4P0BA

Crystal structure of hoip pub domain in complex with otulin pim
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
173
structure length
169
Chain Sequence
b'EEERAFLVAREELASALRRDSGQAFSLEQLRPLLASSLPLAARYLQLDAARLVRCNAHGEPRNYLNTLSTALNILEKYGRNLLSPQRPRYWRGVKFNNPVFRSTVDAVQGGRDVLRLYGYTEELSFPEGQEEPDEHQVATVTLEVLLLRTELSLLLQNTHPRQQALEQL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E3 ubiquitin-protein ligase RNF31
molecule tags Ligase
source organism Homo sapiens
publication title Binding of OTULIN to the PUB domain of HOIP controls NF-kappa B signaling.
pubmed doi rcsb
total genus 49
structure length 169
sequence length 173
chains with identical sequence C
ec nomenclature ec 2.3.2.31: RBR-type E3 ubiquitin transferase.
pdb deposition date 2014-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09409 PUB PUB domain
A PF18486 PUB_1 PNGase/UBA- or UBX-containing domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.2190 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4p0bA00
4OYJA 2HPJA 2HPLA 5LJMA 5LJNA 2CCQA 4OYKA 4P09A 2CM0A 4P0BA 2D5UA 4JUYA 4P0AA
chains in the Genus database with same CATH superfamily
1CUNA 2E9XB 1VCSA 5EK2A 2WWUA 3E08A 3K3OA 4IDQA 3ZC0A 2VKJA 5L2LA 3WAJA 1JNRA 1XNRT 1WCRA 5F8PA 4ZI3C 2YOEA 4I43B 3W15B 4DR1T 2V6YA 3I0QA 2BS4A 2V1DB 3ONLC 2K5BB 2AE9A 3D0TA 4MBQA 3GMIA 2Y6XA 3BQLA 3PUXF 3RI5A 3UU8A 2XTLA 5LBMA 2BS3A 5FKYA 1LVFA 2WZHA 2YKSA 2NW8A 3N9PA 3V5SA 3ZT5A 3ONJA 3AA6B 3SFDA 2KLQA 4UIGA 2XAJB 1FEWA 1S94A 3OBVE 4YTMA 3VU7H 4I55E 5JR9B 3M3ZB 4GK0E 3L3PA 4EEBA 3IBPA 3ZPOA 4DV2T 2LSJA 4IE5A 2HHHT 4U2ZA 5L3FB 3RIUC 2BKPA 2E9XA 2WU5A 4I0UA 1VCTA 1YQ3A 2PG8A 2K9AA 3CIRA 2K3WA 2WDVA 1D0XA 3E0ZA 2FUPA 2W63A 3DTOA 4LMKA 4IHJE 4PK5A 3ESLA 2LT3A 2H7VC 3C64A 3QOFA 4OHFA 2PTFA 5JR9A 5IHYA 5LA6E 5A1LA 3UU6A 1G8XA 2HPLA 2JQQA 3N9QA 3WI3A 4TN7B 5AQJB 4HFBA 5JDMA 2VL8A 5KX5E 3RYHE 2IC6A 2YN6A 5DJQC 4AKLA 4ZHQE 2LHRA 1NENA 1AJ3A 3JAFA 5ABHA 1ZEEA 4IIJE 2M6BA 1QSDA 2JQHA 2W67A 4GYRA 4B3RT 3PUZF 3G06A 2BG9E 2IAKA 5IYZE 5ABEA 1Y01A 3CX7B 2ZM6T 2LSYA 2W00A 2WB5A 1M7KA 1WFDA 3J7Yq 2F4VT 2BVMA 2BBJA 2YU1A 5FL0A 2A2FX 4YHHT 1OWAA 5IUXA 1ZHCA 1BR1A 4ILUA 4JYAT 2PFVA 4KI0F 2X9XA 3OVUA 4JI4T 4V1Av 3T1HT 1X9BA 2W66A 3F2EA 1LVKA 3PJAA 3AXJB 5DQWA 5GONE 3GN5A 3KVBA 3RRCA 5FMNA 4DIDB 5HXHA 3AVRA 2WM9A 2UXNB 4U7IA 1HCIA 2UXBT 2VK9A 4U31A 5HAXA 3CKDA 4QXCB 4XAXB 3UT5E 2DCFA 4F8HA 1OEDB 3E22E 4AKGA 4PJLA 3UU5A 4HWDA 3RLFF 4A56A 4CN1A 2V7KA 2HH7A 3ZYKA 5JDGA 4LF8T 4QWNB 4AIUA 4DMVA 4Q25A 2X0YA 2NTXA 3KBUA 1HFAA 1YD8G 2WWVA 5ADXL 4NXMT 3PU8A 3PUAA 3OYXA 4HTEA 2EHOD 3LJCA 1KF6A 2FBWA 2X0HA 3MACA 2ODUA 4JUYA 5FXVA 3UFGA 3UUBA 4MALA 3ZT7A 3RPUA 1XDOA 2CBIA 2X9YA 4TV8E 4HFIA 4KUMB 5C3JA 2X0LB 3N2GE 1LKXA 2CM0A 3CQCB 3AEAA 3KINB 1KNPA 4IDOA 5HXEA 3EI0A 4KBMB 3N9LA 4PW8A 4UEMA 4UR9A 4IREA 4C91A 4IDNA 2VKHA 4CI2B 3RYIE 3ETVA 2WAUA 3LFMA 1IBLT 4JI7T 5AQNB 1HR0T 4YY3T 4HE8A 3B57A 1MNDA 4BAYB 4HFEA 2YK0A 4U3CA 3PUGA 3VR9A 5J2TE 2W4XA 4TWFA 4DV7T 4DVDA 2M67A 4AQFA 2J47A 5FYMA 2H3RA 3NRXA 4X65T 2WMOA 1L0VA 4KHZF 1UX5A 3AB3B 3EUHA 3JAEA 5L47A 2WSSV 4JI6T 3Q5EA 1HS7A 3LK3B 3WAKA 2X9HA 4LF4T 3Q5XA 4ASKA 2XY8B 2BG9C 3H3AA 3HL6A 2XJ7A 3UTKA 1T8BA 2UUBT 3ZSSA 2V26A 4ILCA 4JEHB 1W9RA 1JNZA 4ZS2A 3SFEA 1OEDA 4E7ZA 4YSXA 4AKHA 2FJBA 2H89A 2LOPA 5LYJE 5HWXA 3C4XA 2YEVC 5L4HA 1W0BA 2JPFA 3IA3A 3HKEE 3OPCA 2I59A 4IE6A 4WYVA 2XQ8A 3Q5WA 4TX5A 4HWFA 1T7SA 2ODVA 1XWMA 3P7IA 5CFBA 1XMOT 1N33T 2VVSA 5LCYA 4A5XA 3ZSTA 1VOMA 2BVLA 2V6XA 2LSKA 2WS3A 3CPZA 3ZKRA 3RIAA 4H9PC 4PFPA 2ACXA 5AQIB 5AQOB 5FY1A 5LGNB 2CXLA 2Q9QC 1Z0PA 2BKOA 1KNZA 3V5UA 1WLXA 3MZKB 4X20E 5JVDE 5TAOA 4P0AA 2C0SA 2XQ5A 3BK9A 1J5ET 3AA7B 4NIQA 3PUQA 2NP9A 2OLTA 2HN2A 2J62A 4Z91A 3HKDE 4IE4A 1HNZT 3IF8B 2XAGB 4PAGA 4ILAA 4M1PA 2LKGA 4GIWA 2KXPB 4JI0T 3HKBE 3UUMA 2LSIA 3FBLA 2FJDA 4UV8B 4AXPA 3ANWB 2E5LT 2YDQA 5LMUT 2XUEA 1H7CA 3NVOA 4G63A 4MFRA 2IC9A 3SOLA 3AA0B 4BJMA 4HFVA 4COFA 1IBMT 4AKIA 2VWAA 1FMWA 2RP4A 1CHUA 2CXFA 4KMCA 4QX8B 2YDRA 4UF0A 3ZYLA 4KHPT 2XQ9A 5JTGA 4AKRB 2CA5A 4YSYA 3GA8A 4KX6A 4P1NA 5LMNT 4DR5T 2L9QA 3K3NA 3PV0F 1I94T 1KK7A 4YSZA 4WBOA 4B3MT 2BBHA 4BJNA 2BG9A 2WZIA 4EGWA 3UQ7A 4JI3T 3RH3A 2C5JA 2IUBA 5HWYA 4YJ3E 3ZMTB 5JQGE 5LHIB 4DV5T 2K24A 4OX9T 1T72A 3NKZA 5F5WA 2E8IA 3ZCJA 3CQXC 4EZHA 3VKHA 5ETWA 5JDNA 5JDHA 2MAWA 2Q9QB 2D5UA 5FVKA 4X1KE 2WDRA 1UCUA 3RKGA 5HXCA 3AE3A 3RRWA 2XPKA 5LGUB 2FJAA 3CQGB 5LOVE 4GK5E 4ZI7E 5J2UE 1UURA 4L9IA 4JI1T 1HG5A 2FJEA 3AECA 1SUMB 3T1YT 2QVAA 5LHGB 1N36T 1EZ3A 4N78D 3AE2A 4U7YA 3HA4A 1YXRA 2GK9A 5JDQA 3VKGA 3LBXA 4ILBA 2MOZA 2JJ9A 2OV9A 2X68A 4QXBB 2W61A 3C4ZA 2J1DG 3ETUA 3L09A 3ZYMA 4ZZCA 2NTYA 3PUWF 4IT4A 3TLWA 4MHCA 3Q2MA 5KMGP 1XNQT 2LOSA 3FZMB 1MIWA 4O4IE 2DWGA 5LGTB 2V7LA 3R6NA 3P4RA 3PUVF 5CGMA 3QB5A 1BR4A 2ZM0A 5HCMA 3ZC1A 4GYSA 3BQKA 2KT9A 4UVCB 3NZPA 3IHRA 4GKJT 2WMNA 5AQGB 2YU2A 4DR2T 2BZBA 4IE7A 3ZLIA 1S35A 1UX4A 3O1HA 3I9YA 4P0BA 2KMFA 4ZI2D 2XAFB 2JMHA 3JC6D 2CHNA 1X79A 3PDYA 3PUYF 4AI6A 2H88A 2N9DA 4OYKA 4YLHA 5AQLB 1N34T 4CN4A 4LFCT 4H9NC 5HEJA 1E7PA 2IMLA 4ZZBA 3NWIA 3C98B 1OXZA 2NOXA 1WR6A 3FBZA 3GWHA 3I0OA 3RGLA 2BG9B 4YXDA 4DV4T 2VL0A 3AA1B 2DWKA 2OA5A 3UQ4A 3BQIA 5AQHB 5BMVE 2XM1A 3ZMSB 5AQQB 5HCJA 4FI5A 5KXJA 5HXSA 1MNEA 1QUUA 1XZYA 2A72A 2EHOC 2XQ4A 3AE9A 3AEFA 3FZFB 3O1IA 3PJAJ 4KP3C 4NUVA 2VKOA 1KNRA 4ERRA 3UU3A 4UV9B 4Z90A 5F3JA 3KV9A 4U33A 1NAFA 1Y64B 4OYJA 4U2YA 4C90A 1NEKA 2N1GA 2V6YB 4U74A 3JADA 5EK3A 5CA1E 1YQ4A 3OJAA 2JQ9A 3L8RA 5L4EA 3ZMZB 4DR4T 3LBXB 2XHEB 1ZV4X 5ABFB 2DL1A 4MLKA 4TV9E 3ABVA 2KNDA 2KWHA 2MYSA 2V7IA 3P8CD 3UFEA 5L3BB 3NBXX 4O4JE 1SA0E 4WZXA 1IZNB 3A8YC 4O4LE 4JLEA 4I4TE 2Z6EA 3I1AA 1UK5A 2CE7A 5HEHA 3VR8A 4HFCA 5JDLA 4QXHB 3RC8A 4J2CA 4OK0A 4GKKT 1IAPA 2RA1A 4IL4A 4EEDA 4PJNA 4Z8XA 3AVSA 2XSAA 4NPPA 2Q9QA 2CBJA 2M6IA 2E5VA 4L0RA 2XAHB 2UU9T 1B7TA 5LBQB 3AAIA 5J0ZA 2XQ7A 3FXEB 3J9X1 4EYYR 3HI2A 3ZEFB 2IIUA 4DMWA 5M4YA 3RYFE 4ZS3A 2LKHA 2UUCT 4PK6A 5DQVA 3C4WA 4HEAA 4DR3T 1HF8A 4XBFB 2LRKA 2X67A 2D9DA 1ZP0A 3CMLA 3EDUA 3FZLB 3PE0A 4FJOA 4UF0B 5FVLA 3P50A 5LB7B 3SS1A 4AQYT 3Q9DA 2C5IT 3AE7A 2V7JA 3C51A 5H6QB 3TLTA 4AQFC 2CRBA 3RF1A 1NWMX 3OTOT 2A9UA 1IJ6A 5L3GB 4JV5T 2LRLA 2V7MA 2CLYC 4H63H 3VRAA 3B5MA 1YW0A 3ZN0B 4H9RC 2MTQA 2VVNA 5LJNA 5FXXA 3HKCE 4OFZA 2W2UA 4ZOLE 2BDEA 2WCAA 3ZJ1A 4ZI2C 4LFAT 4IE0A 4ZI3D 3RKOA 5AQSB 3CK6A 4CXWA 3NZQA 4O2BE 2Y8DA 3SWHA 5FP3A 3AE5A 3N2KE 2MBGA 4DBRA 1ZOYA 2ES0A 1I6ZA 2VQET 1BR2A 1HG2A 3KBTA 4H63V 5CB4E 1KFYA 4CXYA 2A3DA 2WDQA 2JRKA 2LLYA 2W62A 1WYCA 5H6RB 4H9SE 4DV0T 4U72A 4HFHA 1SE7A 2MPKA 4P09A 2W0GA 3OYZA 4H9OC 5AQKB 4JEUB 1US7B 2E9XC 3TLVA 2I0MA 3AAAB 2CEAA 3IEEA 5IWAT 2ACZA 1HX1B 4IGUA 4K0UA 1D0YA 4LFBT 1SHZC 2K48A 1UUSA 2JQKA 2CLYB 2L3LA 4JI5T 3TKLB 1HNWT 2JMKA 2XQ3A 2UUAT 2CWYA 5C2TA 4JBWF 4ISTA 2LM9A 2V5DA 2KINB 3MJXA 5J1GA 5ABGA 4YT0A 5KDMC 2LEHA 2QYWA 3O1JA 5HEGA 4QKNA 4X64T 3CX8B 3EAMA 1MMAA 2XM2A 4CN6A 4DNDA 2E9XD 4AISA 2CXDA 1W09A 3X1DA 2D2SA 2WQYA 3RQWA 3P4PA 4DV1T 5AQTB 2CWOA 2ZMAA 3AXJA 4HN9A 3RHWA 3LSVA 1E1HB 3TLUA 3ZT6A 3MA9A 4F6RC 4X5TA 5LHHB 3FZKB 1HTJF 4JI8T 2IHR1 3LK42 1DU2A 2X9WA 2H7OA 3AEEA 4PNIA 2HN1A 3B13A 2KWIB 4PK4A 4CI1B 5HXRA 3F31A 3RYCE 1V9DA 1T98A 5AQUB 3PUSA 5ABFA 1HNXT 1OEDC 3Q5DA 1G73A 2XQ6A 2QA7A 2VB6A 3CX6B 1WYBA 3ZN1B 3UU4A 4DV3T 3EVYA 4LF9T 1N32T 4EOZB 3FHNA 4DUYT 3O9XA 5FNVE 3EHZA 3HR0A 4NUUA 2LJLA 4PJMA 1QLBA 3ANWA 4K0KT 2D0UA 4YFSA 5L3CB 2C5KT 1FJGT 4HKAA 3K3QC 2I6HA 5HEOA 4E7SA 4ZEYA 3AEBA 2XQAA 5EK4A 2D0TA 4A97A 4XZCA 3CVRA 2HPJA 4I50E 2IW5B 4CXXA 4YJ2E 3QUJA 2CPTA 2XAQB 5BR8T 3ZJ2A 3ZMUB 4LF7T 3QK6A 4X1YE 3A7MA 3SRZA 3KV6A 3S4UA 1U4QA 5CJ5A 2J4GA 4HFDA 3L39A 5AQMB 2VQFT 3NRYA 4H9QC 2DI4A 2LHNA 3LK2B 3EABA 5AFUL 3R84B 3ZMVB 3JC6C 2PBIA 2P9BA 2XQYA 3P4SA 4EV6A 4HWHA 1MIVA 2X66A 3C50A 1R8IA 4QH5A 3UUXB 4QH4A 4QH1A 2WBLA 4PFOA 4WW0A 1WR0A 2LE8A 3PTRB 4X66T 4EZ4A 1FMVA 2CCQA 4HWCA 5AQPB 2NW9A 4DR7T 3CWZB 4UVAB 2Q9QD 4L5GA 3VHLA 4TZ4C 3EDVA 3N9OA 4DUZT 3LG7A 1GQEA 1W0AA 4ANJA 4LF6T 2YINA 5EZYE 5LG4A 5E0OA 5LP6E 2KZ7B 1IJ5A 3AE1A 1XMQT 3AE6A 4IDPA 4ISSA 2XSBA 2VASA 4QHOA 5JR9C 4YTNA 4DV6T 4CI3B 3AAEB 4YHJA 3FXDB 3RX6A 2B76A 4EIWA 2R6GF 2AXDS 5AQRB 5FL1A 1LRZA 3I9WA 4DBQA 3GN5B 1YKHB 2G0UA 4QX7B 2V8SV 4WBNE 5C8YE 5LJMA 2NW7A 5FXZA 3RIFA 1HX8A 4TWDA 2B1EA 4UVBB 4O8SA 2KSRA 4HWIB 5JH7E 3P4QA 4A98A 2L8KA 3MKDA 4BA9A 5LG3A 4PJJA 3P4WA 3AEDA 4TUYE 3MK7C 2ZLYA 3U78A 2YDSA 5FY0A 4B6XA 2EHOA 2NWBA 1D1CA 1U5PA 4LMLA 1OEDE 2DNXA 4CZZB 5JDFA 2BKNA 3A5XA 3OKQA 3RQUA 1MMGA 2JIWA 3KV4A 3JCFA 1M62A 2E2AA 2WU2A 3MXZA 2WY2A 4IL9A 3RC3A 2UXDT 3F57A 4LF5T 4TNWA 4ZXLA 4DR6T 3AEGA 2UXCT 4GOUA 3FB2A 4B3ST 1MMDA 5AQFB 4O2AE 1KEYA 3H37A 3QC9A 3ZCIA 4G2AA 1D0ZA 3KFWX 1IBKT 1YKEB 4NXNT 3T8OA 5HYAA 4EXTA 4EB6E 2V5CA 5LXTE 5JRCA 2CHOA 1FIOA 3RIUA 4JI2T 4WNKA 2X51A 4X1IE 3UULA 5LNKA 1MMNA 1UGOA 1D1AA 2PJQA 5FY7A 2LM2A 4ADZA 4LMJA 4EAHA 4YTPA 1J1JA 3PU3A 4TNVA 1Z8UA 3TLSA 2Y48B 3AE8A 4UELA 1D1BA 4EYUA 4X62T 4O4HE 1MIYA 3N9MA 3DP7A 4B3TT 2IDOB 2WP9A 1J5WA 2XZEA 5JRCB 2XASB 2DLRA 2RPAA 3PURA 4AQGA 4CQIA 3N9NA 2BS2A 3M65A 4HGAA 4TWHA 3VRBA 2ZM8A 4DO0A 5JREA 1BR0A 4UXNB 3KV5A 2DHRA 2QRXA 2ZM2A 3K1SA 3QNUA 3N5LA 3ONXA 2SPCA 3K8PC 2LSGA 3KVAA 1E2AA 2VKDA 3DJBA 3H3MA 1XDPA 3AE4A 2N2NA 3O4XE 1WRDA 3N2OA 2QGSA 5FXWA 5L3DB 2UXXB 3UUNA 1ZKEA 5AQVB 4IDZA 5L3EB 3KDSE 5DABA 5HEUA 5CA0E 2EHOB 2NR4A 3LDQB 1VRBA 2CMRA 3FZHB 1O3XA 3QB5K 3U3IA 2VURA
chains in the Genus database with same CATH topology
1CUNA 2E9XB 5EK2A 2WWUA 3E08A 3K3OA 3ZC0A 2VKJA 5L2LA 3WAJA 5F8PA 4ZI3C 3W15B 4I43B 3I0QA 2V1DB 2K5BB 3D0TA 4MBQA 3GMIA 2Y6XA 3BQLA 2XTLA 5LBMA 3V5SA 1LVFA 3N9PA 2NW8A 3AA6B 2KLQA 4UIGA 2XAJB 1FEWA 1S94A 3OBVE 3VU7H 5JR9B 4I55E 4GK0E 3L3PA 3IBPA 3ZPOA 2LSJA 4IE5A 5L3FB 2E9XA 2PG8A 3I9YA 2K9AA 3E0ZA 4PK5A 4TV9E 1D0XA 2W63A 3DTOA 5JDLA 4IHJE 3ESLA 2LT3A 2H7VC 3C64A 4OHFA 4AI6A 5JR9A 5LA6E 5IHYA 5A1LA 1G8XA 2HPLA 2JQQA 3N9QA 3WI3A 4TN7B 5JDMA 2VL8A 5KX5E 3RYHE 2IC6A 4AKLA 5DJQC 4ZHQE 1AJ3A 2LHRA 1ZEEA 4IIJE 1QSDA 4GYRA 2IAKA 5IYZE 3CX7B 2LSYA 2W00A 3J7Yq 2BVMA 2YU1A 2A2FX 1OWAA 1ZHCA 1BR1A 4ILUA 2PFVA 2X9XA 4V1Av 3F2EA 1LVKA 5DQWA 5GONE 3GN5A 3KVBA 3RRCA 5FMNA 5HXHA 3AVRA 2WM9A 2UXNB 1HCIA 2VK9A 5HAXA 3CKDA 4QXCB 4XAXB 3UT5E 2DCFA 4AKGA 3E22E 4PJLA 4A56A 2V7KA 2HH7A 3ZYKA 5JDGA 4QWNB 4DMVA 2NTXA 3KBUA 1HFAA 1YD8G 5ADXL 3PU8A 3PUAA 3OYXA 4HTEA 2EHOD 3LJCA 4JUYA 4UF0A 3MACA 2ODUA 5FXVA 4MALA 3RPUA 4TV8E 2X9YA 4KUMB 2X0LB 3N2GE 1LKXA 2CM0A 3CQCB 3KINB 5HXEA 4KBMB 4PW8A 3N9LA 4UEMA 4C91A 2VKHA 3RYIE 3ETVA 2WAUA 3LFMA 4HE8A 3B57A 1MNDA 4BAYB 5J2TE 2YK0A 3PUGA 4DVDA 2M67A 4AQFA 5FYMA 2H3RA 3NRXA 2WMOA 1UX5A 3AB3B 3EUHA 1HS7A 2WSSV 3LK3B 3WAKA 2X9HA 3Q5XA 4ASKA 3HL6A 3H3AA 3UTKA 2V26A 4JEHB 4E7ZA 4AKHA 4ZS2A 2LOPA 5LYJE 5HWXA 3C4XA 2YEVC 2JPFA 4IE6A 3HKEE 2I59A 3Q5WA 4TX5A 2ODVA 3P7IA 5LCYA 1VOMA 2BVLA 2LSKA 3CPZA 5LGNB 4H9PC 4PFPA 2ACXA 5FY1A 2CXLA 2Q9QC 1Z0PA 1KNZA 3V5UA 1WLXA 3MZKB 4X20E 5JVDE 5TAOA 2C0SA 3BK9A 3AA7B 3PUQA 2NP9A 3HKDE 4IE4A 3IF8B 2XAGB 4PAGA 4M1PA 4GIWA 2KXPB 3HKBE 3UUMA 2LSIA 3FBLA 4UV8B 4AXPA 3ANWB 2XUEA 1H7CA 4G63A 4MFRA 2IC9A 3SOLA 3AA0B 4BJMA 4HFVA 4AKIA 2VWAA 1FMWA 2RP4A 2CXFA 4KMCA 4QX8B 3ZYLA 4AKRB 2CA5A 3GA8A 2L9QA 3K3NA 1KK7A 4WBOA 4BJNA 3RH3A 2C5JA 5HWYA 4YJ3E 3ZMTB 5JQGE 5LHIB 2K24A 2E8IA 3ZCJA 3CQXC 4EZHA 5ETWA 5JDNA 2Q9QB 2D5UA 3RRWA 4X1KE 1UCUA 5LGUB 5HXCA 3CQGB 5LOVE 4GK5E 5J2UE 4L9IA 1HG5A 5LHGB 1EZ3A 4N78D 3HA4A 2GK9A 5JDQA 3VKGA 3LBXA 2MOZA 2JJ9A 4QXBB 2X68A 2W61A 3C4ZA 2J1DG 3ETUA 3L09A 3ZYMA 4P0AA 2NTYA 4MHCA 3Q2MA 5KMGP 2LOSA 1MIWA 4O4IE 2DWGA 5LGTB 2V7LA 3R6NA 1BR4A 2ZM0A 3ZC1A 4GYSA 3BQKA 2KT9A 4UVCB 3NZPA 3IHRA 2WMNA 2YU2A 2BZBA 4IE7A 3ZLIA 1S35A 1UX4A 3O1HA 4P0BA 2KMFA 2XAFB 2JMHA 3JC6D 3PDYA 1X79A 2N9DA 4OYKA 4YLHA 4H9NC 4ZI2D 3C98B 1OXZA 2NOXA 1WR6A 3FBZA 3GWHA 3I0OA 3AA1B 2DWKA 2OA5A 3BQIA 5BMVE 3ZMSB 4FI5A 5HXSA 1MNEA 1QUUA 2A72A 2EHOC 4KP3C 4ZI7E 3O1IA 4NUVA 4ERRA 2VKOA 4UV9B 5F3JA 3KV9A 1NAFA 1Y64B 4OYJA 4C90A 2N1GA 4U74A 5EK3A 5CA1E 3OJAA 3ZMZB 3LBXB 2XHEB 1ZV4X 4MLKA 3UFEA 2KNDA 2KWHA 2MYSA 2V7IA 3P8CD 5L3BB 3NBXX 4O4JE 1SA0E 1IZNB 4O4LE 4JLEA 4I4TE 2Z6EA 3I1AA 2CE7A 3RC8A 4QXHB 4J2CA 4OK0A 1IAPA 2RA1A 4PJNA 4Z8XA 3AVSA 2Q9QA 4L0RA 2XAHB 1B7TA 5LBQB 3AAIA 3FXEB 3J9X1 4EYYR 3HI2A 3ZEFB 4DMWA 5M4YA 3RYFE 4ZS3A 4XBFB 4PK6A 5DQVA 3C4WA 4HEAA 1HF8A 2X67A 3CMLA 3SS1A 3EDUA 3PE0A 4FJOA 4UF0B 3Q9DA 2C5IT 4AQFC 2V7JA 3C51A 5H6QB 1NWMX 1IJ6A 5L3GB 2V7MA 2CLYC 4H63H 1YW0A 3ZN0B 4H9RC 2MTQA 5LJNA 5FXXA 3HKCE 4OFZA 4ZOLE 2BDEA 3ZJ1A 4ZI2C 4IE0A 4ZI3D 3RKOA 4CXWA 3NZQA 4O2BE 2Y8DA 3SWHA 5FP3A 3N2KE 2MBGA 4DBRA 2ES0A 1BR2A 1HG2A 3KBTA 4H63V 5CB4E 4CXYA 2A3DA 2JRKA 2W62A 1WYCA 5H6RB 4H9SE 4U72A 4P09A 2W0GA 3OYZA 4H9OC 4JEUB 1US7B 2E9XC 3AAAB 2CEAA 3IEEA 3VKHA 4IGUA 4K0UA 1D0YA 1SHZC 2K48A 2CLYB 2L3LA 3TKLB 2JMKA 2CWYA 4ISTA 2LM9A 2KINB 3MJXA 5J1GA 5KDMC 2LEHA 3O1JA 4QKNA 3CX8B 1MMAA 4DNDA 2E9XD 2CXDA 2D2SA 2CWOA 2ZMAA 4HN9A 4F6RC 5LHHB 1E1HB 3MA9A 1HTJF 3LK42 2X9WA 2H7OA 4PNIA 4PK4A 3B13A 4CI1B 2KWIB 5HXRA 3F31A 3RYCE 1V9DA 1T98A 3PUSA 1G73A 2QA7A 2VB6A 3CX6B 1WYBA 3ZN1B 3EVYA 4EOZB 3FHNA 3O9XA 5FNVE 3HR0A 4NUUA 2LJLA 4PJMA 3ANWA 2D0UA 4YFSA 5L3CB 2C5KT 4HKAA 3K3QC 4E7SA 5EK4A 2D0TA 4XZCA 3CVRA 2HPJA 4I50E 2IW5B 4CXXA 4YJ2E 3QUJA 2XAQB 3ZJ2A 3ZMUB 3QK6A 4X1YE 3SRZA 3KV6A 3S4UA 1U4QA 3NRYA 4H9QC 2DI4A 2LHNA 3LK2B 5AFUL 3R84B 3ZMVB 3JC6C 2PBIA 2P9BA 2XQYA 1MIVA 2X66A 3C50A 4CI2B 3UUXB 5JDHA 4WW0A 2WBLA 4PFOA 2LE8A 3PTRB 4EZ4A 1FMVA 2CCQA 2NW9A 3CWZB 4UVAB 2Q9QD 4L5GA 3VHLA 4TZ4C 3EDVA 3N9OA 3LG7A 4ANJA 2YINA 5EZYE 5LG4A 5E0OA 5LP6E 2KZ7B 1IJ5A 4ISSA 4QHOA 2VASA 5JR9C 4CI3B 3AAEB 4YHJA 3FXDB 3RX6A 4EIWA 1LRZA 3I9WA 4DBQA 3GN5B 1YKHB 2G0UA 4QX7B 4WBNE 5C8YE 5LJMA 2NW7A 5FXZA 1HX8A 2B1EA 4UVBB 4O8SA 5JH7E 2L8KA 3MKDA 4BA9A 4PJJA 4TUYE 3MK7C 2ZLYA 3U78A 5FY0A 4B6XA 2EHOA 2NWBA 1D1CA 1U5PA 4CZZB 2DNXA 5JDFA 3A5XA 3OKQA 1MMGA 3KV4A 3MXZA 3RC3A 3F57A 4GOUA 3FB2A 1MMDA 4O2AE 3H37A 3QC9A 3ZCIA 4G2AA 1D0ZA 3KFWX 1YKEB 3T8OA 5HYAA 4EXTA 4EB6E 5LXTE 5JRCA 1FIOA 4WNKA 2X51A 4X1IE 3UULA 5LNKA 1MMNA 1D1AA 2PJQA 5FY7A 4ADZA 4EAHA 3PU3A 2Y48B 4UELA 1D1BA 4EYUA 4O4HE 1MIYA 3N9MA 3DP7A 5JRCB 2XASB 2DLRA 3PURA 4CQIA 4AQGA 3N9NA 3M65A 4HGAA 4DO0A 1BR0A 2ZM8A 5JREA 4UXNB 3KV5A 2DHRA 2ZM2A 3N5LA 3ONXA 2SPCA 3K8PC 2LSGA 3KVAA 2VKDA 3DJBA 2N2NA 3O4XE 1WRDA 3N2OA 2QGSA 5FXWA 2UXXB 3UUNA 1ZKEA 4IDZA 5L3EB 3KDSE 5DABA 5CA0E 2EHOB 1VRBA 2CMRA 1O3XA 5L3DB 3U3IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OYJ A;  2HPJ A;  2HPL A;  5LJM A;  5LJN A;  2CCQ A;  4OYK A;  4P09 A;  2CM0 A;  4P0B A;  2D5U A;  4JUY A;  4P0A A; 
#chains in the Genus database with same CATH topology
 1CUN A;  2E9X B;  1VCS A;  5EK2 A;  2WWU A;  3E08 A;  3K3O A;  4IDQ A;  3ZC0 A;  2VKJ A;  5L2L A;  3WAJ A;  1JNR A;  1XNR T;  1WCR A;  5F8P A;  4ZI3 C;  2YOE A;  4I43 B;  3W15 B;  4DR1 T;  2V6Y A;  3I0Q A;  2BS4 A;  2V1D B;  3ONL C;  2K5B B;  2AE9 A;  3D0T A;  4MBQ A;  3GMI A;  2Y6X A;  3BQL A;  3PUX F;  3RI5 A;  3UU8 A;  2XTL A;  5LBM A;  2BS3 A;  5FKY A;  1LVF A;  2WZH A;  2YKS A;  2NW8 A;  3N9P A;  3V5S A;  3ZT5 A;  3ONJ A;  3AA6 B;  3SFD A;  2KLQ A;  4UIG A;  2XAJ B;  1FEW A;  1S94 A;  3OBV E;  4YTM A;  3VU7 H;  4I55 E;  5JR9 B;  3M3Z B;  4GK0 E;  3L3P A;  4EEB A;  3IBP A;  3ZPO A;  4DV2 T;  2LSJ A;  4IE5 A;  2HHH T;  4U2Z A;  5L3F B;  3RIU C;  2BKP A;  2E9X A;  2WU5 A;  4I0U A;  1VCT A;  1YQ3 A;  2PG8 A;  2K9A A;  3CIR A;  2K3W A;  2WDV A;  1D0X A;  3E0Z A;  2FUP A;  2W63 A;  3DTO A;  4LMK A;  4IHJ E;  4PK5 A;  3ESL A;  2LT3 A;  2H7V C;  3C64 A;  3QOF A;  4OHF A;  2PTF A;  5JR9 A;  5IHY A;  5LA6 E;  5A1L A;  3UU6 A;  1G8X A;  2HPL A;  2JQQ A;  3N9Q A;  3WI3 A;  4TN7 B;  5AQJ B;  4HFB A;  5JDM A;  2VL8 A;  5KX5 E;  3RYH E;  2IC6 A;  2YN6 A;  5DJQ C;  4AKL A;  4ZHQ E;  2LHR A;  1NEN A;  1AJ3 A;  3JAF A;  5ABH A;  1ZEE A;  4IIJ E;  2M6B A;  1QSD A;  2JQH A;  2W67 A;  4GYR A;  4B3R T;  3PUZ F;  3G06 A;  2BG9 E;  2IAK A;  5IYZ E;  5ABE A;  1Y01 A;  3CX7 B;  2ZM6 T;  2LSY A;  2W00 A;  2WB5 A;  1M7K A;  1WFD A;  3J7Y q;  2F4V T;  2BVM A;  2BBJ A;  2YU1 A;  5FL0 A;  2A2F X;  4YHH T;  1OWA A;  5IUX A;  1ZHC A;  1BR1 A;  4ILU A;  4JYA T;  2PFV A;  4KI0 F;  2X9X A;  3OVU A;  4JI4 T;  4V1A v;  3T1H T;  1X9B A;  2W66 A;  3F2E A;  1LVK A;  3PJA A;  3AXJ B;  5DQW A;  5GON E;  3GN5 A;  3KVB A;  3RRC A;  5FMN A;  4DID B;  5HXH A;  3AVR A;  2WM9 A;  2UXN B;  4U7I A;  1HCI A;  2UXB T;  2VK9 A;  4U31 A;  5HAX A;  3CKD A;  4QXC B;  4XAX B;  3UT5 E;  2DCF A;  4F8H A;  1OED B;  3E22 E;  4AKG A;  4PJL A;  3UU5 A;  4HWD A;  3RLF F;  4A56 A;  4CN1 A;  2V7K A;  2HH7 A;  3ZYK A;  5JDG A;  4LF8 T;  4QWN B;  4AIU A;  4DMV A;  4Q25 A;  2X0Y A;  2NTX A;  3KBU A;  1HFA A;  1YD8 G;  2WWV A;  5ADX L;  4NXM T;  3PU8 A;  3PUA A;  3OYX A;  4HTE A;  2EHO D;  3LJC A;  1KF6 A;  2FBW A;  2X0H A;  3MAC A;  2ODU A;  4JUY A;  5FXV A;  3UFG A;  3UUB A;  4MAL A;  3ZT7 A;  3RPU A;  1XDO A;  2CBI A;  2X9Y A;  4TV8 E;  4HFI A;  4KUM B;  5C3J A;  2X0L B;  3N2G E;  1LKX A;  2CM0 A;  3CQC B;  3AEA A;  3KIN B;  1KNP A;  4IDO A;  5HXE A;  3EI0 A;  4KBM B;  3N9L A;  4PW8 A;  4UEM A;  4UR9 A;  4IRE A;  4C91 A;  4IDN A;  2VKH A;  4CI2 B;  3RYI E;  3ETV A;  2WAU A;  3LFM A;  1IBL T;  4JI7 T;  5AQN B;  1HR0 T;  4YY3 T;  4HE8 A;  3B57 A;  1MND A;  4BAY B;  4HFE A;  2YK0 A;  4U3C A;  3PUG A;  3VR9 A;  5J2T E;  2W4X A;  4TWF A;  4DV7 T;  4DVD A;  2M67 A;  4AQF A;  2J47 A;  5FYM A;  2H3R A;  3NRX A;  4X65 T;  2WMO A;  1L0V A;  4KHZ F;  1UX5 A;  3AB3 B;  3EUH A;  3JAE A;  5L47 A;  2WSS V;  4JI6 T;  3Q5E A;  1HS7 A;  3LK3 B;  3WAK A;  2X9H A;  4LF4 T;  3Q5X A;  4ASK A;  2XY8 B;  2BG9 C;  3H3A A;  3HL6 A;  2XJ7 A;  3UTK A;  1T8B A;  2UUB T;  3ZSS A;  2V26 A;  4ILC A;  4JEH B;  1W9R A;  1JNZ A;  4ZS2 A;  3SFE A;  1OED A;  4E7Z A;  4YSX A;  4AKH A;  2FJB A;  2H89 A;  2LOP A;  5LYJ E;  5HWX A;  3C4X A;  2YEV C;  5L4H A;  1W0B A;  2JPF A;  3IA3 A;  3HKE E;  3OPC A;  2I59 A;  4IE6 A;  4WYV A;  2XQ8 A;  3Q5W A;  4TX5 A;  4HWF A;  1T7S A;  2ODV A;  1XWM A;  3P7I A;  5CFB A;  1XMO T;  1N33 T;  2VVS A;  5LCY A;  4A5X A;  3ZST A;  1VOM A;  2BVL A;  2V6X A;  2LSK A;  2WS3 A;  3CPZ A;  3ZKR A;  3RIA A;  4H9P C;  4PFP A;  2ACX A;  5AQI B;  5AQO B;  5FY1 A;  5LGN B;  2CXL A;  2Q9Q C;  1Z0P A;  2BKO A;  1KNZ A;  3V5U A;  1WLX A;  3MZK B;  4X20 E;  5JVD E;  5TAO A;  4P0A A;  2C0S A;  2XQ5 A;  3BK9 A;  1J5E T;  3AA7 B;  4NIQ A;  3PUQ A;  2NP9 A;  2OLT A;  2HN2 A;  2J62 A;  4Z91 A;  3HKD E;  4IE4 A;  1HNZ T;  3IF8 B;  2XAG B;  4PAG A;  4ILA A;  4M1P A;  2LKG A;  4GIW A;  2KXP B;  4JI0 T;  3HKB E;  3UUM A;  2LSI A;  3FBL A;  2FJD A;  4UV8 B;  4AXP A;  3ANW B;  2E5L T;  2YDQ A;  5LMU T;  2XUE A;  1H7C A;  3NVO A;  4G63 A;  4MFR A;  2IC9 A;  3SOL A;  3AA0 B;  4BJM A;  4HFV A;  4COF A;  1IBM T;  4AKI A;  2VWA A;  1FMW A;  2RP4 A;  1CHU A;  2CXF A;  4KMC A;  4QX8 B;  2YDR A;  4UF0 A;  3ZYL A;  4KHP T;  2XQ9 A;  5JTG A;  4AKR B;  2CA5 A;  4YSY A;  3GA8 A;  4KX6 A;  4P1N A;  5LMN T;  4DR5 T;  2L9Q A;  3K3N A;  3PV0 F;  1I94 T;  1KK7 A;  4YSZ A;  4WBO A;  4B3M T;  2BBH A;  4BJN A;  2BG9 A;  2WZI A;  4EGW A;  3UQ7 A;  4JI3 T;  3RH3 A;  2C5J A;  2IUB A;  5HWY A;  4YJ3 E;  3ZMT B;  5JQG E;  5LHI B;  4DV5 T;  2K24 A;  4OX9 T;  1T72 A;  3NKZ A;  5F5W A;  2E8I A;  3ZCJ A;  3CQX C;  4EZH A;  3VKH A;  5ETW A;  5JDN A;  5JDH A;  2MAW A;  2Q9Q B;  2D5U A;  5FVK A;  4X1K E;  2WDR A;  1UCU A;  3RKG A;  5HXC A;  3AE3 A;  3RRW A;  2XPK A;  5LGU B;  2FJA A;  3CQG B;  5LOV E;  4GK5 E;  4ZI7 E;  5J2U E;  1UUR A;  4L9I A;  4JI1 T;  1HG5 A;  2FJE A;  3AEC A;  1SUM B;  3T1Y T;  2QVA A;  5LHG B;  1N36 T;  1EZ3 A;  4N78 D;  3AE2 A;  4U7Y A;  3HA4 A;  1YXR A;  2GK9 A;  5JDQ A;  3VKG A;  3LBX A;  4ILB A;  2MOZ A;  2JJ9 A;  2OV9 A;  2X68 A;  4QXB B;  2W61 A;  3C4Z A;  2J1D G;  3ETU A;  3L09 A;  3ZYM A;  4ZZC A;  2NTY A;  3PUW F;  4IT4 A;  3TLW A;  4MHC A;  3Q2M A;  5KMG P;  1XNQ T;  2LOS A;  3FZM B;  1MIW A;  4O4I E;  2DWG A;  5LGT B;  2V7L A;  3R6N A;  3P4R A;  3PUV F;  5CGM A;  3QB5 A;  1BR4 A;  2ZM0 A;  5HCM A;  3ZC1 A;  4GYS A;  3BQK A;  2KT9 A;  4UVC B;  3NZP A;  3IHR A;  4GKJ T;  2WMN A;  5AQG B;  2YU2 A;  4DR2 T;  2BZB A;  4IE7 A;  3ZLI A;  1S35 A;  1UX4 A;  3O1H A;  3I9Y A;  4P0B A;  2KMF A;  4ZI2 D;  2XAF B;  2JMH A;  3JC6 D;  2CHN A;  1X79 A;  3PDY A;  3PUY F;  4AI6 A;  2H88 A;  2N9D A;  4OYK A;  4YLH A;  5AQL B;  1N34 T;  4CN4 A;  4LFC T;  4H9N C;  5HEJ A;  1E7P A;  2IML A;  4ZZB A;  3NWI A;  3C98 B;  1OXZ A;  2NOX A;  1WR6 A;  3FBZ A;  3GWH A;  3I0O A;  3RGL A;  2BG9 B;  4YXD A;  4DV4 T;  2VL0 A;  3AA1 B;  2DWK A;  2OA5 A;  3UQ4 A;  3BQI A;  5AQH B;  5BMV E;  2XM1 A;  3ZMS B;  5AQQ B;  5HCJ A;  4FI5 A;  5KXJ A;  5HXS A;  1MNE A;  1QUU A;  1XZY A;  2A72 A;  2EHO C;  2XQ4 A;  3AE9 A;  3AEF A;  3FZF B;  3O1I A;  3PJA J;  4KP3 C;  4NUV A;  2VKO A;  1KNR A;  4ERR A;  3UU3 A;  4UV9 B;  4Z90 A;  5F3J A;  3KV9 A;  4U33 A;  1NAF A;  1Y64 B;  4OYJ A;  4U2Y A;  4C90 A;  1NEK A;  2N1G A;  2V6Y B;  4U74 A;  3JAD A;  5EK3 A;  5CA1 E;  1YQ4 A;  3OJA A;  2JQ9 A;  3L8R A;  5L4E A;  3ZMZ B;  4DR4 T;  3LBX B;  2XHE B;  1ZV4 X;  5ABF B;  2DL1 A;  4MLK A;  4TV9 E;  3ABV A;  2KND A;  2KWH A;  2MYS A;  2V7I A;  3P8C D;  3UFE A;  5L3B B;  3NBX X;  4O4J E;  1SA0 E;  4WZX A;  1IZN B;  3A8Y C;  4O4L E;  4JLE A;  4I4T E;  2Z6E A;  3I1A A;  1UK5 A;  2CE7 A;  5HEH A;  3VR8 A;  4HFC A;  5JDL A;  4QXH B;  3RC8 A;  4J2C A;  4OK0 A;  4GKK T;  1IAP A;  2RA1 A;  4IL4 A;  4EED A;  4PJN A;  4Z8X A;  3AVS A;  2XSA A;  4NPP A;  2Q9Q A;  2CBJ A;  2M6I A;  2E5V A;  4L0R A;  2XAH B;  2UU9 T;  1B7T A;  5LBQ B;  3AAI A;  5J0Z A;  2XQ7 A;  3FXE B;  3J9X 1;  4EYY R;  3HI2 A;  3ZEF B;  2IIU A;  4DMW A;  5M4Y A;  3RYF E;  4ZS3 A;  2LKH A;  2UUC T;  4PK6 A;  5DQV A;  3C4W A;  4HEA A;  4DR3 T;  1HF8 A;  4XBF B;  2LRK A;  2X67 A;  2D9D A;  1ZP0 A;  3CML A;  3EDU A;  3FZL B;  3PE0 A;  4FJO A;  4UF0 B;  5FVL A;  3P50 A;  5LB7 B;  3SS1 A;  4AQY T;  3Q9D A;  2C5I T;  3AE7 A;  2V7J A;  3C51 A;  5H6Q B;  3TLT A;  4AQF C;  2CRB A;  3RF1 A;  1NWM X;  3OTO T;  2A9U A;  1IJ6 A;  5L3G B;  4JV5 T;  2LRL A;  2V7M A;  2CLY C;  4H63 H;  3VRA A;  3B5M A;  1YW0 A;  3ZN0 B;  4H9R C;  2MTQ A;  2VVN A;  5LJN A;  5FXX A;  3HKC E;  4OFZ A;  2W2U A;  4ZOL E;  2BDE A;  2WCA A;  3ZJ1 A;  4ZI2 C;  4LFA T;  4IE0 A;  4ZI3 D;  3RKO A;  5AQS B;  3CK6 A;  4CXW A;  3NZQ A;  4O2B E;  2Y8D A;  3SWH A;  5FP3 A;  3AE5 A;  3N2K E;  2MBG A;  4DBR A;  1ZOY A;  2ES0 A;  1I6Z A;  2VQE T;  1BR2 A;  1HG2 A;  3KBT A;  4H63 V;  5CB4 E;  1KFY A;  4CXY A;  2A3D A;  2WDQ A;  2JRK A;  2LLY A;  2W62 A;  1WYC A;  5H6R B;  4H9S E;  4DV0 T;  4U72 A;  4HFH A;  1SE7 A;  2MPK A;  4P09 A;  2W0G A;  3OYZ A;  4H9O C;  5AQK B;  4JEU B;  1US7 B;  2E9X C;  3TLV A;  2I0M A;  3AAA B;  2CEA A;  3IEE A;  5IWA T;  2ACZ A;  1HX1 B;  4IGU A;  4K0U A;  1D0Y A;  4LFB T;  1SHZ C;  2K48 A;  1UUS A;  2JQK A;  2CLY B;  2L3L A;  4JI5 T;  3TKL B;  1HNW T;  2JMK A;  2XQ3 A;  2UUA T;  2CWY A;  5C2T A;  4JBW F;  4IST A;  2LM9 A;  2V5D A;  2KIN B;  3MJX A;  5J1G A;  5ABG A;  4YT0 A;  5KDM C;  2LEH A;  2QYW A;  3O1J A;  5HEG A;  4QKN A;  4X64 T;  3CX8 B;  3EAM A;  1MMA A;  2XM2 A;  4CN6 A;  4DND A;  2E9X D;  4AIS A;  2CXD A;  1W09 A;  3X1D A;  2D2S A;  2WQY A;  3RQW A;  3P4P A;  4DV1 T;  5AQT B;  2CWO A;  2ZMA A;  3AXJ A;  4HN9 A;  3RHW A;  3LSV A;  1E1H B;  3TLU A;  3ZT6 A;  3MA9 A;  4F6R C;  4X5T A;  5LHH B;  3FZK B;  1HTJ F;  4JI8 T;  2IHR 1;  3LK4 2;  1DU2 A;  2X9W A;  2H7O A;  3AEE A;  4PNI A;  2HN1 A;  3B13 A;  2KWI B;  4PK4 A;  4CI1 B;  5HXR A;  3F31 A;  3RYC E;  1V9D A;  1T98 A;  5AQU B;  3PUS A;  5ABF A;  1HNX T;  1OED C;  3Q5D A;  1G73 A;  2XQ6 A;  2QA7 A;  2VB6 A;  3CX6 B;  1WYB A;  3ZN1 B;  3UU4 A;  4DV3 T;  3EVY A;  4LF9 T;  1N32 T;  4EOZ B;  3FHN A;  4DUY T;  3O9X A;  5FNV E;  3EHZ A;  3HR0 A;  4NUU A;  2LJL A;  4PJM A;  1QLB A;  3ANW A;  4K0K T;  2D0U A;  4YFS A;  5L3C B;  2C5K T;  1FJG T;  4HKA A;  3K3Q C;  2I6H A;  5HEO A;  4E7S A;  4ZEY A;  3AEB A;  2XQA A;  5EK4 A;  2D0T A;  4A97 A;  4XZC A;  3CVR A;  2HPJ A;  4I50 E;  2IW5 B;  4CXX A;  4YJ2 E;  3QUJ A;  2CPT A;  2XAQ B;  5BR8 T;  3ZJ2 A;  3ZMU B;  4LF7 T;  3QK6 A;  4X1Y E;  3A7M A;  3SRZ A;  3KV6 A;  3S4U A;  1U4Q A;  5CJ5 A;  2J4G A;  4HFD A;  3L39 A;  5AQM B;  2VQF T;  3NRY A;  4H9Q C;  2DI4 A;  2LHN A;  3LK2 B;  3EAB A;  5AFU L;  3R84 B;  3ZMV B;  3JC6 C;  2PBI A;  2P9B A;  2XQY A;  3P4S A;  4EV6 A;  4HWH A;  1MIV A;  2X66 A;  3C50 A;  1R8I A;  4QH5 A;  3UUX B;  4QH4 A;  4QH1 A;  2WBL A;  4PFO A;  4WW0 A;  1WR0 A;  2LE8 A;  3PTR B;  4X66 T;  4EZ4 A;  1FMV A;  2CCQ A;  4HWC A;  5AQP B;  2NW9 A;  4DR7 T;  3CWZ B;  4UVA B;  2Q9Q D;  4L5G A;  3VHL A;  4TZ4 C;  3EDV A;  3N9O A;  4DUZ T;  3LG7 A;  1GQE A;  1W0A A;  4ANJ A;  4LF6 T;  2YIN A;  5EZY E;  5LG4 A;  5E0O A;  5LP6 E;  2KZ7 B;  1IJ5 A;  3AE1 A;  1XMQ T;  3AE6 A;  4IDP A;  4ISS A;  2XSB A;  2VAS A;  4QHO A;  5JR9 C;  4YTN A;  4DV6 T;  4CI3 B;  3AAE B;  4YHJ A;  3FXD B;  3RX6 A;  2B76 A;  4EIW A;  2R6G F;  2AXD S;  5AQR B;  5FL1 A;  1LRZ A;  3I9W A;  4DBQ A;  3GN5 B;  1YKH B;  2G0U A;  4QX7 B;  2V8S V;  4WBN E;  5C8Y E;  5LJM A;  2NW7 A;  5FXZ A;  3RIF A;  1HX8 A;  4TWD A;  2B1E A;  4UVB B;  4O8S A;  2KSR A;  4HWI B;  5JH7 E;  3P4Q A;  4A98 A;  2L8K A;  3MKD A;  4BA9 A;  5LG3 A;  4PJJ A;  3P4W A;  3AED A;  4TUY E;  3MK7 C;  2ZLY A;  3U78 A;  2YDS A;  5FY0 A;  4B6X A;  2EHO A;  2NWB A;  1D1C A;  1U5P A;  4LML A;  1OED E;  2DNX A;  4CZZ B;  5JDF A;  2BKN A;  3A5X A;  3OKQ A;  3RQU A;  1MMG A;  2JIW A;  3KV4 A;  3JCF A;  1M62 A;  2E2A A;  2WU2 A;  3MXZ A;  2WY2 A;  4IL9 A;  3RC3 A;  2UXD T;  3F57 A;  4LF5 T;  4TNW A;  4ZXL A;  4DR6 T;  3AEG A;  2UXC T;  4GOU A;  3FB2 A;  4B3S T;  1MMD A;  5AQF B;  4O2A E;  1KEY A;  3H37 A;  3QC9 A;  3ZCI A;  4G2A A;  1D0Z A;  3KFW X;  1IBK T;  1YKE B;  4NXN T;  3T8O A;  5HYA A;  4EXT A;  4EB6 E;  2V5C A;  5LXT E;  5JRC A;  2CHO A;  1FIO A;  3RIU A;  4JI2 T;  4WNK A;  2X51 A;  4X1I E;  3UUL A;  5LNK A;  1MMN A;  1UGO A;  1D1A A;  2PJQ A;  5FY7 A;  2LM2 A;  4ADZ A;  4LMJ A;  4EAH A;  4YTP A;  1J1J A;  3PU3 A;  4TNV A;  1Z8U A;  3TLS A;  2Y48 B;  3AE8 A;  4UEL A;  1D1B A;  4EYU A;  4X62 T;  4O4H E;  1MIY A;  3N9M A;  3DP7 A;  4B3T T;  2IDO B;  2WP9 A;  1J5W A;  2XZE A;  5JRC B;  2XAS B;  2DLR A;  2RPA A;  3PUR A;  4AQG A;  4CQI A;  3N9N A;  2BS2 A;  3M65 A;  4HGA A;  4TWH A;  3VRB A;  2ZM8 A;  4DO0 A;  5JRE A;  1BR0 A;  4UXN B;  3KV5 A;  2DHR A;  2QRX A;  2ZM2 A;  3K1S A;  3QNU A;  3N5L A;  3ONX A;  2SPC A;  3K8P C;  2LSG A;  3KVA A;  1E2A A;  2VKD A;  3DJB A;  3H3M A;  1XDP A;  3AE4 A;  2N2N A;  3O4X E;  1WRD A;  3N2O A;  2QGS A;  5FXW A;  5L3D B;  2UXX B;  3UUN A;  1ZKE A;  5AQV B;  4IDZ A;  5L3E B;  3KDS E;  5DAB A;  5HEU A;  5CA0 E;  2EHO B;  2NR4 A;  3LDQ B;  1VRB A;  2CMR A;  3FZH B;  1O3X A;  3QB5 K;  3U3I A;  2VUR A; 
#chains in the Genus database with same CATH homology
 1CUN A;  2E9X B;  5EK2 A;  2WWU A;  3E08 A;  3K3O A;  3ZC0 A;  2VKJ A;  5L2L A;  3WAJ A;  5F8P A;  4ZI3 C;  3W15 B;  4I43 B;  3I0Q A;  2V1D B;  2K5B B;  3D0T A;  4MBQ A;  3GMI A;  2Y6X A;  3BQL A;  2XTL A;  5LBM A;  3V5S A;  1LVF A;  3N9P A;  2NW8 A;  3AA6 B;  2KLQ A;  4UIG A;  2XAJ B;  1FEW A;  1S94 A;  3OBV E;  3VU7 H;  5JR9 B;  4I55 E;  4GK0 E;  3L3P A;  3IBP A;  3ZPO A;  2LSJ A;  4IE5 A;  5L3F B;  2E9X A;  2PG8 A;  3I9Y A;  2K9A A;  3E0Z A;  4PK5 A;  4TV9 E;  1D0X A;  2W63 A;  3DTO A;  5JDL A;  4IHJ E;  3ESL A;  2LT3 A;  2H7V C;  3C64 A;  4OHF A;  4AI6 A;  5JR9 A;  5LA6 E;  5IHY A;  5A1L A;  1G8X A;  2HPL A;  2JQQ A;  3N9Q A;  3WI3 A;  4TN7 B;  5JDM A;  2VL8 A;  5KX5 E;  3RYH E;  2IC6 A;  4AKL A;  5DJQ C;  4ZHQ E;  1AJ3 A;  2LHR A;  1ZEE A;  4IIJ E;  1QSD A;  4GYR A;  2IAK A;  5IYZ E;  3CX7 B;  2LSY A;  2W00 A;  3J7Y q;  2BVM A;  2YU1 A;  2A2F X;  1OWA A;  1ZHC A;  1BR1 A;  4ILU A;  2PFV A;  2X9X A;  4V1A v;  3F2E A;  1LVK A;  5DQW A;  5GON E;  3GN5 A;  3KVB A;  3RRC A;  5FMN A;  5HXH A;  3AVR A;  2WM9 A;  2UXN B;  1HCI A;  2VK9 A;  5HAX A;  3CKD A;  4QXC B;  4XAX B;  3UT5 E;  2DCF A;  4AKG A;  3E22 E;  4PJL A;  4A56 A;  2V7K A;  2HH7 A;  3ZYK A;  5JDG A;  4QWN B;  4DMV A;  2NTX A;  3KBU A;  1HFA A;  1YD8 G;  5ADX L;  3PU8 A;  3PUA A;  3OYX A;  4HTE A;  2EHO D;  3LJC A;  4JUY A;  4UF0 A;  3MAC A;  2ODU A;  5FXV A;  4MAL A;  3RPU A;  4TV8 E;  2X9Y A;  4KUM B;  2X0L B;  3N2G E;  1LKX A;  2CM0 A;  3CQC B;  3KIN B;  5HXE A;  4KBM B;  4PW8 A;  3N9L A;  4UEM A;  4C91 A;  2VKH A;  3RYI E;  3ETV A;  2WAU A;  3LFM A;  4HE8 A;  3B57 A;  1MND A;  4BAY B;  5J2T E;  2YK0 A;  3PUG A;  4DVD A;  2M67 A;  4AQF A;  5FYM A;  2H3R A;  3NRX A;  2WMO A;  1UX5 A;  3AB3 B;  3EUH A;  1HS7 A;  2WSS V;  3LK3 B;  3WAK A;  2X9H A;  3Q5X A;  4ASK A;  3HL6 A;  3H3A A;  3UTK A;  2V26 A;  4JEH B;  4E7Z A;  4AKH A;  4ZS2 A;  2LOP A;  5LYJ E;  5HWX A;  3C4X A;  2YEV C;  2JPF A;  4IE6 A;  3HKE E;  2I59 A;  3Q5W A;  4TX5 A;  2ODV A;  3P7I A;  5LCY A;  1VOM A;  2BVL A;  2LSK A;  3CPZ A;  5LGN B;  4H9P C;  4PFP A;  2ACX A;  5FY1 A;  2CXL A;  2Q9Q C;  1Z0P A;  1KNZ A;  3V5U A;  1WLX A;  3MZK B;  4X20 E;  5JVD E;  5TAO A;  2C0S A;  3BK9 A;  3AA7 B;  3PUQ A;  2NP9 A;  3HKD E;  4IE4 A;  3IF8 B;  2XAG B;  4PAG A;  4M1P A;  4GIW A;  2KXP B;  3HKB E;  3UUM A;  2LSI A;  3FBL A;  4UV8 B;  4AXP A;  3ANW B;  2XUE A;  1H7C A;  4G63 A;  4MFR A;  2IC9 A;  3SOL A;  3AA0 B;  4BJM A;  4HFV A;  4AKI A;  2VWA A;  1FMW A;  2RP4 A;  2CXF A;  4KMC A;  4QX8 B;  3ZYL A;  4AKR B;  2CA5 A;  3GA8 A;  2L9Q A;  3K3N A;  1KK7 A;  4WBO A;  4BJN A;  3RH3 A;  2C5J A;  5HWY A;  4YJ3 E;  3ZMT B;  5JQG E;  5LHI B;  2K24 A;  2E8I A;  3ZCJ A;  3CQX C;  4EZH A;  5ETW A;  5JDN A;  2Q9Q B;  2D5U A;  3RRW A;  4X1K E;  1UCU A;  5LGU B;  5HXC A;  3CQG B;  5LOV E;  4GK5 E;  5J2U E;  4L9I A;  1HG5 A;  5LHG B;  1EZ3 A;  4N78 D;  3HA4 A;  2GK9 A;  5JDQ A;  3VKG A;  3LBX A;  2MOZ A;  2JJ9 A;  4QXB B;  2X68 A;  2W61 A;  3C4Z A;  2J1D G;  3ETU A;  3L09 A;  3ZYM A;  4P0A A;  2NTY A;  4MHC A;  3Q2M A;  5KMG P;  2LOS A;  1MIW A;  4O4I E;  2DWG A;  5LGT B;  2V7L A;  3R6N A;  1BR4 A;  2ZM0 A;  3ZC1 A;  4GYS A;  3BQK A;  2KT9 A;  4UVC B;  3NZP A;  3IHR A;  2WMN A;  2YU2 A;  2BZB A;  4IE7 A;  3ZLI A;  1S35 A;  1UX4 A;  3O1H A;  4P0B A;  2KMF A;  2XAF B;  2JMH A;  3JC6 D;  3PDY A;  1X79 A;  2N9D A;  4OYK A;  4YLH A;  4H9N C;  4ZI2 D;  3C98 B;  1OXZ A;  2NOX A;  1WR6 A;  3FBZ A;  3GWH A;  3I0O A;  3AA1 B;  2DWK A;  2OA5 A;  3BQI A;  5BMV E;  3ZMS B;  4FI5 A;  5HXS A;  1MNE A;  1QUU A;  2A72 A;  2EHO C;  4KP3 C;  4ZI7 E;  3O1I A;  4NUV A;  4ERR A;  2VKO A;  4UV9 B;  5F3J A;  3KV9 A;  1NAF A;  1Y64 B;  4OYJ A;  4C90 A;  2N1G A;  4U74 A;  5EK3 A;  5CA1 E;  3OJA A;  3ZMZ B;  3LBX B;  2XHE B;  1ZV4 X;  4MLK A;  3UFE A;  2KND A;  2KWH A;  2MYS A;  2V7I A;  3P8C D;  5L3B B;  3NBX X;  4O4J E;  1SA0 E;  1IZN B;  4O4L E;  4JLE A;  4I4T E;  2Z6E A;  3I1A A;  2CE7 A;  3RC8 A;  4QXH B;  4J2C A;  4OK0 A;  1IAP A;  2RA1 A;  4PJN A;  4Z8X A;  3AVS A;  2Q9Q A;  4L0R A;  2XAH B;  1B7T A;  5LBQ B;  3AAI A;  3FXE B;  3J9X 1;  4EYY R;  3HI2 A;  3ZEF B;  4DMW A;  5M4Y A;  3RYF E;  4ZS3 A;  4XBF B;  4PK6 A;  5DQV A;  3C4W A;  4HEA A;  1HF8 A;  2X67 A;  3CML A;  3SS1 A;  3EDU A;  3PE0 A;  4FJO A;  4UF0 B;  3Q9D A;  2C5I T;  4AQF C;  2V7J A;  3C51 A;  5H6Q B;  1NWM X;  1IJ6 A;  5L3G B;  2V7M A;  2CLY C;  4H63 H;  1YW0 A;  3ZN0 B;  4H9R C;  2MTQ A;  5LJN A;  5FXX A;  3HKC E;  4OFZ A;  4ZOL E;  2BDE A;  3ZJ1 A;  4ZI2 C;  4IE0 A;  4ZI3 D;  3RKO A;  4CXW A;  3NZQ A;  4O2B E;  2Y8D A;  3SWH A;  5FP3 A;  3N2K E;  2MBG A;  4DBR A;  2ES0 A;  1BR2 A;  1HG2 A;  3KBT A;  4H63 V;  5CB4 E;  4CXY A;  2A3D A;  2JRK A;  2W62 A;  1WYC A;  5H6R B;  4H9S E;  4U72 A;  4P09 A;  2W0G A;  3OYZ A;  4H9O C;  4JEU B;  1US7 B;  2E9X C;  3AAA B;  2CEA A;  3IEE A;  3VKH A;  4IGU A;  4K0U A;  1D0Y A;  1SHZ C;  2K48 A;  2CLY B;  2L3L A;  3TKL B;  2JMK A;  2CWY A;  4IST A;  2LM9 A;  2KIN B;  3MJX A;  5J1G A;  5KDM C;  2LEH A;  3O1J A;  4QKN A;  3CX8 B;  1MMA A;  4DND A;  2E9X D;  2CXD A;  2D2S A;  2CWO A;  2ZMA A;  4HN9 A;  4F6R C;  5LHH B;  1E1H B;  3MA9 A;  1HTJ F;  3LK4 2;  2X9W A;  2H7O A;  4PNI A;  4PK4 A;  3B13 A;  4CI1 B;  2KWI B;  5HXR A;  3F31 A;  3RYC E;  1V9D A;  1T98 A;  3PUS A;  1G73 A;  2QA7 A;  2VB6 A;  3CX6 B;  1WYB A;  3ZN1 B;  3EVY A;  4EOZ B;  3FHN A;  3O9X A;  5FNV E;  3HR0 A;  4NUU A;  2LJL A;  4PJM A;  3ANW A;  2D0U A;  4YFS A;  5L3C B;  2C5K T;  4HKA A;  3K3Q C;  4E7S A;  5EK4 A;  2D0T A;  4XZC A;  3CVR A;  2HPJ A;  4I50 E;  2IW5 B;  4CXX A;  4YJ2 E;  3QUJ A;  2XAQ B;  3ZJ2 A;  3ZMU B;  3QK6 A;  4X1Y E;  3SRZ A;  3KV6 A;  3S4U A;  1U4Q A;  3NRY A;  4H9Q C;  2DI4 A;  2LHN A;  3LK2 B;  5AFU L;  3R84 B;  3ZMV B;  3JC6 C;  2PBI A;  2P9B A;  2XQY A;  1MIV A;  2X66 A;  3C50 A;  4CI2 B;  3UUX B;  5JDH A;  4WW0 A;  2WBL A;  4PFO A;  2LE8 A;  3PTR B;  4EZ4 A;  1FMV A;  2CCQ A;  2NW9 A;  3CWZ B;  4UVA B;  2Q9Q D;  4L5G A;  3VHL A;  4TZ4 C;  3EDV A;  3N9O A;  3LG7 A;  4ANJ A;  2YIN A;  5EZY E;  5LG4 A;  5E0O A;  5LP6 E;  2KZ7 B;  1IJ5 A;  4ISS A;  4QHO A;  2VAS A;  5JR9 C;  4CI3 B;  3AAE B;  4YHJ A;  3FXD B;  3RX6 A;  4EIW A;  1LRZ A;  3I9W A;  4DBQ A;  3GN5 B;  1YKH B;  2G0U A;  4QX7 B;  4WBN E;  5C8Y E;  5LJM A;  2NW7 A;  5FXZ A;  1HX8 A;  2B1E A;  4UVB B;  4O8S A;  5JH7 E;  2L8K A;  3MKD A;  4BA9 A;  4PJJ A;  4TUY E;  3MK7 C;  2ZLY A;  3U78 A;  5FY0 A;  4B6X A;  2EHO A;  2NWB A;  1D1C A;  1U5P A;  4CZZ B;  2DNX A;  5JDF A;  3A5X A;  3OKQ A;  1MMG A;  3KV4 A;  3MXZ A;  3RC3 A;  3F57 A;  4GOU A;  3FB2 A;  1MMD A;  4O2A E;  3H37 A;  3QC9 A;  3ZCI A;  4G2A A;  1D0Z A;  3KFW X;  1YKE B;  3T8O A;  5HYA A;  4EXT A;  4EB6 E;  5LXT E;  5JRC A;  1FIO A;  4WNK A;  2X51 A;  4X1I E;  3UUL A;  5LNK A;  1MMN A;  1D1A A;  2PJQ A;  5FY7 A;  4ADZ A;  4EAH A;  3PU3 A;  2Y48 B;  4UEL A;  1D1B A;  4EYU A;  4O4H E;  1MIY A;  3N9M A;  3DP7 A;  5JRC B;  2XAS B;  2DLR A;  3PUR A;  4CQI A;  4AQG A;  3N9N A;  3M65 A;  4HGA A;  4DO0 A;  1BR0 A;  2ZM8 A;  5JRE A;  4UXN B;  3KV5 A;  2DHR A;  2ZM2 A;  3N5L A;  3ONX A;  2SPC A;  3K8P C;  2LSG A;  3KVA A;  2VKD A;  3DJB A;  2N2N A;  3O4X E;  1WRD A;  3N2O A;  2QGS A;  5FXW A;  2UXX B;  3UUN A;  1ZKE A;  4IDZ A;  5L3E B;  3KDS E;  5DAB A;  5CA0 E;  2EHO B;  1VRB A;  2CMR A;  1O3X A;  5L3D B;  3U3I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...