4P0BA

Crystal structure of hoip pub domain in complex with otulin pim
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
173
structure length
169
Chain Sequence
EEERAFLVAREELASALRRDSGQAFSLEQLRPLLASSLPLAARYLQLDAARLVRCNAHGEPRNYLNTLSTALNILEKYGRNLLSPQRPRYWRGVKFNNPVFRSTVDAVQGGRDVLRLYGYTEELSFPEGQEEPDEHQVATVTLEVLLLRTELSLLLQNTHPRQQALEQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E3 ubiquitin-protein ligase RNF31
publication title Binding of OTULIN to the PUB domain of HOIP controls NF-kappa B signaling.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 49
structure length 169
sequence length 173
chains with identical sequence C
ec nomenclature ec 2.3.2.31: RBR-type E3 ubiquitin transferase.
pdb deposition date 2014-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09409 PUB PUB domain
A PF18486 PUB_1 PNGase/UBA- or UBX-containing domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.2190 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4p0bA00
2D5UA 5LJMA 4OYJA 2HPJA 2CCQA 4P0BA 4OYKA 4JUYA 2HPLA 2CM0A 4P0AA 4P09A 5LJNA
chains in the Genus database with same CATH superfamily
5L3GB 4U31A 4UXNB 2YK0A 4PFPA 4TWDA 4X1YE 4IDZA 2IC9A 3M65A 4HTEA 1LVKA 2YDRA 1LKXA 3IEEA 2IHR1 5LA6E 4IT4A 3F2EA 2YKSA 3ONXA 1YXRA 3QNUA 2I0MA 2QGSA 1R8IA 3ANWB 4PJNA 3AVSA 3FBZA 4H63V 2X9XA 4DIDB 2F4VT 5H6QB 3KV9A 4DR7T 1I6ZA 3H3AA 3RKOA 2WCAA 3PV0F 3SS1A 1E7PA 1KF6A 2V26A 3UUBA 2YDSA 1IBMT 1W0AA 4TN7B 1SA0E 2H3RA 4ASKA 2NP9A 4GK0E 2E9XC 3ZYMA 1KFYA 1YKEB 3AB3B 2UXNB 3BK9A 2KLQA 3MZKB 3OYZA 1X9BA 2PJQA 2A2FX 5TAOA 4AQFC 2VVNA 2ZLYA 1T98A 2WU5A 2DL1A 4YJ3E 3NZPA 4DV4T 3Q2MA 1U5PA 1HNXT 3RC8A 3ZKRA 3N2KE 1HX8A 1T72A 2E2AA 5HXCA 3EABA 5LXTE 4DV6T 1N36T 2XQ5A 2K5BB 1WR0A 2ODUA 3PUWF 2XM1A 3ZYKA 2V5DA 3SFDA 4P09A 4QKNA 3OYXA 4WYVA 1MMDA 3P4RA 3LK2B 3LSVA 4X5TA 5FXXA 5HCMA 2KNDA 4HFIA 4K0KT 3KVBA 4EB6E 3RRWA 4EXTA 2VK9A 2J62A 4HFVA 4PAGA 5ADXL 4EEDA 2SPCA 3RYHE 3VKGA 5DQVA 3TLVA 3FBLA 3HL6A 2LSJA 3PUXF 4EYUA 2EHOC 1XDOA 2V7JA 2N2NA 2RA1A 3FZMB 1L0VA 3MA9A 4JLEA 2WZIA 1I94T 3CQXC 3AEEA 1E2AA 2M6BA 3N9OA 3RX6A 2BS2A 2LSIA 1WLXA 4GKKT 1MMAA 3BQKA 2XQ9A 2XY8B 4YSYA 3AE4A 3LK42 5BR8T 1OXZA 1M62A 3UFGA 4EIWA 4A97A 4DUYT 2L8KA 3DP7A 2DHRA 2BG9E 3CQGB 2XM2A 4ZS3A 4OX9T 3ONJA 5HWYA 3ZPOA 5M4YA 3EUHA 4IE0A 2KMFA 3PUGA 4H9OC 2XQ3A 4C90A 3RF1A 4G63A 4ZHQE 1IJ5A 2QA7A 3T8OA 3ZN1B 5FVLA 1XMQT 3OBVE 1YD8G 4PFOA 2X51A 4U3CA 3HI2A 3QUJA 3ZMVB 2LHNA 2KXPB 1IBKT 3P4SA 3HKCE 4HFDA 1KNZA 2A3DA 1G73A 4UVBB 3RYIE 4X20E 2W67A 1US7B 4LFAT 4DR1T 1YQ3A 1FMWA 2WDQA 2ACXA 5JDGA 3L3PA 4KHZF 5JDQA 3C4WA 4YLHA 4IE5A 3B57A 4TZ4C 3RRCA 1ZOYA 2WM9A 5LG3A 3F31A 5KX5E 4CN4A 5DABA 5AQTB 4H63H 1N32T 1BR4A 4GYSA 3RLFF 3JC6D 5FVKA 1WFDA 2H89A 2IMLA 1QUUA 4TX5A 2H7VC 4UIGA 2D0TA 3AA1B 5LGUB 4QX7B 2JRKA 2CBJA 3LBXB 4BJMA 2BS4A 3UQ4A 4X66T 2OV9A 2X68A 4H9NC 4OYJA 3ZMUB 5AQGB 5L4HA 1MIYA 2DWGA 2XQYA 3VR8A 4UELA 3RYCE 2UUCT 3AE1A 3FZLB 2LRKA 2CWOA 4P0AA 2FJBA 5KXJA 1HS7A 3T1HT 3LG7A 2NOXA 2Y8DA 5HWXA 2LM2A 5JDNA 2WMNA 1QSDA 4ZI2C 2V7MA 4KX6A 3BQIA 4GYRA 3EI0A 5LYJE 5H6RB 3FZFB 2D5UA 1HNZT 1XZYA 4O4LE 3X1DA 4E7SA 1J5ET 3NRYA 3ZT6A 4X62T 2Q9QA 4IE4A 3RIAA 2JPFA 4M1PA 3AAIA 3GN5A 4YSXA 3LFMA 3C98B 2VWAA 3JAEA 3MK7C 4I50E 4Z90A 3OPCA 5LMNT 3O1JA 2XQAA 2QYWA 5CA0E 1KNPA 4LFBT 5C8YE 1OEDE 2NW7A 5FXWA 2LEHA 1KK7A 3ZCJA 4P0BA 4HEAA 3FZKB 4HWDA 5JDFA 1ZP0A 5HXRA 5AQMB 1LRZA 5HAXA 2PG8A 4ISSA 3KINB 4TWHA 3A5XA 2V6XA 2XAHB 3AE2A 3N2GE 4CI3B 3KFWX 2LSYA 4L5GA 5GONE 2X9YA 5JVDE 1O3XA 3PTRB 4HWIB 3AA0B 4EAHA 2XAQB 5FMNA 3KBUA 3R84B 4JV5T 2DNXA 2XAJB 4JI2T 2V7KA 5FNVE 4U7IA 5HCJA 2NTYA 2X0HA 2ZM0A 4JI5T 1MIWA 1Y01A 4U72A 3IF8B 5EK2A 1NENA 5AQRB 2LT3A 4IREA 2LHRA 4AKRB 2UXXB 4ILBA 2XJ7A 4BA9A 4WBNE 3VKHA 5FY1A 4LF8T 5IHYA 5AQHB 1HCIA 1W09A 4ISTA 3PUZF 4KBMB 1FMVA 3HKBE 1KEYA 5LHHB 4DR6T 4L0RA 4B6XA 4UEMA 1T7SA 2LKGA 3ZT7A 3K8PC 3VRBA 5AQNB 4WBOA 2BVMA 3OKQA 1W9RA 4KP3C 5CJ5A 3F57A 2X9WA 2CE7A 3O4XE 5AQJB 1X79A 4O4JE 5LNKA 3Q5DA 3RI5A 4KI0F 3MJXA 5AFUL 2CEAA 2JQHA 2X0LB 1MIVA 5AQIB 2FJAA 2VQFT 5EK4A 3J9X1 1BR0A 4ERRA 2YOEA 2UUAT 5IYZE 1S94A 3U3IA 3UFEA 3CMLA 3SOLA 3RIUC 5KDMC 3KVAA 5LHGB 4IL4A 3UU8A 4LF4T 3VRAA 5FP3A 3PU8A 3V5SA 3WAJA 3EVYA 4QWNB 4CI1B 1D0YA 2CXLA 4UF0A 2A72A 2MOZA 5HEUA 3N9PA 2GK9A 4U74A 3C50A 5LOVE 3UT5E 4CN1A 1LVFA 4IDOA 4BAYB 1B7TA 2BG9A 2JQKA 3ZJ1A 2WWUA 4YT0A 2M6IA 2HPLA 2N1GA 5AQUB 2V7LA 2LKHA 1ZHCA 1CUNA 2K9AA 5E0OA 2IUBA 2Q9QD 2W2UA 4KMCA 3N9LA 2WP9A 4BJNA 2J1DG 4H9QC 3UQ7A 2K48A 4DO0A 4NXNT 4HE8A 2KZ7B 1Z8UA 2WSSV 4AKLA 2CMRA 3MXZA 2KSRA 3RYFE 5FXVA 2YU2A 4TWFA 3ZC1A 3QB5A 2A9UA 2YEVC 1KNRA 1W0BA 3ONLC 4O2AE 2L9QA 2W00A 1WRDA 3JC6C 2JJ9A 4GOUA 5FYMA 3ZMZB 2KINB 1V9DA 2NW8A 4LMJA 2W0GA 2CBIA 1JNZA 4HKAA 4NUUA 3TKLB 2ODVA 2YU1A 4IGUA 5JRCA 1MNDA 4CI2B 2YN6A 3AEAA 2VKHA 3UTKA 3O9XA 4ILUA 3T1YT 2W4XA 1SE7A 3B5MA 3UUNA 1MMGA 4IL9A 4OK0A 4TV9E 2HH7A 2D2SA 3O1IA 4Z91A 5EK3A 4DMWA 4OYKA 2V6YB 2I59A 2UXBT 2WQYA 1FEWA 3JCFA 1VRBA 5L3CB 4YHHT 4I4TE 5AQFB 1M7KA 3E0ZA 2JQQA 3TLWA 2VL8A 2AXDS 3Q5EA 4QXBB 2V6YA 4YXDA 1EZ3A 2VB6A 3N2OA 3CVRA 3LK3B 3K3NA 3RPUA 5L3DB 2MAWA 1AJ3A 5EZYE 4LF7T 3QB5K 5KMGP 1J5WA 5JQGE 4JBWF 5HXHA 3Q9DA 3Q5WA 1OEDA 4O8SA 5ABHA 4EZ4A 2CPTA 5ETWA 3EDVA 3ZN0B 3V5UA 4PJJA 5JR9A 3IHRA 3AVRA 4AQYT 2Z6EA 4YTMA 2AE9A 3AEDA 4XZCA 4C91A 4CXYA 4DUZT 3NBXX 4OHFA 3KV5A 5BMVE 2LJLA 2WS3A 2BVLA 2V7IA 2BKOA 5LBQB 3MACA 3EHZA 4DV3T 3I9WA 3W15B 2KWHA 2C0SA 3RQUA 3Q5XA 4H9SE 4KUMB 2K3WA 1N34T 2Q9QB 4AKGA 3ZJ2A 1WYCA 3DTOA 1UK5A 4CZZB 3GN5B 4CN6A 2LRLA 3JAFA 2I6HA 4B3TT 4H9RC 4Q25A 1HTJF 2HN2A 3RC3A 4DR2T 2WBLA 2XHEB 2V1DB 4QXHB 1NWMX 2CHOA 3UU3A 4GIWA 4ADZA 2CM0A 1YQ4A 4YFSA 3KV4A 4IDPA 3SFEA 4ILAA 1T8BA 3P4PA 3PURA 4DV7T 4NIQA 4O4HE 1WR6A 3SRZA 3MKDA 3AE8A 4EOZB 4LF5T 4EZHA 5C3JA 2X9HA 3A8YC 2W61A 5ABFA 1SUMB 5JREA 3AXJA 4JI1T 4U2ZA 2MPKA 3VR9A 5F3JA 2NR4A 4N78D 1UX5A 4QX8B 2ZM6T 5DQWA 5AQPB 4TNVA 3L8RA 2DCFA 3LDQB 5FKYA 2J4GA 2WZHA 1D1BA 4YSZA 2E5LT 5J0ZA 1HG2A 4DR4T 3ZYLA 4CXXA 2WB5A 1G8XA 4ZEYA 3OVUA 4HFHA 2VURA 5FY0A 1UURA 4PW8A 2B76A 1VCTA 3ABVA 3AEBA 4JI3T 2OA5A 4EGWA 2L3LA 3ZC0A 1GQEA 5AQLB 2YINA 3GA8A 4DBQA 2C5IT 3N9QA 5HXEA 4UV8B 5J2UE 3ZSTA 4QHOA 4UVAB 2X0YA 3AE9A 1JNRA 3VU7H 4JYAT 4DV5T 2HN1A 5L3BB 3P50A 2XTLA 4X64T 2WMOA 1BR1A 3ZEFB 3WAKA 3E22E 2E9XA 5JH7E 2BS3A 4EV6A 1HX1B 3UULA 5LG4A 3CIRA 5FL0A 1S35A 5ABGA 3I1AA 2ZMAA 3EAMA 2KT9A 1YKHB 2WAUA 2Q9QC 1ZEEA 4AI6A 5CGMA 4JI7T 1SHZC 2H7OA 4U7YA 2XASB 3CPZA 4AQFA 4YTPA 3PJAA 3EDUA 4L9IA 4AQGA 2QRXA 5L2LA 4IDNA 4XBFB 3C4ZA 3J7Yq 4GKJT 2FBWA 4LMKA 3ZT5A 4JI8T 2D9DA 5LB7B 4CQIA 1HG5A 1FIOA 5FXZA 4IE7A 4DR3T 2D0UA 5AQVB 2LSGA 5AQQB 2WU2A 4I0UA 1UUSA 2MBGA 4QH4A 2NTXA 3UU4A 2LM9A 4ZS2A 1QLBA 4B3MT 2FUPA 4I55E 2XSAA 2EHOB 3K3OA 4HWCA 4WZXA 4B3RT 2DLRA 3ZMTB 4UF0B 4TV8E 2N9DA 1YW0A 2P9BA 3UUMA 3VHLA 3NRXA 4AISA 4NXMT 1XNQT 4DBRA 3OJAA 2LSKA 2X67A 3HR0A 2EHOA 3PUSA 4QH1A 4MLKA 2BG9B 3S4UA 5HEHA 2BBJA 5LGTB 5F5WA 5JDMA 5HEOA 2WDRA 3ANWA 4MFRA 3O1HA 4IHJE 3PUAA 1VCSA 2LE8A 2BKNA 2J47A 5LHIB 4B3ST 2XAGB 3K3QC 2CA5A 2LLYA 3CX8B 4I43B 4EEBA 4NUVA 3AE5A 2HPJA 1HR0T 2IAKA 3FZHB 4A98A 3B13A 5IUXA 4LFCT 1ZV4X 2UU9T 1Z0PA 2V8SV 1WCRA 3FXDB 4PJLA 4O2BE 4F6RC 5L3FB 4LMLA 2H88A 2ZM2A 4DV0T 4WNKA 2Y48B 1IAPA 3AAEB 3RHWA 4JI6T 2LOPA 1NEKA 2OLTA 3RKGA 3CX7B 4A56A 3PUQA 2UUBT 2UXCT 2CHNA 2PFVA 5J2TE 4HFBA 3CQCB 4F8HA 4AKIA 4ZI3D 3P4WA 2JMHA 2XAFB 4ZOLE 3FXEB 1UX4A 1Y64B 3I0QA 5JDHA 2JQ9A 2XUEA 2G0UA 3OTOT 5AQOB 4YTNA 2WY2A 2C5KT 2CCQA 2BKPA 3UUXB 5FY7A 5JRCB 3AECA 2E8IA 2JMKA 2IC6A 4DMVA 2JIWA 2RPAA 3RH3A 3GWHA 4LF9T 4J2CA 2ZM8A 1H7CA 3D0TA 5F8PA 4JUYA 1VOMA 5LCYA 4YHJA 1UCUA 3SWHA 3P7IA 1HFAA 4KHPT 3ZMSB 2WDVA 4FI5A 4V1Av 3IA3A 2XSBA 2CLYB 1HNWT 1XDPA 2X66A 1N33T 3AE6A 1D0ZA 1XMOT 3H3MA 3P8CD 2BDEA 2IW5B 2BG9C 4PK4A 2ACZA 3QK6A 4HWHA 3L09A 1HF8A 5LJNA 1D1AA 4EYYR 3AE7A 4PJMA 2E9XD 3PE0A 4ZI7E 3C51A 4A5XA 5HEGA 5HEJA 4TUYE 2MYSA 3HA4A 3N9MA 3KDSE 1UGOA 2XQ6A 3TLTA 2XQ4A 3PJAJ 3IBPA 3TLUA 3CK6A 4CXWA 2R6GF 1OEDB 3ETVA 4DV1T 4UVCB 4MBQA 4QH5A 2VKJA 4MALA 4X1IE 3AA6B 4HFEA 5CFBA 3H37A 5JR9B 2W62A 5AQSB 4P1NA 5HXSA 4DV2T 2XPKA 4PNIA 2IIUA 3R6NA 2RP4A 1OWAA 2M67A 3A7MA 5A1LA 4IDQA 3AEGA 1XNRT 3ZCIA 3AEFA 3BQLA 4NPPA 1U4QA 2UXDT 3AA7B 3U78A 2MTQA 3DJBA 3I9YA 2CXFA 2VKDA 4MHCA 3PUVF 4ZXLA 2NWBA 3PDYA 3N5LA 4XAXB 4QXCB 3JADA 1E1HB 3PUYF 5JDLA 2EHOD 2KWIB 2DWKA 2PBIA 2B1EA 1FJGT 2QVAA 1XWMA 4GK5E 3M3ZB 4PK6A 3KBTA 2FJDA 3L39A 3UU5A 2K24A 2YDQA 3RGLA 4K0UA 2CLYC 5LJMA 4TNWA 3LBXA 4X65T 3QOFA 3NWIA 2W63A 2VQET 5CA1E 3ZLIA 5ABEA 4G2AA 4AKHA 3AE3A 3RQWA 3HKEE 2VASA 5ABFB 4IE6A 5L47A 3CKDA 1MNEA 4DR5T 4IIJE 4AIUA 2PTFA 2CXDA 1D0XA 4OFZA 3AXJB 3LJCA 3E08A 4HGAA 3QC9A 2VVSA 2LOSA 4UR9A 3FHNA 5L3EB 5LP6E 5AQKB 1ZKEA 2W66A 3PU3A 4JEHB 5L4EA 2C5JA 4YY3T 1OEDC 4H9PC 1NAFA 3ESLA 4DNDA 2NW9A 4UV9B 2VKOA 4HWFA 3KV6A 1D1CA 4PK5A 4HFCA 4ZZCA 3TLSA 5JR9C 2BBHA 1BR2A 4WW0A 2XZEA 1MMNA 4ANJA 2FJEA 3HKDE 5FL1A 5LBMA 4ILCA 4LF6T 5DJQC 3ETUA 2V5CA 2CRBA 5C2TA 4COFA 1WYBA 5IWAT 4DVDA 5LMUT 4HN9A 1DU2A 3CX6B 3NKZA 2E5VA 2E9XB 2HHHT 2XQ7A 5CB4E 2CWYA 4FJOA 4JI4T 3RIUA 3CWZB 3UU6A 1CHUA 3I0OA 1J1JA 4JEUB 3AAAB 4AXPA 4U33A 3K1SA 4ZZBA 4Z8XA 4U2YA 2DI4A 2Y6XA 3RIFA 5J1GA 3NZQA 3ZSSA 3N9NA 3GMIA 3P4QA 3FB2A 5LGNB 3C4XA 4YJ2E 3WI3A 2VL0A 1IJ6A 1IZNB 5HYAA 4ZI3C 2XQ8A 2IDOB 4O4IE 2WWVA 1IBLT 4ZI2D 2BZBA 4E7ZA 4JI0T 4X1KE 3NVOA 3C64A 2ES0A 5JTGA 3G06A
chains in the Genus database with same CATH topology
3K3NA 3RPUA 5L3GB 5L3DB 5CA0E 2JMHA 1AJ3A 5EZYE 4UXNB 2XAFB 2YK0A 4PFPA 4X1YE 4ZOLE 5C8YE 4IDZA 2IC9A 1UX4A 3FXEB 1Y64B 3I0QA 3M65A 2NW7A 5JDHA 5KMGP 4HTEA 5FXWA 1LVKA 5JQGE 2LEHA 1LKXA 3Q9DA 5HXHA 3Q5WA 2XUEA 4O8SA 3IEEA 1KK7A 3ZCJA 2G0UA 5LA6E 4EZ4A 4P0BA 3F2EA 4HEAA 5ETWA 3EDVA 5JDFA 2C5KT 2CCQA 3ZN0B 5HXRA 3V5UA 1LRZA 5HAXA 2PG8A 3UUXB 3ONXA 5FY7A 4PJJA 5JRCB 4ISSA 5JR9A 2QGSA 3IHRA 2E8IA 3AVRA 2JMKA 2IC6A 4DMVA 3KINB 3ANWB 2Z6EA 4PJNA 3AVSA 3RH3A 3GWHA 3FBZA 4XZCA 4H63V 4C91A 4CXYA 2X9XA 3A5XA 4J2CA 2XAHB 3NBXX 2ZM8A 3KV5A 4OHFA 5BMVE 3N2GE 1H7CA 5H6QB 3KFWX 2LJLA 4CI3B 2LSYA 3KV9A 4L5GA 2BVLA 3H3AA 3D0TA 2X9YA 5GONE 3RKOA 5F8PA 4JUYA 5JVDE 1O3XA 1VOMA 2V7IA 4YHJA 3PTRB 5LBQB 1UCUA 5LCYA 3SWHA 3SS1A 3P7IA 1HFAA 3AA0B 3ZMSB 4EAHA 2XAQB 3MACA 3KBUA 4FI5A 5FMNA 2V26A 4V1Av 3I9WA 3R84B 2DNXA 2XAJB 4TN7B 1SA0E 2H3RA 4ASKA 2CLYB 3W15B 2X66A 2KWHA 2NP9A 2V7KA 1D0ZA 2E9XC 4GK0E 5FNVE 2C0SA 3ZYMA 2NTYA 2ZM0A 3P8CD 1MIWA 3Q5XA 4U72A 1YKEB 2BDEA 3IF8B 4H9SE 2IW5B 4PK4A 3AB3B 5EK2A 3QK6A 4KUMB 5LP6E 2LT3A 2UXNB 3BK9A 2LHRA 3L09A 2Q9QB 2KLQA 3ZJ2A 1HF8A 4AKGA 1WYCA 4AKRB 3DTOA 5LJNA 2UXXB 1D1AA 4EYYR 4BA9A 4CZZB 3GN5B 4PJMA 2E9XD 3MZKB 3OYZA 3PE0A 2PJQA 2A2FX 4H9RC 5TAOA 4AQFC 1HTJF 4WBNE 3RC3A 4ZI7E 3VKHA 3C51A 5FY1A 2WBLA 2XHEB 5IHYA 2V1DB 2ZLYA 4QXHB 1NWMX 4TUYE 4GIWA 2MYSA 1T98A 4ADZA 2CM0A 1HCIA 3HA4A 4YFSA 3N9MA 3KDSE 4YJ3E 3NZPA 4ISTA 3Q2MA 4KBMB 1U5PA 3IBPA 3KV4A 1FMVA 3HKBE 4CXWA 5LHHB 4L0RA 3RC8A 3PURA 3N2KE 1HX8A 4B6XA 5HXCA 4UEMA 5LXTE 4O4HE 3ETVA 1WR6A 3K8PC 3SRZA 3MKDA 4UVCB 4EOZB 4MBQA 4WBOA 2K5BB 4EZHA 2BVMA 2VKJA 3OKQA 4MALA 4X1IE 3AA6B 2ODUA 4KP3C 2X9HA 2W61A 3H37A 5JR9B 2W62A 3ZYKA 3F57A 2X9WA 5HXSA 4P09A 4QKNA 5JREA 2CE7A 3OYXA 4PNIA 1MMDA 3O4XE 3R6NA 1X79A 2RP4A 4O4JE 3LK2B 5LNKA 5F3JA 5FXXA 2KNDA 1OWAA 2M67A 3KVBA 4EB6E 4N78D 1UX5A 4QX8B 5A1LA 3RRWA 4EXTA 2VK9A 3MJXA 5DQWA 5AFUL 2CEAA 2X0LB 4HFVA 3ZCIA 2DCFA 4PAGA 5ADXL 1MIVA 2SPCA 1D1BA 3BQLA 1U4QA 3RYHE 3VKGA 1HG2A 3AA7B 3U78A 5EK4A 5DQVA 3J9X1 3FBLA 1BR0A 2MTQA 3HL6A 2LSJA 4ERRA 4EYUA 3DJBA 2EHOC 3ZYLA 4CXXA 2V7JA 3I9YA 2N2NA 1G8XA 2RA1A 5IYZE 1S94A 3U3IA 2CXFA 2VKDA 4MHCA 5FY0A 3CMLA 3UFEA 3MA9A 4JLEA 3SOLA 2NWBA 3PDYA 3KVAA 5KDMC 3CQXC 3N5LA 5LHGB 4XAXB 4PW8A 4QXCB 2OA5A 3N9OA 3RX6A 2L3LA 1E1HB 3ZC0A 5JDLA 5FP3A 3PU8A 3V5SA 2LSIA 3WAJA 1WLXA 2YINA 3EVYA 3GA8A 2EHOD 1MMAA 3BQKA 4DBQA 2C5IT 2KWIB 3N9QA 5HXEA 4UV8B 4QWNB 5J2UE 4CI1B 3LK42 4QHOA 1OXZA 2DWKA 1D0YA 2B1EA 2CXLA 2PBIA 4UVAB 4GK5E 4UF0A 4EIWA 2A72A 2MOZA 3VU7H 2L8KA 4PK6A 3KBTA 3DP7A 3N9PA 5L3BB 2DHRA 2GK9A 2XTLA 2WMOA 1BR1A 4U74A 3ZEFB 2K24A 3C50A 5LOVE 3WAKA 3UT5E 3CQGB 4K0UA 3E22E 2CLYC 2E9XA 5JH7E 5LJMA 4ZS3A 1LVFA 3LBXA 4BAYB 1B7TA 3UULA 5HWYA 5LG4A 1S35A 3I1AA 3ZPOA 2ZMAA 3ZJ1A 2W63A 2WWUA 5M4YA 3EUHA 4IE0A 5CA1E 2KMFA 3ZLIA 2KT9A 3PUGA 4H9OC 1YKHB 2WAUA 2Q9QC 4G2AA 1ZEEA 4AKHA 4AI6A 2HPLA 2N1GA 1SHZC 2H7OA 2XASB 3HKEE 4C90A 2VASA 3CPZA 4AQFA 4G63A 4IE6A 4ZHQE 1IJ5A 3CKDA 2QA7A 3EDUA 3T8OA 3ZN1B 4L9IA 1MNEA 3OBVE 4IIJE 4AQGA 2V7LA 2CXDA 1D0XA 4OFZA 1YD8G 3LJCA 3E08A 4HGAA 1ZHCA 3QC9A 1CUNA 2K9AA 4PFOA 5E0OA 2X51A 5L2LA 2LOSA 2Q9QD 4XBFB 3FHNA 3HI2A 4KMCA 5L3EB 3N9LA 3QUJA 3ZMVB 4BJNA 2LHNA 2J1DG 2KXPB 3C4ZA 1ZKEA 2K48A 4H9QC 4DO0A 3J7Yq 3PU3A 3HKCE 2KZ7B 4HE8A 4JEHB 1KNZA 2WSSV 4CQIA 4AKLA 2A3DA 1HG5A 2C5JA 1G73A 2CMRA 4UVBB 1FIOA 3RYIE 3MXZA 5FXZA 4IE7A 4X20E 3RYFE 4H9PC 1US7B 1NAFA 5FXVA 3ESLA 2YU2A 2D0UA 1FMWA 2ACXA 4DNDA 5JDGA 2LSGA 3ZC1A 3L3PA 5JDQA 2NW9A 3C4WA 4UV9B 2VKOA 3KV6A 4YLHA 1D1CA 4PK5A 2YEVC 4IE5A 3B57A 5JR9C 4TZ4C 4O2AE 1BR2A 2MBGA 2L9QA 3RRCA 4WW0A 2WM9A 2NTXA 2W00A 1WRDA 3JC6C 2LM9A 1MMNA 4ZS2A 4ANJA 2JJ9A 4GOUA 3HKDE 4I55E 5FYMA 3ZMZB 2KINB 1V9DA 3F31A 5KX5E 5LBMA 2NW8A 2EHOB 5DABA 4H63H 3K3OA 5DJQC 2DLRA 3ETUA 3ZMTB 4UF0B 4TV8E 2N9DA 1YW0A 1WYBA 2P9BA 1BR4A 2W0GA 4GYSA 4DVDA 3JC6D 3UUMA 3VHLA 4HN9A 3NRXA 1QUUA 3CX6B 4TX5A 4HKAA 2H7VC 4NUUA 4UIGA 2D0TA 3AA1B 3TKLB 4DBRA 3OJAA 4QX7B 2LSKA 2X67A 3HR0A 2EHOA 3PUSA 2E9XB 5LGUB 2JRKA 2ODVA 4MLKA 2YU1A 3LBXB 5CB4E 4IGUA 2CWYA 5JRCA 4FJOA 4BJMA 3S4UA 1MNDA 5LGTB 2X68A 4H9NC 4OYJA 3ZMUB 5JDMA 1MIYA 3ANWA 3CWZB 4MFRA 2DWGA 3O1HA 4IHJE 2XQYA 3PUAA 4UELA 2LE8A 4CI2B 5LHIB 3I0OA 3RYCE 2VKHA 4JEUB 2XAGB 3UTKA 3AAAB 4AXPA 3K3QC 2CWOA 3O9XA 2CA5A 4P0AA 4ILUA 3CX8B 4I43B 4NUVA 4Z8XA 2HPJA 2IAKA 1HS7A 2DI4A 2Y6XA 3LG7A 2NOXA 5J1GA 3UUNA 3NZQA 2Y8DA 1MMGA 3B13A 3N9NA 3GMIA 1ZV4X 3FB2A 4OK0A 4TV9E 5HWXA 1Z0PA 5LGNB 3C4XA 2HH7A 4YJ2E 5JDNA 3FXDB 4PJLA 2WMNA 1QSDA 4ZI2C 2D2SA 4O2BE 3WI3A 3O1IA 4F6RC 2V7MA 5L3FB 5EK3A 3BQIA 2ZM2A 4DMWA 1IJ6A 4GYRA 4OYKA 4WNKA 2I59A 1IZNB 2Y48B 5LYJE 5H6RB 1FEWA 2D5UA 4O4LE 4E7SA 3NRYA 1IAPA 1VRBA 3AAEB 5HYAA 2LOPA 4ZI3C 5L3CB 2Q9QA 4O4IE 4IE4A 4I4TE 2JPFA 3CX7B 4M1PA 3AAIA 4ZI2D 3GN5A 3E0ZA 4A56A 2JQQA 3LFMA 2BZBA 3PUQA 4E7ZA 4X1KE 3C98B 2VWAA 2PFVA 3MK7C 4I50E 2VL8A 5J2TE 4QXBB 1EZ3A 2VB6A 3N2OA 3CQCB 3O1JA 3C64A 4ZI3D 2ES0A 3CVRA 4AKIA 3LK3B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D5U A;  5LJM A;  4OYJ A;  2HPJ A;  2CCQ A;  4P0B A;  4OYK A;  4JUY A;  2HPL A;  2CM0 A;  4P0A A;  4P09 A;  5LJN A; 
#chains in the Genus database with same CATH topology
 5L3G B;  4U31 A;  4UXN B;  2YK0 A;  4PFP A;  4TWD A;  4X1Y E;  4IDZ A;  2IC9 A;  3M65 A;  4HTE A;  1LVK A;  2YDR A;  1LKX A;  3IEE A;  2IHR 1;  5LA6 E;  4IT4 A;  3F2E A;  2YKS A;  3ONX A;  1YXR A;  3QNU A;  2I0M A;  2QGS A;  1R8I A;  3ANW B;  4PJN A;  3AVS A;  3FBZ A;  4H63 V;  2X9X A;  4DID B;  2F4V T;  5H6Q B;  3KV9 A;  4DR7 T;  1I6Z A;  3H3A A;  3RKO A;  2WCA A;  3PV0 F;  3SS1 A;  1E7P A;  1KF6 A;  2V26 A;  3UUB A;  2YDS A;  1IBM T;  1W0A A;  4TN7 B;  1SA0 E;  2H3R A;  4ASK A;  2NP9 A;  4GK0 E;  2E9X C;  3ZYM A;  1KFY A;  1YKE B;  3AB3 B;  2UXN B;  3BK9 A;  2KLQ A;  3MZK B;  3OYZ A;  1X9B A;  2PJQ A;  2A2F X;  5TAO A;  4AQF C;  2VVN A;  2ZLY A;  1T98 A;  2WU5 A;  2DL1 A;  4YJ3 E;  3NZP A;  4DV4 T;  3Q2M A;  1U5P A;  1HNX T;  3RC8 A;  3ZKR A;  3N2K E;  1HX8 A;  1T72 A;  2E2A A;  5HXC A;  3EAB A;  5LXT E;  4DV6 T;  1N36 T;  2XQ5 A;  2K5B B;  1WR0 A;  2ODU A;  3PUW F;  2XM1 A;  3ZYK A;  2V5D A;  3SFD A;  4P09 A;  4QKN A;  3OYX A;  4WYV A;  1MMD A;  3P4R A;  3LK2 B;  3LSV A;  4X5T A;  5FXX A;  5HCM A;  2KND A;  4HFI A;  4K0K T;  3KVB A;  4EB6 E;  3RRW A;  4EXT A;  2VK9 A;  2J62 A;  4HFV A;  4PAG A;  5ADX L;  4EED A;  2SPC A;  3RYH E;  3VKG A;  5DQV A;  3TLV A;  3FBL A;  3HL6 A;  2LSJ A;  3PUX F;  4EYU A;  2EHO C;  1XDO A;  2V7J A;  2N2N A;  2RA1 A;  3FZM B;  1L0V A;  3MA9 A;  4JLE A;  2WZI A;  1I94 T;  3CQX C;  3AEE A;  1E2A A;  2M6B A;  3N9O A;  3RX6 A;  2BS2 A;  2LSI A;  1WLX A;  4GKK T;  1MMA A;  3BQK A;  2XQ9 A;  2XY8 B;  4YSY A;  3AE4 A;  3LK4 2;  5BR8 T;  1OXZ A;  1M62 A;  3UFG A;  4EIW A;  4A97 A;  4DUY T;  2L8K A;  3DP7 A;  2DHR A;  2BG9 E;  3CQG B;  2XM2 A;  4ZS3 A;  4OX9 T;  3ONJ A;  5HWY A;  3ZPO A;  5M4Y A;  3EUH A;  4IE0 A;  2KMF A;  3PUG A;  4H9O C;  2XQ3 A;  4C90 A;  3RF1 A;  4G63 A;  4ZHQ E;  1IJ5 A;  2QA7 A;  3T8O A;  3ZN1 B;  5FVL A;  1XMQ T;  3OBV E;  1YD8 G;  4PFO A;  2X51 A;  4U3C A;  3HI2 A;  3QUJ A;  3ZMV B;  2LHN A;  2KXP B;  1IBK T;  3P4S A;  3HKC E;  4HFD A;  1KNZ A;  2A3D A;  1G73 A;  4UVB B;  3RYI E;  4X20 E;  2W67 A;  1US7 B;  4LFA T;  4DR1 T;  1YQ3 A;  1FMW A;  2WDQ A;  2ACX A;  5JDG A;  3L3P A;  4KHZ F;  5JDQ A;  3C4W A;  4YLH A;  4IE5 A;  3B57 A;  4TZ4 C;  3RRC A;  1ZOY A;  2WM9 A;  5LG3 A;  3F31 A;  5KX5 E;  4CN4 A;  5DAB A;  5AQT B;  4H63 H;  1N32 T;  1BR4 A;  4GYS A;  3RLF F;  3JC6 D;  5FVK A;  1WFD A;  2H89 A;  2IML A;  1QUU A;  4TX5 A;  2H7V C;  4UIG A;  2D0T A;  3AA1 B;  5LGU B;  4QX7 B;  2JRK A;  2CBJ A;  3LBX B;  4BJM A;  2BS4 A;  3UQ4 A;  4X66 T;  2OV9 A;  2X68 A;  4H9N C;  4OYJ A;  3ZMU B;  5AQG B;  5L4H A;  1MIY A;  2DWG A;  2XQY A;  3VR8 A;  4UEL A;  3RYC E;  2UUC T;  3AE1 A;  3FZL B;  2LRK A;  2CWO A;  4P0A A;  2FJB A;  5KXJ A;  1HS7 A;  3T1H T;  3LG7 A;  2NOX A;  2Y8D A;  5HWX A;  2LM2 A;  5JDN A;  2WMN A;  1QSD A;  4ZI2 C;  2V7M A;  4KX6 A;  3BQI A;  4GYR A;  3EI0 A;  5LYJ E;  5H6R B;  3FZF B;  2D5U A;  1HNZ T;  1XZY A;  4O4L E;  3X1D A;  4E7S A;  1J5E T;  3NRY A;  3ZT6 A;  4X62 T;  2Q9Q A;  4IE4 A;  3RIA A;  2JPF A;  4M1P A;  3AAI A;  3GN5 A;  4YSX A;  3LFM A;  3C98 B;  2VWA A;  3JAE A;  3MK7 C;  4I50 E;  4Z90 A;  3OPC A;  5LMN T;  3O1J A;  2XQA A;  2QYW A;  5CA0 E;  1KNP A;  4LFB T;  5C8Y E;  1OED E;  2NW7 A;  5FXW A;  2LEH A;  1KK7 A;  3ZCJ A;  4P0B A;  4HEA A;  3FZK B;  4HWD A;  5JDF A;  1ZP0 A;  5HXR A;  5AQM B;  1LRZ A;  5HAX A;  2PG8 A;  4ISS A;  3KIN B;  4TWH A;  3A5X A;  2V6X A;  2XAH B;  3AE2 A;  3N2G E;  4CI3 B;  3KFW X;  2LSY A;  4L5G A;  5GON E;  2X9Y A;  5JVD E;  1O3X A;  3PTR B;  4HWI B;  3AA0 B;  4EAH A;  2XAQ B;  5FMN A;  3KBU A;  3R84 B;  4JV5 T;  2DNX A;  2XAJ B;  4JI2 T;  2V7K A;  5FNV E;  4U7I A;  5HCJ A;  2NTY A;  2X0H A;  2ZM0 A;  4JI5 T;  1MIW A;  1Y01 A;  4U72 A;  3IF8 B;  5EK2 A;  1NEN A;  5AQR B;  2LT3 A;  4IRE A;  2LHR A;  4AKR B;  2UXX B;  4ILB A;  2XJ7 A;  4BA9 A;  4WBN E;  3VKH A;  5FY1 A;  4LF8 T;  5IHY A;  5AQH B;  1HCI A;  1W09 A;  4IST A;  3PUZ F;  4KBM B;  1FMV A;  3HKB E;  1KEY A;  5LHH B;  4DR6 T;  4L0R A;  4B6X A;  4UEM A;  1T7S A;  2LKG A;  3ZT7 A;  3K8P C;  3VRB A;  5AQN B;  4WBO A;  2BVM A;  3OKQ A;  1W9R A;  4KP3 C;  5CJ5 A;  3F57 A;  2X9W A;  2CE7 A;  3O4X E;  5AQJ B;  1X79 A;  4O4J E;  5LNK A;  3Q5D A;  3RI5 A;  4KI0 F;  3MJX A;  5AFU L;  2CEA A;  2JQH A;  2X0L B;  1MIV A;  5AQI B;  2FJA A;  2VQF T;  5EK4 A;  3J9X 1;  1BR0 A;  4ERR A;  2YOE A;  2UUA T;  5IYZ E;  1S94 A;  3U3I A;  3UFE A;  3CML A;  3SOL A;  3RIU C;  5KDM C;  3KVA A;  5LHG B;  4IL4 A;  3UU8 A;  4LF4 T;  3VRA A;  5FP3 A;  3PU8 A;  3V5S A;  3WAJ A;  3EVY A;  4QWN B;  4CI1 B;  1D0Y A;  2CXL A;  4UF0 A;  2A72 A;  2MOZ A;  5HEU A;  3N9P A;  2GK9 A;  4U74 A;  3C50 A;  5LOV E;  3UT5 E;  4CN1 A;  1LVF A;  4IDO A;  4BAY B;  1B7T A;  2BG9 A;  2JQK A;  3ZJ1 A;  2WWU A;  4YT0 A;  2M6I A;  2HPL A;  2N1G A;  5AQU B;  2V7L A;  2LKH A;  1ZHC A;  1CUN A;  2K9A A;  5E0O A;  2IUB A;  2Q9Q D;  2W2U A;  4KMC A;  3N9L A;  2WP9 A;  4BJN A;  2J1D G;  4H9Q C;  3UQ7 A;  2K48 A;  4DO0 A;  4NXN T;  4HE8 A;  2KZ7 B;  1Z8U A;  2WSS V;  4AKL A;  2CMR A;  3MXZ A;  2KSR A;  3RYF E;  5FXV A;  2YU2 A;  4TWF A;  3ZC1 A;  3QB5 A;  2A9U A;  2YEV C;  1KNR A;  1W0B A;  3ONL C;  4O2A E;  2L9Q A;  2W00 A;  1WRD A;  3JC6 C;  2JJ9 A;  4GOU A;  5FYM A;  3ZMZ B;  2KIN B;  1V9D A;  2NW8 A;  4LMJ A;  2W0G A;  2CBI A;  1JNZ A;  4HKA A;  4NUU A;  3TKL B;  2ODV A;  2YU1 A;  4IGU A;  5JRC A;  1MND A;  4CI2 B;  2YN6 A;  3AEA A;  2VKH A;  3UTK A;  3O9X A;  4ILU A;  3T1Y T;  2W4X A;  1SE7 A;  3B5M A;  3UUN A;  1MMG A;  4IL9 A;  4OK0 A;  4TV9 E;  2HH7 A;  2D2S A;  3O1I A;  4Z91 A;  5EK3 A;  4DMW A;  4OYK A;  2V6Y B;  2I59 A;  2UXB T;  2WQY A;  1FEW A;  3JCF A;  1VRB A;  5L3C B;  4YHH T;  4I4T E;  5AQF B;  1M7K A;  3E0Z A;  2JQQ A;  3TLW A;  2VL8 A;  2AXD S;  3Q5E A;  4QXB B;  2V6Y A;  4YXD A;  1EZ3 A;  2VB6 A;  3N2O A;  3CVR A;  3LK3 B;  3K3N A;  3RPU A;  5L3D B;  2MAW A;  1AJ3 A;  5EZY E;  4LF7 T;  3QB5 K;  5KMG P;  1J5W A;  5JQG E;  4JBW F;  5HXH A;  3Q9D A;  3Q5W A;  1OED A;  4O8S A;  5ABH A;  4EZ4 A;  2CPT A;  5ETW A;  3EDV A;  3ZN0 B;  3V5U A;  4PJJ A;  5JR9 A;  3IHR A;  3AVR A;  4AQY T;  2Z6E A;  4YTM A;  2AE9 A;  3AED A;  4XZC A;  4C91 A;  4CXY A;  4DUZ T;  3NBX X;  4OHF A;  3KV5 A;  5BMV E;  2LJL A;  2WS3 A;  2BVL A;  2V7I A;  2BKO A;  5LBQ B;  3MAC A;  3EHZ A;  4DV3 T;  3I9W A;  3W15 B;  2KWH A;  2C0S A;  3RQU A;  3Q5X A;  4H9S E;  4KUM B;  2K3W A;  1N34 T;  2Q9Q B;  4AKG A;  3ZJ2 A;  1WYC A;  3DTO A;  1UK5 A;  4CZZ B;  3GN5 B;  4CN6 A;  2LRL A;  3JAF A;  2I6H A;  4B3T T;  4H9R C;  4Q25 A;  1HTJ F;  2HN2 A;  3RC3 A;  4DR2 T;  2WBL A;  2XHE B;  2V1D B;  4QXH B;  1NWM X;  2CHO A;  3UU3 A;  4GIW A;  4ADZ A;  2CM0 A;  1YQ4 A;  4YFS A;  3KV4 A;  4IDP A;  3SFE A;  4ILA A;  1T8B A;  3P4P A;  3PUR A;  4DV7 T;  4NIQ A;  4O4H E;  1WR6 A;  3SRZ A;  3MKD A;  3AE8 A;  4EOZ B;  4LF5 T;  4EZH A;  5C3J A;  2X9H A;  3A8Y C;  2W61 A;  5ABF A;  1SUM B;  5JRE A;  3AXJ A;  4JI1 T;  4U2Z A;  2MPK A;  3VR9 A;  5F3J A;  2NR4 A;  4N78 D;  1UX5 A;  4QX8 B;  2ZM6 T;  5DQW A;  5AQP B;  4TNV A;  3L8R A;  2DCF A;  3LDQ B;  5FKY A;  2J4G A;  2WZH A;  1D1B A;  4YSZ A;  2E5L T;  5J0Z A;  1HG2 A;  4DR4 T;  3ZYL A;  4CXX A;  2WB5 A;  1G8X A;  4ZEY A;  3OVU A;  4HFH A;  2VUR A;  5FY0 A;  1UUR A;  4PW8 A;  2B76 A;  1VCT A;  3ABV A;  3AEB A;  4JI3 T;  2OA5 A;  4EGW A;  2L3L A;  3ZC0 A;  1GQE A;  5AQL B;  2YIN A;  3GA8 A;  4DBQ A;  2C5I T;  3N9Q A;  5HXE A;  4UV8 B;  5J2U E;  3ZST A;  4QHO A;  4UVA B;  2X0Y A;  3AE9 A;  1JNR A;  3VU7 H;  4JYA T;  4DV5 T;  2HN1 A;  5L3B B;  3P50 A;  2XTL A;  4X64 T;  2WMO A;  1BR1 A;  3ZEF B;  3WAK A;  3E22 E;  2E9X A;  5JH7 E;  2BS3 A;  4EV6 A;  1HX1 B;  3UUL A;  5LG4 A;  3CIR A;  5FL0 A;  1S35 A;  5ABG A;  3I1A A;  2ZMA A;  3EAM A;  2KT9 A;  1YKH B;  2WAU A;  2Q9Q C;  1ZEE A;  4AI6 A;  5CGM A;  4JI7 T;  1SHZ C;  2H7O A;  4U7Y A;  2XAS B;  3CPZ A;  4AQF A;  4YTP A;  3PJA A;  3EDU A;  4L9I A;  4AQG A;  2QRX A;  5L2L A;  4IDN A;  4XBF B;  3C4Z A;  3J7Y q;  4GKJ T;  2FBW A;  4LMK A;  3ZT5 A;  4JI8 T;  2D9D A;  5LB7 B;  4CQI A;  1HG5 A;  1FIO A;  5FXZ A;  4IE7 A;  4DR3 T;  2D0U A;  5AQV B;  2LSG A;  5AQQ B;  2WU2 A;  4I0U A;  1UUS A;  2MBG A;  4QH4 A;  2NTX A;  3UU4 A;  2LM9 A;  4ZS2 A;  1QLB A;  4B3M T;  2FUP A;  4I55 E;  2XSA A;  2EHO B;  3K3O A;  4HWC A;  4WZX A;  4B3R T;  2DLR A;  3ZMT B;  4UF0 B;  4TV8 E;  2N9D A;  1YW0 A;  2P9B A;  3UUM A;  3VHL A;  3NRX A;  4AIS A;  4NXM T;  1XNQ T;  4DBR A;  3OJA A;  2LSK A;  2X67 A;  3HR0 A;  2EHO A;  3PUS A;  4QH1 A;  4MLK A;  2BG9 B;  3S4U A;  5HEH A;  2BBJ A;  5LGT B;  5F5W A;  5JDM A;  5HEO A;  2WDR A;  3ANW A;  4MFR A;  3O1H A;  4IHJ E;  3PUA A;  1VCS A;  2LE8 A;  2BKN A;  2J47 A;  5LHI B;  4B3S T;  2XAG B;  3K3Q C;  2CA5 A;  2LLY A;  3CX8 B;  4I43 B;  4EEB A;  4NUV A;  3AE5 A;  2HPJ A;  1HR0 T;  2IAK A;  3FZH B;  4A98 A;  3B13 A;  5IUX A;  4LFC T;  1ZV4 X;  2UU9 T;  1Z0P A;  2V8S V;  1WCR A;  3FXD B;  4PJL A;  4O2B E;  4F6R C;  5L3F B;  4LML A;  2H88 A;  2ZM2 A;  4DV0 T;  4WNK A;  2Y48 B;  1IAP A;  3AAE B;  3RHW A;  4JI6 T;  2LOP A;  1NEK A;  2OLT A;  3RKG A;  3CX7 B;  4A56 A;  3PUQ A;  2UUB T;  2UXC T;  2CHN A;  2PFV A;  5J2T E;  4HFB A;  3CQC B;  4F8H A;  4AKI A;  4ZI3 D;  3P4W A;  2JMH A;  2XAF B;  4ZOL E;  3FXE B;  1UX4 A;  1Y64 B;  3I0Q A;  5JDH A;  2JQ9 A;  2XUE A;  2G0U A;  3OTO T;  5AQO B;  4YTN A;  2WY2 A;  2C5K T;  2CCQ A;  2BKP A;  3UUX B;  5FY7 A;  5JRC B;  3AEC A;  2E8I A;  2JMK A;  2IC6 A;  4DMV A;  2JIW A;  2RPA A;  3RH3 A;  3GWH A;  4LF9 T;  4J2C A;  2ZM8 A;  1H7C A;  3D0T A;  5F8P A;  4JUY A;  1VOM A;  5LCY A;  4YHJ A;  1UCU A;  3SWH A;  3P7I A;  1HFA A;  4KHP T;  3ZMS B;  2WDV A;  4FI5 A;  4V1A v;  3IA3 A;  2XSB A;  2CLY B;  1HNW T;  1XDP A;  2X66 A;  1N33 T;  3AE6 A;  1D0Z A;  1XMO T;  3H3M A;  3P8C D;  2BDE A;  2IW5 B;  2BG9 C;  4PK4 A;  2ACZ A;  3QK6 A;  4HWH A;  3L09 A;  1HF8 A;  5LJN A;  1D1A A;  4EYY R;  3AE7 A;  4PJM A;  2E9X D;  3PE0 A;  4ZI7 E;  3C51 A;  4A5X A;  5HEG A;  5HEJ A;  4TUY E;  2MYS A;  3HA4 A;  3N9M A;  3KDS E;  1UGO A;  2XQ6 A;  3TLT A;  2XQ4 A;  3PJA J;  3IBP A;  3TLU A;  3CK6 A;  4CXW A;  2R6G F;  1OED B;  3ETV A;  4DV1 T;  4UVC B;  4MBQ A;  4QH5 A;  2VKJ A;  4MAL A;  4X1I E;  3AA6 B;  4HFE A;  5CFB A;  3H37 A;  5JR9 B;  2W62 A;  5AQS B;  4P1N A;  5HXS A;  4DV2 T;  2XPK A;  4PNI A;  2IIU A;  3R6N A;  2RP4 A;  1OWA A;  2M67 A;  3A7M A;  5A1L A;  4IDQ A;  3AEG A;  1XNR T;  3ZCI A;  3AEF A;  3BQL A;  4NPP A;  1U4Q A;  2UXD T;  3AA7 B;  3U78 A;  2MTQ A;  3DJB A;  3I9Y A;  2CXF A;  2VKD A;  4MHC A;  3PUV F;  4ZXL A;  2NWB A;  3PDY A;  3N5L A;  4XAX B;  4QXC B;  3JAD A;  1E1H B;  3PUY F;  5JDL A;  2EHO D;  2KWI B;  2DWK A;  2PBI A;  2B1E A;  1FJG T;  2QVA A;  1XWM A;  4GK5 E;  3M3Z B;  4PK6 A;  3KBT A;  2FJD A;  3L39 A;  3UU5 A;  2K24 A;  2YDQ A;  3RGL A;  4K0U A;  2CLY C;  5LJM A;  4TNW A;  3LBX A;  4X65 T;  3QOF A;  3NWI A;  2W63 A;  2VQE T;  5CA1 E;  3ZLI A;  5ABE A;  4G2A A;  4AKH A;  3AE3 A;  3RQW A;  3HKE E;  2VAS A;  5ABF B;  4IE6 A;  5L47 A;  3CKD A;  1MNE A;  4DR5 T;  4IIJ E;  4AIU A;  2PTF A;  2CXD A;  1D0X A;  4OFZ A;  3AXJ B;  3LJC A;  3E08 A;  4HGA A;  3QC9 A;  2VVS A;  2LOS A;  4UR9 A;  3FHN A;  5L3E B;  5LP6 E;  5AQK B;  1ZKE A;  2W66 A;  3PU3 A;  4JEH B;  5L4E A;  2C5J A;  4YY3 T;  1OED C;  4H9P C;  1NAF A;  3ESL A;  4DND A;  2NW9 A;  4UV9 B;  2VKO A;  4HWF A;  3KV6 A;  1D1C A;  4PK5 A;  4HFC A;  4ZZC A;  3TLS A;  5JR9 C;  2BBH A;  1BR2 A;  4WW0 A;  2XZE A;  1MMN A;  4ANJ A;  2FJE A;  3HKD E;  5FL1 A;  5LBM A;  4ILC A;  4LF6 T;  5DJQ C;  3ETU A;  2V5C A;  2CRB A;  5C2T A;  4COF A;  1WYB A;  5IWA T;  4DVD A;  5LMU T;  4HN9 A;  1DU2 A;  3CX6 B;  3NKZ A;  2E5V A;  2E9X B;  2HHH T;  2XQ7 A;  5CB4 E;  2CWY A;  4FJO A;  4JI4 T;  3RIU A;  3CWZ B;  3UU6 A;  1CHU A;  3I0O A;  1J1J A;  4JEU B;  3AAA B;  4AXP A;  4U33 A;  3K1S A;  4ZZB A;  4Z8X A;  4U2Y A;  2DI4 A;  2Y6X A;  3RIF A;  5J1G A;  3NZQ A;  3ZSS A;  3N9N A;  3GMI A;  3P4Q A;  3FB2 A;  5LGN B;  3C4X A;  4YJ2 E;  3WI3 A;  2VL0 A;  1IJ6 A;  1IZN B;  5HYA A;  4ZI3 C;  2XQ8 A;  2IDO B;  4O4I E;  2WWV A;  1IBL T;  4ZI2 D;  2BZB A;  4E7Z A;  4JI0 T;  4X1K E;  3NVO A;  3C64 A;  2ES0 A;  5JTG A;  3G06 A; 
#chains in the Genus database with same CATH homology
 3K3N A;  3RPU A;  5L3G B;  5L3D B;  5CA0 E;  2JMH A;  1AJ3 A;  5EZY E;  4UXN B;  2XAF B;  2YK0 A;  4PFP A;  4X1Y E;  4ZOL E;  5C8Y E;  4IDZ A;  2IC9 A;  1UX4 A;  3FXE B;  1Y64 B;  3I0Q A;  3M65 A;  2NW7 A;  5JDH A;  5KMG P;  4HTE A;  5FXW A;  1LVK A;  5JQG E;  2LEH A;  1LKX A;  3Q9D A;  5HXH A;  3Q5W A;  2XUE A;  4O8S A;  3IEE A;  1KK7 A;  3ZCJ A;  2G0U A;  5LA6 E;  4EZ4 A;  4P0B A;  3F2E A;  4HEA A;  5ETW A;  3EDV A;  5JDF A;  2C5K T;  2CCQ A;  3ZN0 B;  5HXR A;  3V5U A;  1LRZ A;  5HAX A;  2PG8 A;  3UUX B;  3ONX A;  5FY7 A;  4PJJ A;  5JRC B;  4ISS A;  5JR9 A;  2QGS A;  3IHR A;  2E8I A;  3AVR A;  2JMK A;  2IC6 A;  4DMV A;  3KIN B;  3ANW B;  2Z6E A;  4PJN A;  3AVS A;  3RH3 A;  3GWH A;  3FBZ A;  4XZC A;  4H63 V;  4C91 A;  4CXY A;  2X9X A;  3A5X A;  4J2C A;  2XAH B;  3NBX X;  2ZM8 A;  3KV5 A;  4OHF A;  5BMV E;  3N2G E;  1H7C A;  5H6Q B;  3KFW X;  2LJL A;  4CI3 B;  2LSY A;  3KV9 A;  4L5G A;  2BVL A;  3H3A A;  3D0T A;  2X9Y A;  5GON E;  3RKO A;  5F8P A;  4JUY A;  5JVD E;  1O3X A;  1VOM A;  2V7I A;  4YHJ A;  3PTR B;  5LBQ B;  1UCU A;  5LCY A;  3SWH A;  3SS1 A;  3P7I A;  1HFA A;  3AA0 B;  3ZMS B;  4EAH A;  2XAQ B;  3MAC A;  3KBU A;  4FI5 A;  5FMN A;  2V26 A;  4V1A v;  3I9W A;  3R84 B;  2DNX A;  2XAJ B;  4TN7 B;  1SA0 E;  2H3R A;  4ASK A;  2CLY B;  3W15 B;  2X66 A;  2KWH A;  2NP9 A;  2V7K A;  1D0Z A;  2E9X C;  4GK0 E;  5FNV E;  2C0S A;  3ZYM A;  2NTY A;  2ZM0 A;  3P8C D;  1MIW A;  3Q5X A;  4U72 A;  1YKE B;  2BDE A;  3IF8 B;  4H9S E;  2IW5 B;  4PK4 A;  3AB3 B;  5EK2 A;  3QK6 A;  4KUM B;  5LP6 E;  2LT3 A;  2UXN B;  3BK9 A;  2LHR A;  3L09 A;  2Q9Q B;  2KLQ A;  3ZJ2 A;  1HF8 A;  4AKG A;  1WYC A;  4AKR B;  3DTO A;  5LJN A;  2UXX B;  1D1A A;  4EYY R;  4BA9 A;  4CZZ B;  3GN5 B;  4PJM A;  2E9X D;  3MZK B;  3OYZ A;  3PE0 A;  2PJQ A;  2A2F X;  4H9R C;  5TAO A;  4AQF C;  1HTJ F;  4WBN E;  3RC3 A;  4ZI7 E;  3VKH A;  3C51 A;  5FY1 A;  2WBL A;  2XHE B;  5IHY A;  2V1D B;  2ZLY A;  4QXH B;  1NWM X;  4TUY E;  4GIW A;  2MYS A;  1T98 A;  4ADZ A;  2CM0 A;  1HCI A;  3HA4 A;  4YFS A;  3N9M A;  3KDS E;  4YJ3 E;  3NZP A;  4IST A;  3Q2M A;  4KBM B;  1U5P A;  3IBP A;  3KV4 A;  1FMV A;  3HKB E;  4CXW A;  5LHH B;  4L0R A;  3RC8 A;  3PUR A;  3N2K E;  1HX8 A;  4B6X A;  5HXC A;  4UEM A;  5LXT E;  4O4H E;  3ETV A;  1WR6 A;  3K8P C;  3SRZ A;  3MKD A;  4UVC B;  4EOZ B;  4MBQ A;  4WBO A;  2K5B B;  4EZH A;  2BVM A;  2VKJ A;  3OKQ A;  4MAL A;  4X1I E;  3AA6 B;  2ODU A;  4KP3 C;  2X9H A;  2W61 A;  3H37 A;  5JR9 B;  2W62 A;  3ZYK A;  3F57 A;  2X9W A;  5HXS A;  4P09 A;  4QKN A;  5JRE A;  2CE7 A;  3OYX A;  4PNI A;  1MMD A;  3O4X E;  3R6N A;  1X79 A;  2RP4 A;  4O4J E;  3LK2 B;  5LNK A;  5F3J A;  5FXX A;  2KND A;  1OWA A;  2M67 A;  3KVB A;  4EB6 E;  4N78 D;  1UX5 A;  4QX8 B;  5A1L A;  3RRW A;  4EXT A;  2VK9 A;  3MJX A;  5DQW A;  5AFU L;  2CEA A;  2X0L B;  4HFV A;  3ZCI A;  2DCF A;  4PAG A;  5ADX L;  1MIV A;  2SPC A;  1D1B A;  3BQL A;  1U4Q A;  3RYH E;  3VKG A;  1HG2 A;  3AA7 B;  3U78 A;  5EK4 A;  5DQV A;  3J9X 1;  3FBL A;  1BR0 A;  2MTQ A;  3HL6 A;  2LSJ A;  4ERR A;  4EYU A;  3DJB A;  2EHO C;  3ZYL A;  4CXX A;  2V7J A;  3I9Y A;  2N2N A;  1G8X A;  2RA1 A;  5IYZ E;  1S94 A;  3U3I A;  2CXF A;  2VKD A;  4MHC A;  5FY0 A;  3CML A;  3UFE A;  3MA9 A;  4JLE A;  3SOL A;  2NWB A;  3PDY A;  3KVA A;  5KDM C;  3CQX C;  3N5L A;  5LHG B;  4XAX B;  4PW8 A;  4QXC B;  2OA5 A;  3N9O A;  3RX6 A;  2L3L A;  1E1H B;  3ZC0 A;  5JDL A;  5FP3 A;  3PU8 A;  3V5S A;  2LSI A;  3WAJ A;  1WLX A;  2YIN A;  3EVY A;  3GA8 A;  2EHO D;  1MMA A;  3BQK A;  4DBQ A;  2C5I T;  2KWI B;  3N9Q A;  5HXE A;  4UV8 B;  4QWN B;  5J2U E;  4CI1 B;  3LK4 2;  4QHO A;  1OXZ A;  2DWK A;  1D0Y A;  2B1E A;  2CXL A;  2PBI A;  4UVA B;  4GK5 E;  4UF0 A;  4EIW A;  2A72 A;  2MOZ A;  3VU7 H;  2L8K A;  4PK6 A;  3KBT A;  3DP7 A;  3N9P A;  5L3B B;  2DHR A;  2GK9 A;  2XTL A;  2WMO A;  1BR1 A;  4U74 A;  3ZEF B;  2K24 A;  3C50 A;  5LOV E;  3WAK A;  3UT5 E;  3CQG B;  4K0U A;  3E22 E;  2CLY C;  2E9X A;  5JH7 E;  5LJM A;  4ZS3 A;  1LVF A;  3LBX A;  4BAY B;  1B7T A;  3UUL A;  5HWY A;  5LG4 A;  1S35 A;  3I1A A;  3ZPO A;  2ZMA A;  3ZJ1 A;  2W63 A;  2WWU A;  5M4Y A;  3EUH A;  4IE0 A;  5CA1 E;  2KMF A;  3ZLI A;  2KT9 A;  3PUG A;  4H9O C;  1YKH B;  2WAU A;  2Q9Q C;  4G2A A;  1ZEE A;  4AKH A;  4AI6 A;  2HPL A;  2N1G A;  1SHZ C;  2H7O A;  2XAS B;  3HKE E;  4C90 A;  2VAS A;  3CPZ A;  4AQF A;  4G63 A;  4IE6 A;  4ZHQ E;  1IJ5 A;  3CKD A;  2QA7 A;  3EDU A;  3T8O A;  3ZN1 B;  4L9I A;  1MNE A;  3OBV E;  4IIJ E;  4AQG A;  2V7L A;  2CXD A;  1D0X A;  4OFZ A;  1YD8 G;  3LJC A;  3E08 A;  4HGA A;  1ZHC A;  3QC9 A;  1CUN A;  2K9A A;  4PFO A;  5E0O A;  2X51 A;  5L2L A;  2LOS A;  2Q9Q D;  4XBF B;  3FHN A;  3HI2 A;  4KMC A;  5L3E B;  3N9L A;  3QUJ A;  3ZMV B;  4BJN A;  2LHN A;  2J1D G;  2KXP B;  3C4Z A;  1ZKE A;  2K48 A;  4H9Q C;  4DO0 A;  3J7Y q;  3PU3 A;  3HKC E;  2KZ7 B;  4HE8 A;  4JEH B;  1KNZ A;  2WSS V;  4CQI A;  4AKL A;  2A3D A;  1HG5 A;  2C5J A;  1G73 A;  2CMR A;  4UVB B;  1FIO A;  3RYI E;  3MXZ A;  5FXZ A;  4IE7 A;  4X20 E;  3RYF E;  4H9P C;  1US7 B;  1NAF A;  5FXV A;  3ESL A;  2YU2 A;  2D0U A;  1FMW A;  2ACX A;  4DND A;  5JDG A;  2LSG A;  3ZC1 A;  3L3P A;  5JDQ A;  2NW9 A;  3C4W A;  4UV9 B;  2VKO A;  3KV6 A;  4YLH A;  1D1C A;  4PK5 A;  2YEV C;  4IE5 A;  3B57 A;  5JR9 C;  4TZ4 C;  4O2A E;  1BR2 A;  2MBG A;  2L9Q A;  3RRC A;  4WW0 A;  2WM9 A;  2NTX A;  2W00 A;  1WRD A;  3JC6 C;  2LM9 A;  1MMN A;  4ZS2 A;  4ANJ A;  2JJ9 A;  4GOU A;  3HKD E;  4I55 E;  5FYM A;  3ZMZ B;  2KIN B;  1V9D A;  3F31 A;  5KX5 E;  5LBM A;  2NW8 A;  2EHO B;  5DAB A;  4H63 H;  3K3O A;  5DJQ C;  2DLR A;  3ETU A;  3ZMT B;  4UF0 B;  4TV8 E;  2N9D A;  1YW0 A;  1WYB A;  2P9B A;  1BR4 A;  2W0G A;  4GYS A;  4DVD A;  3JC6 D;  3UUM A;  3VHL A;  4HN9 A;  3NRX A;  1QUU A;  3CX6 B;  4TX5 A;  4HKA A;  2H7V C;  4NUU A;  4UIG A;  2D0T A;  3AA1 B;  3TKL B;  4DBR A;  3OJA A;  4QX7 B;  2LSK A;  2X67 A;  3HR0 A;  2EHO A;  3PUS A;  2E9X B;  5LGU B;  2JRK A;  2ODV A;  4MLK A;  2YU1 A;  3LBX B;  5CB4 E;  4IGU A;  2CWY A;  5JRC A;  4FJO A;  4BJM A;  3S4U A;  1MND A;  5LGT B;  2X68 A;  4H9N C;  4OYJ A;  3ZMU B;  5JDM A;  1MIY A;  3ANW A;  3CWZ B;  4MFR A;  2DWG A;  3O1H A;  4IHJ E;  2XQY A;  3PUA A;  4UEL A;  2LE8 A;  4CI2 B;  5LHI B;  3I0O A;  3RYC E;  2VKH A;  4JEU B;  2XAG B;  3UTK A;  3AAA B;  4AXP A;  3K3Q C;  2CWO A;  3O9X A;  2CA5 A;  4P0A A;  4ILU A;  3CX8 B;  4I43 B;  4NUV A;  4Z8X A;  2HPJ A;  2IAK A;  1HS7 A;  2DI4 A;  2Y6X A;  3LG7 A;  2NOX A;  5J1G A;  3UUN A;  3NZQ A;  2Y8D A;  1MMG A;  3B13 A;  3N9N A;  3GMI A;  1ZV4 X;  3FB2 A;  4OK0 A;  4TV9 E;  5HWX A;  1Z0P A;  5LGN B;  3C4X A;  2HH7 A;  4YJ2 E;  5JDN A;  3FXD B;  4PJL A;  2WMN A;  1QSD A;  4ZI2 C;  2D2S A;  4O2B E;  3WI3 A;  3O1I A;  4F6R C;  2V7M A;  5L3F B;  5EK3 A;  3BQI A;  2ZM2 A;  4DMW A;  1IJ6 A;  4GYR A;  4OYK A;  4WNK A;  2I59 A;  1IZN B;  2Y48 B;  5LYJ E;  5H6R B;  1FEW A;  2D5U A;  4O4L E;  4E7S A;  3NRY A;  1IAP A;  1VRB A;  3AAE B;  5HYA A;  2LOP A;  4ZI3 C;  5L3C B;  2Q9Q A;  4O4I E;  4IE4 A;  4I4T E;  2JPF A;  3CX7 B;  4M1P A;  3AAI A;  4ZI2 D;  3GN5 A;  3E0Z A;  4A56 A;  2JQQ A;  3LFM A;  2BZB A;  3PUQ A;  4E7Z A;  4X1K E;  3C98 B;  2VWA A;  2PFV A;  3MK7 C;  4I50 E;  2VL8 A;  5J2T E;  4QXB B;  1EZ3 A;  2VB6 A;  3N2O A;  3CQC B;  3O1J A;  3C64 A;  4ZI3 D;  2ES0 A;  3CVR A;  4AKI A;  3LK3 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...