN A;  5JVD E;  4ANJ A;  1QSD A;  4QWN B;  5JDF A;  2EHO B;  3N9O A;  4OFZ A;  4I4T E;  3I1A A;  3RX6 A;  4O4H E;  2WMN A;  5LP6 E;  4TX5 A;  4HEA A;  2BVL A;  1SA0 E;  2E8I A;  4IGU A;  5CB4 E;  2OA5 A;  4H9N C;  3E22 E;  1V9D A;  1MNE A;  4IIJ E;  5L3G B;  1LVK A;  2YEV C;  2NWB A;  3ESL A;  3MAC A;  3N2G E;  4O4J E;  4TV8 E;  2CWO A;  5KX5 E;  3GA8 A;  4ERR A;  4ASK A;  2A72 A;  4QX7 B;  3AAA B;  2B1E A;  2CLY C;  5FP3 A;  3N9Q A;  3P7I A;  3U78 A;  2RA1 A;  4GIW A;  4WW0 A;  2DLR A;  4WBO A;  4YFS A;  4GOU A;  3PUG A;  2JJ9 A;  4TN7 B;  1UX4 A;  4GYR A;  1IAP A;  2VB6 A;  2EHO C;  5FY7 A;  5FXZ A;  4MLK A;  3HKE E;  4IDZ A;  4H9O C;  4G63 A;  3A5X A;  1WRD A;  1UX5 A;  3FXE B;  2VAS A;  3RYF E;  2EHO A;  2V26 A;  4PJJ A;  1CUN A;  2CMR A;  3OBV E;  5DQV A;  2NW9 A;  5H6R B;  5HAX A;  4GYS A;  3I0Q A;  2LHR A;  1HCI A;  3ETU A;  1MMG A;  3QUJ A;  2QA7 A;  3ZYK A;  1FMW A;  3FHN A;  4ISS A;  4PJM A;  2YU2 A;  4JEU B;  4MBQ A;  5DQW A;  2NTX A;  1MMA A;  4MHC A;  4DBQ A;  3ZYM A;  2LSY A;  4QXH B;  2P9B A;  4KUM B;  2DNX A;  2LEH A;  3ZN1 B;  2XTL A;  2X68 A;  5FXW A;  1IJ5 A;  2LM9 A;  4I50 E;  4QHO A;  5H6Q B;  1O3X A;  4UF0 B;  4CI1 B;  3OKQ A;  4X1K E;  4ZI3 D;  4BAY B;  3LK3 B;  3OJA A;  5C8Y E;  2A3D A;  4X20 E;  3PUS A;  4TZ4 C;  3DTO A;  5FY0 A;  4EYY R;  3H37 A;  2BDE A;  4XBF B;  1B7T A;  2IC9 A;  3N9M A;  5J1G A;  3RYC E;  3RKO A;  3PDY A;  3HI2 A;  3Q5X A;  4OHF A;  3RC3 A;  2K5B B;  4CZZ B;  1MIV A;  3CWZ B;  4WNK A;  5HYA A;  2WBL A;  3N2K E;  4KMC A;  3V5S A;  2PJQ A;  1LRZ A;  3UUN A;  3AA6 B;  3B13 A;  4HFV A;  3VHL A;  1D1C A;  1ZV4 X;  4KP3 C;  4P0B A;  3GN5 B;  2NW8 A;  4DVD A;  2DCF A;  3AAE B;  3CQG B;  2Q9Q D;  3K8P C;  4P0A A;  3RRW A;  4AKL A;  3KV9 A;  4JUY A;  5E0O A;  1HFA A;  4CI2 B;  2X67 A;  1NAF A;  4H63 H;  3PUA A;  5LXT E;  2JMH A;  4PK4 A;  4AQF C;  5JDN A;  3FXD B;  2IW5 B;  2KZ7 B;  3IF8 B;  5ETW A;  2Z6E A;  2W63 A;  3ZEF B;  3B57 A;  5IHY A;  1YKE B;  4UF0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...