4P0JA

Crystal structure of loop-swapped interleukin-36ra
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
147
structure length
147
Chain Sequence
SGALCFRMKDSALKVLYLHNNQLLAGGLHAGKVIKGEEISVVPNRWLDASLSPVILGVQGGSQCLSCGVGQEPTLTLEPVNIMELYLGAKESKSFTFYRRDMGLTSSFESAAYPGWFLCTVPEADQPVRLTQELGKSYNTDFYFQQC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular Determinants of Agonist and Antagonist Signaling through the IL-36 Receptor.
pubmed doi rcsb
molecule keywords Interleukin-36 receptor antagonist/Interleukin-36 gamma chim
molecule tags Cytokine
source organism Homo sapiens
total genus 27
structure length 147
sequence length 147
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00340 IL1 Interleukin-1 / 18
A PF00340 IL1 Interleukin-1 / 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 4p0jA00
1DQGA 7I1BA 4CJMA 4ZOTA 2NVHA 1JY0A 1S0LA 1AFCA 1Q1UA 1FMMS 3POKA 1BLAA 1JT7A 1IT0A 2Z49A 4D0ZA 1PUUB 2D22A 2QN4A 2UUSA 5F90A 4QD2B 2X2SA 3CRIA 4I4SA 3BA5A 21BIA 2XOAA 1AVAC 4X38A 3AKGA 1DQOA 4J2KA 1ISVA 1SR4A 3RTJB 3AJ5A 4I8MA 1VCLA 3FJHA 1IHKA 4L4IA 1K5UA 3B9UA 1BA7A 3FJJA 3F62B 1I1EA 4QBVA 2RG9B 5D61A 1F31A 3WMUA 41BIA 1G9CA 3CA5A 5G00A 4OWLA 4I6IA 3UD8A 1V6XA 3FFZA 3Q7XA 5FZUA 1JQZA 4XFTA 3ZC9A 4IZXA 4ZGRB 4X3AA 1FV3A 4XKIA 4YOLA 3CAHA 2VSAA 1HWOB 4DCKC 4OEGA 1J0SA 5JLVA 1BLDA 1I1BA 1MC9A 1DFCA 2IWTB 2K43A 3O4DA 3FJIA 2HW9A 3BB2A 3AKIA 4G9MA 4R6UB 2E4MC 5DUYA 4A7YA 3CQAA 3ILAA 4I4QA 4QBCA 4KEIA 1T4QA 2KLLA 4XFUA 3EF2A 3FJAA 5DSSB 2VLCA 5BP5A 4ISQA 3E8LC 4LO3C 3OGGA 1EV2A 1DZDA 5FNWA 1M2TB 2HZ9A 4ENDA 2FO1A 1V6UA 3IIRA 3OBRA 4I4RA 3FJBA 3N7JA 1TWMA 1DLLA 1R8OA 4I4PA 1OQLB 4KEKA 3CA6A 2LIQA 3Q7YA 2ESUA 1S0GA 4I4UA 2K8RA 2Q3NB 1XZZA 1ITBA 1CE7B 1YF8B 2AFGA 3IAGC 3A22A 3VT1A 5I1BA 4QALA 3O4CA 3WO3A 4A7KA 2J3PA 1CVSA 4LO7C 1V6VA 1XYFA 1L2HA 1M16A 9ILBA 4J2SA 2D7RA 2AAIB 1TTUA 3HBWA 3I2AA 4P0KA 3HMYA 4OW4A 1YTOA 4Q9PA 4OEEA 4EFRA 2KH2A 5DZUA 3BAUA 4F83A 2VSEA 3WINC 3OJMA 4JQ0A 1SZ6B 1YXWA 3H6SE 1AVWB 1S0BA 2DS0A 2KI4A 4LO1C 5D62A 4IY8A 5EG6C 2NYYA 3FJDA 3MPPG 5FZZA 4LO0C 2NP0A 4J23B 4EKXB 1WD4A 2BFHA 3NBDA 2R9KB 5FZYA 4USOA 3FGMA 1TFMB 4I0YA 1NZKA 1GGPB 4ZBVB 2E4MA 3VUOA 3D7WB 4AN6A 4JKQA 1TWEA 1T9FA 2AQZA 5EC5A 3BRGC 1S0FA 3QYDA 4QKSA 4LO3A 4J2YA 2F2FC 4ZA3B 3PHZA 3RTIB 1BFBA 3BA7A 4GOVA 3HN1A 4I1EA 5E24E 3BADA 3AH1A 1WBAA 3O4BA 3NBEA 3FUQA 4PC4A 1HWPB 4I1BA 1BFFA 3C9ZA 1WD3A 1HWNB 1EVTA 1G82A 2ZR1B 3NJ5A 4LO7B 1D0HA 2KI6B 4P0LA 4EFQA 5BXRA 2Y9WC 1RY7A 1AVUA 3CA4A 3JRRA 1XHBA 5BVPI 3UD9A 1ISXA 2GZBA 3V0AA 2D1ZA 4X39A 3WINA 4AN7B 3WO2A 4Q91A 3FJ8A 3BTAA 2HWMA 3ZXDA 1G9DA 1Z0HA 1TP0A 1JLXA 2I1BA 1IJTA 4LO1A 2Z48A 2FGFA 4IY9A 2P23A 1S0DA 4LO0A 5EHAA 1HCEA 2RSTA 3IM5A 1HWMB 2DRZA 5F8YA 4IHZA 1BARA 5GAQA 4I3NA 4USPA 3Q7WA 3AJ6A 1IRAX 2DREA 4H9WA 1Z2VA 4P6AA 3VT2A 4QKRA 3OBTA 4JRAA 1G9BA 1JT5A 3A23A 3UD7A 2HWAA 1FWVA 3CA1A 1KNMA 2P39A 4GP3A 1FMZA 3AH4A 1R8NA 3FJEA 3N0KA 3O4AA 2MLLB 4LO2C 2F2FA 3VSFA 1A8DA 3N7LA 2VXRA 1YBIA 4G6MA 31BIA 1FWUA 1QXMA 1JT3A 3BRDA 3AKFA 1DJSB 2L5XA 3BAVA 3V79C 1ABRB 5DVHA 2K4AB 3S8JA 1NUNA 1ILR1 3R4SA 1W3AA 3O44A 4GAIA 4I4YA 2BEAA 4F34A 3I29B 1HKNA 2Y9XE 3BAGA 2F8XC 1MD6A 3MALA 1QQLA 1S0EA 4OEFA 3BAHA 3CRHA 3I2XA 1QQKA 3A21A 1IRPA 1FQ9A 4WBCA 3NBNA 4IYBA 3VEQA 8I1BA 1UPSA 1W3FA 2Y9GA 3T8SA 3N7KA 4ZKTB 1W3GA 2NTDA 5BOWA 1EYLA 1JLYA 2KKIA 5JMCA 2WBCA 1PZZA 1G9AA 3W9TA 3V0BA 1YYNA 1FGAA 1TOOA 2RQ9A 3FJCA 2MC2A 3H6QA 3BA4A 4QC4A 4I4OA 1N4KA 3OJVA 3O5WB 2VU9A 1Q04A 3OGFA 4GP0A 1DFQA 1JT4A 3AH2A 4DEPA 4ISRA 4I4VA 4KEJA 1EPWA 3OJ2A 4GOYA 2IHOA 1RG8A 2D7IA 3O3QA 3AKHA 3VWCA 3A07A 2VUAA 3PUBA 4G6JA 2Q9XA 2D44A 1K5VA 5BXSA 4LO2A 1FV2A 3ZXGA 4XFSA 2ZQNA 3ZX7A 1S0CA 4JKXB 3PG0A 4Z9WB 2WRYA 5FNXA 4OUJA 1AF9A 3FJFA 4EB2B 1V6WA 3V0AB 3ZC8A 4Q9GA 3IM7A 1AXMA 1ISWA 2X2TA 2Y9FA 3IM6A 4D8HA 1RMLA 5F8WA 4ZFYB 2D43A 4TLPA 4HA2A 4DENA 5BQUC 1E0OA 4P0JA 3RMYA 1Z4SA 3CU1B 3O49A 4FGFA 1ISZA 4JPZA 1Q03A 3BAOA 3BAQA 4QO3A 4Z8SB 3WO4A 1HIBA 2NZ9A 4J2XA 5BXPA 3CRGA 1FN0A 3LTQA 4HJJA 3O4OA 6I1BA 4ZFWB 3TC2A 2QYIB 3RSJA 4G1RA 4ZLBB 4QD2C 4I7IA 1ISYA 4OWJA 4IONA 3H6RA 3P6JA 3PMEA 5HPZA 4I4XA 1BFGA 1XG6A 2ERMA 3HOMA 2FFUA 3UDAA 3K1XA 2NM1A 3H6RB 4I37A 1RZOB 1DZCA 2VXTI 1WBCA 3HALA 1SR4C 2ET2A 4KBBA 3RMXA 2MIBA 4G9NA 3UJ0A 5F8SA 3JUTA 3SNVA 4I2SA 1JTCA 4H04A 3P6IA 3FJKA 2M49A 4L4HA 3P53A 4I96A 4II0A 1TIEA 3VSZA 3LLPA 4OWKA 2FDBM 1IILA 2LIEA 4D0TA 3KMVA 3R4UA 3NBCA 4JAWA 4KC3A 2ZQOA 3BX1C 3WA1A 4X37A 3S8KA 1HCDA 1PC8B 3FJ9A 1PWAA 3VT0A 4EFPA 1BFCA 3CA3A 3UJ4A 4A7ZA 3CA0A 3N7MA 3BRFA 3F1RA 1BASA 4EEEB 1AVXB 4JP0A 4LO8B 2D20A 2YUGA 2DRYA 3AZVA 4HR6C 1II4A 1P63A 5BXTA 5D63A 2FFVA 3V0BB 2AXMA 5BP5C 4IQPA 5BQUA 4ZFUB 2D23A 1DIWA 1PUMB 2D24A 3QR5A 3AZWA 2BEBA 2GO2A 3WMVA 1IOBA 3HSMA 3FUOA 4IZEA 1ONKB 4FVVA 4GAFA 5B2HA
chains in the Genus database with same CATH superfamily
1DQGA 7I1BA 4CJMA 4ZOTA 2NVHA 1JY0A 1S0LA 1AFCA 1Q1UA 1FMMS 3POKA 1BLAA 1JT7A 1IT0A 2Z49A 4D0ZA 1PUUB 2D22A 2QN4A 2UUSA 5F90A 4QD2B 2X2SA 3CRIA 4I4SA 3BA5A 21BIA 2XOAA 1AVAC 4X38A 3AKGA 1DQOA 4J2KA 1ISVA 1SR4A 3RTJB 3AJ5A 4I8MA 1VCLA 3FJHA 1IHKA 4L4IA 1K5UA 3B9UA 1BA7A 3FJJA 3F62B 1I1EA 4QBVA 2RG9B 5D61A 1F31A 3WMUA 41BIA 1G9CA 3CA5A 5G00A 4OWLA 4I6IA 3UD8A 1V6XA 3FFZA 3Q7XA 5FZUA 1JQZA 4XFTA 3ZC9A 4IZXA 4ZGRB 4X3AA 1FV3A 4XKIA 4YOLA 3CAHA 2VSAA 1HWOB 4DCKC 4OEGA 1J0SA 5JLVA 1BLDA 1I1BA 1MC9A 1DFCA 2IWTB 2K43A 3O4DA 3FJIA 2HW9A 3BB2A 3AKIA 4G9MA 4R6UB 2E4MC 5DUYA 4A7YA 3CQAA 3ILAA 4I4QA 4QBCA 4KEIA 1T4QA 2KLLA 4XFUA 3EF2A 3FJAA 5DSSB 2VLCA 5BP5A 4ISQA 3E8LC 4LO3C 3OGGA 1EV2A 1DZDA 5FNWA 1M2TB 2HZ9A 4ENDA 2FO1A 1V6UA 3IIRA 3OBRA 4I4RA 3FJBA 3N7JA 1TWMA 1DLLA 1R8OA 4I4PA 1OQLB 4KEKA 3CA6A 2LIQA 3Q7YA 2ESUA 1S0GA 4I4UA 2K8RA 2Q3NB 1XZZA 1ITBA 1CE7B 1YF8B 2AFGA 3IAGC 3A22A 3VT1A 5I1BA 4QALA 3O4CA 3WO3A 4A7KA 2J3PA 1CVSA 4LO7C 1V6VA 1XYFA 1L2HA 1M16A 9ILBA 4J2SA 2D7RA 2AAIB 1TTUA 3HBWA 3I2AA 4P0KA 3HMYA 4OW4A 1YTOA 4Q9PA 4OEEA 4EFRA 2KH2A 5DZUA 3BAUA 4F83A 2VSEA 3WINC 3OJMA 4JQ0A 1SZ6B 1YXWA 3H6SE 1AVWB 1S0BA 2DS0A 2KI4A 4LO1C 5D62A 4IY8A 4MZGB 5EG6C 2NYYA 3FJDA 3MPPG 5FZZA 4LO0C 2NP0A 4J23B 4EKXB 1WD4A 2BFHA 3NBDA 2R9KB 5FZYA 4USOA 3FGMA 1TFMB 4I0YA 1NZKA 1GGPB 4ZBVB 2E4MA 3VUOA 3D7WB 4AN6A 4JKQA 1TWEA 1T9FA 2AQZA 5EC5A 3BRGC 1S0FA 3QYDA 4QKSA 4LO3A 4J2YA 2F2FC 4ZA3B 3PHZA 3RTIB 1BFBA 3BA7A 4GOVA 3HN1A 4I1EA 5E24E 3BADA 3AH1A 1WBAA 3O4BA 3NBEA 3FUQA 4PC4A 1HWPB 4I1BA 1BFFA 3C9ZA 1WD3A 1HWNB 1EVTA 1G82A 2ZR1B 3NJ5A 4LO7B 1D0HA 2KI6B 2NS2A 4P0LA 4EFQA 5BXRA 2Y9WC 1RY7A 1AVUA 3CA4A 3JRRA 1XHBA 5BVPI 3UD9A 1ISXA 2GZBA 3V0AA 2D1ZA 4X39A 3WINA 4AN7B 3WO2A 4Q91A 3FJ8A 3BTAA 2HWMA 3ZXDA 1G9DA 1Z0HA 1TP0A 1JLXA 2I1BA 1IJTA 4LO1A 2Z48A 2FGFA 4IY9A 2P23A 1S0DA 4LO0A 5EHAA 1HCEA 2RSTA 3IM5A 1HWMB 2DRZA 5F8YA 4IHZA 1BARA 5GAQA 4I3NA 4USPA 3Q7WA 3AJ6A 1IRAX 2DREA 4H9WA 1Z2VA 4P6AA 3VT2A 4QKRA 3OBTA 4JRAA 1G9BA 1JT5A 3A23A 3UD7A 2HWAA 1FWVA 3CA1A 1KNMA 2P39A 4GP3A 1FMZA 3AH4A 1R8NA 3FJEA 3N0KA 3O4AA 2MLLB 4LO2C 2F2FA 3VSFA 1A8DA 3N7LA 2VXRA 1YBIA 4G6MA 31BIA 1FWUA 1QXMA 1JT3A 3BRDA 3AKFA 1DJSB 2L5XA 3BAVA 3V79C 1ABRB 5DVHA 2K4AB 3S8JA 1NUNA 1ILR1 3R4SA 1W3AA 3O44A 4GAIA 4I4YA 2BEAA 4F34A 3I29B 1HKNA 2Y9XE 3BAGA 2F8XC 1MD6A 3MALA 1QQLA 1S0EA 4OEFA 3BAHA 3CRHA 3I2XA 1QQKA 3A21A 1IRPA 1FQ9A 4MZHA 4WBCA 3NBNA 4IYBA 3VEQA 8I1BA 1UPSA 1W3FA 2Y9GA 3T8SA 3N7KA 4ZKTB 1W3GA 2NTDA 5BOWA 1EYLA 1JLYA 2KKIA 5JMCA 2WBCA 1PZZA 1G9AA 3W9TA 3V0BA 1YYNA 1FGAA 1TOOA 2RQ9A 3FJCA 2MC2A 3H6QA 3BA4A 4QC4A 4I4OA 1N4KA 3OJVA 3O5WB 2VU9A 1Q04A 3OGFA 4GP0A 1DFQA 1JT4A 3AH2A 4DEPA 4ISRA 4I4VA 4KEJA 4H75A 1EPWA 3OJ2A 4GOYA 2IHOA 1RG8A 2D7IA 3O3QA 3AKHA 3VWCA 3A07A 2VUAA 3PUBA 4MZFB 4G6JA 2Q9XA 2D44A 1K5VA 5BXSA 4LO2A 1FV2A 3ZXGA 4XFSA 2ZQNA 3ZX7A 1S0CA 4JKXB 3PG0A 4Z9WB 2WRYA 5FNXA 4OUJA 1AF9A 3FJFA 4EB2B 1V6WA 3V0AB 3ZC8A 4Q9GA 3IM7A 1AXMA 1ISWA 2X2TA 2Y9FA 3IM6A 4D8HA 1RMLA 5F8WA 4ZFYB 2D43A 4TLPA 4HA2A 4DENA 5BQUC 1E0OA 4P0JA 3RMYA 1Z4SA 3CU1B 3O49A 4FGFA 1ISZA 4JPZA 1Q03A 3BAOA 3BAQA 4QO3A 4Z8SB 3WO4A 1HIBA 2NZ9A 4J2XA 5BXPA 3CRGA 1FN0A 3LTQA 4HJJA 3O4OA 6I1BA 4ZFWB 3TC2A 2QYIB 3RSJA 4G1RA 4ZLBB 4QD2C 4I7IA 1ISYA 4OWJA 4IONA 3H6RA 3P6JA 3PMEA 5HPZA 4I4XA 1BFGA 1XG6A 2ERMA 3HOMA 2FFUA 3UDAA 3K1XA 2NM1A 3H6RB 4I37A 1RZOB 1DZCA 2VXTI 1WBCA 3HALA 1SR4C 2ET2A 4KBBA 3RMXA 2MIBA 4G9NA 3UJ0A 5F8SA 3JUTA 3SNVA 4I2SA 4UY4A 1JTCA 4H04A 3P6IA 3FJKA 2M49A 4L4HA 3P53A 4I96A 4II0A 1TIEA 3VSZA 3LLPA 4OWKA 2FDBM 1IILA 2LIEA 4D0TA 3KMVA 3R4UA 3NBCA 4JAWA 4KC3A 2ZQOA 3BX1C 3WA1A 4X37A 3S8KA 1HCDA 1PC8B 3FJ9A 1PWAA 3VT0A 4EFPA 1BFCA 3CA3A 3UJ4A 4A7ZA 3CA0A 3N7MA 3BRFA 3F1RA 1BASA 4EEEB 1AVXB 4JP0A 4LO8B 2D20A 2YUGA 2DRYA 3AZVA 4HR6C 1II4A 1P63A 5BXTA 5D63A 2FFVA 3V0BB 2AXMA 5BP5C 4IQPA 5BQUA 4ZFUB 2D23A 1DIWA 1PUMB 2D24A 3QR5A 3AZWA 2BEBA 2GO2A 3WMVA 1IOBA 3HSMA 3FUOA 4IZEA 1ONKB 4FVVA 4GAFA 5B2HA
chains in the Genus database with same CATH topology
1DQGA 7I1BA 4CJMA 4ZOTA 2NVHA 1JY0A 1S0LA 1AFCA 1Q1UA 1FMMS 3POKA 1BLAA 1JT7A 1IT0A 2Z49A 4D0ZA 1PUUB 2D22A 2QN4A 2UUSA 5F90A 4QD2B 2X2SA 3CRIA 4I4SA 3BA5A 21BIA 2XOAA 1AVAC 4X38A 3AKGA 1DQOA 4J2KA 1ISVA 1SR4A 3RTJB 3AJ5A 4I8MA 1VCLA 3FJHA 1IHKA 4L4IA 1K5UA 3B9UA 1BA7A 3FJJA 3F62B 1I1EA 4QBVA 2RG9B 5D61A 1F31A 3WMUA 41BIA 1G9CA 3CA5A 5G00A 4OWLA 4I6IA 3UD8A 1V6XA 3FFZA 3Q7XA 5FZUA 1JQZA 4XFTA 3ZC9A 4IZXA 4ZGRB 4X3AA 1FV3A 4XKIA 4YOLA 3CAHA 2VSAA 1HWOB 4DCKC 4OEGA 1J0SA 5JLVA 1BLDA 1I1BA 1MC9A 1DFCA 2IWTB 2K43A 3O4DA 3FJIA 2HW9A 3BB2A 3AKIA 4G9MA 4R6UB 2E4MC 5DUYA 4A7YA 3CQAA 3ILAA 4I4QA 4QBCA 4KEIA 1T4QA 2KLLA 4XFUA 3EF2A 3FJAA 5DSSB 2VLCA 5BP5A 4ISQA 3E8LC 4LO3C 3OGGA 1EV2A 1DZDA 5FNWA 1M2TB 2HZ9A 4ENDA 2FO1A 1V6UA 3IIRA 3OBRA 4I4RA 3FJBA 3N7JA 1TWMA 1DLLA 1R8OA 4I4PA 1OQLB 4KEKA 3CA6A 2LIQA 3Q7YA 2ESUA 1S0GA 4I4UA 2K8RA 2Q3NB 1XZZA 1ITBA 1CE7B 1YF8B 2AFGA 3IAGC 3A22A 3VT1A 5I1BA 4QALA 3O4CA 3WO3A 4A7KA 2J3PA 1CVSA 4LO7C 1V6VA 1XYFA 1L2HA 1M16A 9ILBA 4J2SA 2D7RA 2AAIB 1TTUA 3HBWA 3I2AA 4P0KA 3HMYA 4OW4A 1YTOA 4Q9PA 4OEEA 4EFRA 2KH2A 5DZUA 3BAUA 4F83A 2VSEA 3WINC 3OJMA 4JQ0A 1SZ6B 1YXWA 3H6SE 1AVWB 1S0BA 2DS0A 2KI4A 4LO1C 5D62A 4IY8A 4MZGB 5EG6C 2NYYA 3FJDA 3MPPG 5FZZA 4LO0C 2NP0A 4J23B 4EKXB 1WD4A 2BFHA 3NBDA 2R9KB 5FZYA 4USOA 3FGMA 1TFMB 4I0YA 1NZKA 1GGPB 4ZBVB 2E4MA 3VUOA 3D7WB 4AN6A 4JKQA 1TWEA 1T9FA 2AQZA 5EC5A 3BRGC 1S0FA 3QYDA 4QKSA 4LO3A 4J2YA 2F2FC 4ZA3B 3PHZA 3RTIB 1BFBA 3BA7A 4GOVA 3HN1A 4I1EA 5E24E 3BADA 3AH1A 1WBAA 3O4BA 3NBEA 3FUQA 4PC4A 1HWPB 4I1BA 1BFFA 3C9ZA 1WD3A 1HWNB 1EVTA 1G82A 2ZR1B 3NJ5A 4LO7B 1D0HA 2KI6B 2NS2A 4P0LA 4EFQA 5BXRA 2Y9WC 1RY7A 1AVUA 3CA4A 3JRRA 1XHBA 5BVPI 3UD9A 1ISXA 2GZBA 3V0AA 2D1ZA 4X39A 3WINA 4AN7B 3WO2A 4Q91A 3FJ8A 3BTAA 2HWMA 3ZXDA 1G9DA 1Z0HA 1TP0A 1JLXA 2I1BA 1IJTA 4LO1A 2Z48A 2FGFA 4IY9A 2P23A 1S0DA 4LO0A 5EHAA 1HCEA 2RSTA 3IM5A 1HWMB 2DRZA 5F8YA 4IHZA 1BARA 5GAQA 4I3NA 4USPA 3Q7WA 3AJ6A 1IRAX 2DREA 4H9WA 1Z2VA 4P6AA 3VT2A 4QKRA 3OBTA 4JRAA 1G9BA 1JT5A 3A23A 3UD7A 2HWAA 1FWVA 3CA1A 1KNMA 2P39A 4GP3A 1FMZA 3AH4A 1R8NA 3FJEA 3N0KA 3O4AA 2MLLB 4LO2C 2F2FA 3VSFA 1A8DA 3N7LA 2VXRA 1YBIA 4G6MA 31BIA 1FWUA 1QXMA 1JT3A 3BRDA 3AKFA 1DJSB 2L5XA 3BAVA 3V79C 1ABRB 5DVHA 2K4AB 3S8JA 1NUNA 1ILR1 3R4SA 1W3AA 3O44A 4GAIA 4I4YA 2BEAA 4F34A 3I29B 1HKNA 2Y9XE 3BAGA 2F8XC 1MD6A 3MALA 1QQLA 1S0EA 4OEFA 3BAHA 3CRHA 3I2XA 1QQKA 3A21A 1IRPA 1FQ9A 4MZHA 4WBCA 3NBNA 4IYBA 3VEQA 8I1BA 1UPSA 1W3FA 2Y9GA 3T8SA 3N7KA 4ZKTB 1W3GA 2NTDA 5BOWA 1EYLA 1JLYA 2KKIA 5JMCA 2WBCA 1PZZA 1G9AA 3W9TA 3V0BA 1YYNA 1FGAA 1TOOA 2RQ9A 3FJCA 2MC2A 3H6QA 3BA4A 4QC4A 4I4OA 1N4KA 3OJVA 3O5WB 2VU9A 1Q04A 3OGFA 4GP0A 1DFQA 1JT4A 3AH2A 4DEPA 4ISRA 4I4VA 4KEJA 4H75A 1EPWA 3OJ2A 4GOYA 2IHOA 1RG8A 2D7IA 3O3QA 3AKHA 3VWCA 3A07A 2VUAA 3PUBA 4MZFB 4G6JA 2Q9XA 2D44A 1K5VA 5BXSA 4LO2A 1FV2A 3ZXGA 4XFSA 2ZQNA 3ZX7A 1S0CA 4JKXB 3PG0A 4Z9WB 2WRYA 5FNXA 4OUJA 1AF9A 3FJFA 4EB2B 1V6WA 3V0AB 3ZC8A 4Q9GA 3IM7A 1AXMA 1ISWA 2X2TA 2Y9FA 3IM6A 4D8HA 1RMLA 5F8WA 4ZFYB 2D43A 4TLPA 4HA2A 4DENA 5BQUC 1E0OA 4P0JA 3RMYA 1Z4SA 3CU1B 3O49A 4FGFA 1ISZA 4JPZA 1Q03A 3BAOA 3BAQA 4QO3A 4Z8SB 3WO4A 1HIBA 2NZ9A 4J2XA 5BXPA 3CRGA 1FN0A 3LTQA 4HJJA 3O4OA 6I1BA 4ZFWB 3TC2A 2QYIB 3RSJA 4G1RA 4ZLBB 4QD2C 4I7IA 1ISYA 4OWJA 4IONA 3H6RA 3P6JA 3PMEA 5HPZA 4I4XA 1BFGA 1XG6A 2ERMA 3HOMA 2FFUA 3UDAA 3K1XA 2NM1A 3H6RB 4I37A 1RZOB 1DZCA 2VXTI 1WBCA 3HALA 1SR4C 2ET2A 4KBBA 3RMXA 2MIBA 4G9NA 3UJ0A 5F8SA 3JUTA 3SNVA 4I2SA 4UY4A 1JTCA 4H04A 3P6IA 3FJKA 2M49A 4L4HA 3P53A 4I96A 4II0A 1TIEA 3VSZA 3LLPA 4OWKA 2FDBM 1IILA 2LIEA 4D0TA 3KMVA 3R4UA 3NBCA 4JAWA 4KC3A 2ZQOA 3BX1C 3WA1A 4X37A 3S8KA 1HCDA 1PC8B 3FJ9A 1PWAA 3VT0A 4EFPA 1BFCA 3CA3A 3UJ4A 4A7ZA 3CA0A 3N7MA 3BRFA 3F1RA 1BASA 4EEEB 1AVXB 4JP0A 4LO8B 2D20A 2YUGA 2DRYA 3AZVA 4HR6C 1II4A 1P63A 5BXTA 5D63A 2FFVA 3V0BB 2AXMA 5BP5C 4IQPA 5BQUA 4ZFUB 2D23A 1DIWA 1PUMB 2D24A 3QR5A 3AZWA 2BEBA 2GO2A 3WMVA 1IOBA 3HSMA 3FUOA 4IZEA 1ONKB 4FVVA 4GAFA 5B2HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DQG A;  7I1B A;  4CJM A;  4ZOT A;  2NVH A;  1JY0 A;  1S0L A;  1AFC A;  1Q1U A;  1FMM S;  3POK A;  1BLA A;  1JT7 A;  1IT0 A;  2Z49 A;  4D0Z A;  1PUU B;  2D22 A;  2QN4 A;  2UUS A;  5F90 A;  4QD2 B;  2X2S A;  3CRI A;  4I4S A;  3BA5 A;  21BI A;  2XOA A;  1AVA C;  4X38 A;  3AKG A;  1DQO A;  4J2K A;  1ISV A;  1SR4 A;  3RTJ B;  3AJ5 A;  4I8M A;  1VCL A;  3FJH A;  1IHK A;  4L4I A;  1K5U A;  3B9U A;  1BA7 A;  3FJJ A;  3F62 B;  1I1E A;  4QBV A;  2RG9 B;  5D61 A;  1F31 A;  3WMU A;  41BI A;  1G9C A;  3CA5 A;  5G00 A;  4OWL A;  4I6I A;  3UD8 A;  1V6X A;  3FFZ A;  3Q7X A;  5FZU A;  1JQZ A;  4XFT A;  3ZC9 A;  4IZX A;  4ZGR B;  4X3A A;  1FV3 A;  4XKI A;  4YOL A;  3CAH A;  2VSA A;  1HWO B;  4DCK C;  4OEG A;  1J0S A;  5JLV A;  1BLD A;  1I1B A;  1MC9 A;  1DFC A;  2IWT B;  2K43 A;  3O4D A;  3FJI A;  2HW9 A;  3BB2 A;  3AKI A;  4G9M A;  4R6U B;  2E4M C;  5DUY A;  4A7Y A;  3CQA A;  3ILA A;  4I4Q A;  4QBC A;  4KEI A;  1T4Q A;  2KLL A;  4XFU A;  3EF2 A;  3FJA A;  5DSS B;  2VLC A;  5BP5 A;  4ISQ A;  3E8L C;  4LO3 C;  3OGG A;  1EV2 A;  1DZD A;  5FNW A;  1M2T B;  2HZ9 A;  4END A;  2FO1 A;  1V6U A;  3IIR A;  3OBR A;  4I4R A;  3FJB A;  3N7J A;  1TWM A;  1DLL A;  1R8O A;  4I4P A;  1OQL B;  4KEK A;  3CA6 A;  2LIQ A;  3Q7Y A;  2ESU A;  1S0G A;  4I4U A;  2K8R A;  2Q3N B;  1XZZ A;  1ITB A;  1CE7 B;  1YF8 B;  2AFG A;  3IAG C;  3A22 A;  3VT1 A;  5I1B A;  4QAL A;  3O4C A;  3WO3 A;  4A7K A;  2J3P A;  1CVS A;  4LO7 C;  1V6V A;  1XYF A;  1L2H A;  1M16 A;  9ILB A;  4J2S A;  2D7R A;  2AAI B;  1TTU A;  3HBW A;  3I2A A;  4P0K A;  3HMY A;  4OW4 A;  1YTO A;  4Q9P A;  4OEE A;  4EFR A;  2KH2 A;  5DZU A;  3BAU A;  4F83 A;  2VSE A;  3WIN C;  3OJM A;  4JQ0 A;  1SZ6 B;  1YXW A;  3H6S E;  1AVW B;  1S0B A;  2DS0 A;  2KI4 A;  4LO1 C;  5D62 A;  4IY8 A;  5EG6 C;  2NYY A;  3FJD A;  3MPP G;  5FZZ A;  4LO0 C;  2NP0 A;  4J23 B;  4EKX B;  1WD4 A;  2BFH A;  3NBD A;  2R9K B;  5FZY A;  4USO A;  3FGM A;  1TFM B;  4I0Y A;  1NZK A;  1GGP B;  4ZBV B;  2E4M A;  3VUO A;  3D7W B;  4AN6 A;  4JKQ A;  1TWE A;  1T9F A;  2AQZ A;  5EC5 A;  3BRG C;  1S0F A;  3QYD A;  4QKS A;  4LO3 A;  4J2Y A;  2F2F C;  4ZA3 B;  3PHZ A;  3RTI B;  1BFB A;  3BA7 A;  4GOV A;  3HN1 A;  4I1E A;  5E24 E;  3BAD A;  3AH1 A;  1WBA A;  3O4B A;  3NBE A;  3FUQ A;  4PC4 A;  1HWP B;  4I1B A;  1BFF A;  3C9Z A;  1WD3 A;  1HWN B;  1EVT A;  1G82 A;  2ZR1 B;  3NJ5 A;  4LO7 B;  1D0H A;  2KI6 B;  4P0L A;  4EFQ A;  5BXR A;  2Y9W C;  1RY7 A;  1AVU A;  3CA4 A;  3JRR A;  1XHB A;  5BVP I;  3UD9 A;  1ISX A;  2GZB A;  3V0A A;  2D1Z A;  4X39 A;  3WIN A;  4AN7 B;  3WO2 A;  4Q91 A;  3FJ8 A;  3BTA A;  2HWM A;  3ZXD A;  1G9D A;  1Z0H A;  1TP0 A;  1JLX A;  2I1B A;  1IJT A;  4LO1 A;  2Z48 A;  2FGF A;  4IY9 A;  2P23 A;  1S0D A;  4LO0 A;  5EHA A;  1HCE A;  2RST A;  3IM5 A;  1HWM B;  2DRZ A;  5F8Y A;  4IHZ A;  1BAR A;  5GAQ A;  4I3N A;  4USP A;  3Q7W A;  3AJ6 A;  1IRA X;  2DRE A;  4H9W A;  1Z2V A;  4P6A A;  3VT2 A;  4QKR A;  3OBT A;  4JRA A;  1G9B A;  1JT5 A;  3A23 A;  3UD7 A;  2HWA A;  1FWV A;  3CA1 A;  1KNM A;  2P39 A;  4GP3 A;  1FMZ A;  3AH4 A;  1R8N A;  3FJE A;  3N0K A;  3O4A A;  2MLL B;  4LO2 C;  2F2F A;  3VSF A;  1A8D A;  3N7L A;  2VXR A;  1YBI A;  4G6M A;  31BI A;  1FWU A;  1QXM A;  1JT3 A;  3BRD A;  3AKF A;  1DJS B;  2L5X A;  3BAV A;  3V79 C;  1ABR B;  5DVH A;  2K4A B;  3S8J A;  1NUN A;  1ILR 1;  3R4S A;  1W3A A;  3O44 A;  4GAI A;  4I4Y A;  2BEA A;  4F34 A;  3I29 B;  1HKN A;  2Y9X E;  3BAG A;  2F8X C;  1MD6 A;  3MAL A;  1QQL A;  1S0E A;  4OEF A;  3BAH A;  3CRH A;  3I2X A;  1QQK A;  3A21 A;  1IRP A;  1FQ9 A;  4WBC A;  3NBN A;  4IYB A;  3VEQ A;  8I1B A;  1UPS A;  1W3F A;  2Y9G A;  3T8S A;  3N7K A;  4ZKT B;  1W3G A;  2NTD A;  5BOW A;  1EYL A;  1JLY A;  2KKI A;  5JMC A;  2WBC A;  1PZZ A;  1G9A A;  3W9T A;  3V0B A;  1YYN A;  1FGA A;  1TOO A;  2RQ9 A;  3FJC A;  2MC2 A;  3H6Q A;  3BA4 A;  4QC4 A;  4I4O A;  1N4K A;  3OJV A;  3O5W B;  2VU9 A;  1Q04 A;  3OGF A;  4GP0 A;  1DFQ A;  1JT4 A;  3AH2 A;  4DEP A;  4ISR A;  4I4V A;  4KEJ A;  1EPW A;  3OJ2 A;  4GOY A;  2IHO A;  1RG8 A;  2D7I A;  3O3Q A;  3AKH A;  3VWC A;  3A07 A;  2VUA A;  3PUB A;  4G6J A;  2Q9X A;  2D44 A;  1K5V A;  5BXS A;  4LO2 A;  1FV2 A;  3ZXG A;  4XFS A;  2ZQN A;  3ZX7 A;  1S0C A;  4JKX B;  3PG0 A;  4Z9W B;  2WRY A;  5FNX A;  4OUJ A;  1AF9 A;  3FJF A;  4EB2 B;  1V6W A;  3V0A B;  3ZC8 A;  4Q9G A;  3IM7 A;  1AXM A;  1ISW A;  2X2T A;  2Y9F A;  3IM6 A;  4D8H A;  1RML A;  5F8W A;  4ZFY B;  2D43 A;  4TLP A;  4HA2 A;  4DEN A;  5BQU C;  1E0O A;  4P0J A;  3RMY A;  1Z4S A;  3CU1 B;  3O49 A;  4FGF A;  1ISZ A;  4JPZ A;  1Q03 A;  3BAO A;  3BAQ A;  4QO3 A;  4Z8S B;  3WO4 A;  1HIB A;  2NZ9 A;  4J2X A;  5BXP A;  3CRG A;  1FN0 A;  3LTQ A;  4HJJ A;  3O4O A;  6I1B A;  4ZFW B;  3TC2 A;  2QYI B;  3RSJ A;  4G1R A;  4ZLB B;  4QD2 C;  4I7I A;  1ISY A;  4OWJ A;  4ION A;  3H6R A;  3P6J A;  3PME A;  5HPZ A;  4I4X A;  1BFG A;  1XG6 A;  2ERM A;  3HOM A;  2FFU A;  3UDA A;  3K1X A;  2NM1 A;  3H6R B;  4I37 A;  1RZO B;  1DZC A;  2VXT I;  1WBC A;  3HAL A;  1SR4 C;  2ET2 A;  4KBB A;  3RMX A;  2MIB A;  4G9N A;  3UJ0 A;  5F8S A;  3JUT A;  3SNV A;  4I2S A;  1JTC A;  4H04 A;  3P6I A;  3FJK A;  2M49 A;  4L4H A;  3P53 A;  4I96 A;  4II0 A;  1TIE A;  3VSZ A;  3LLP A;  4OWK A;  2FDB M;  1IIL A;  2LIE A;  4D0T A;  3KMV A;  3R4U A;  3NBC A;  4JAW A;  4KC3 A;  2ZQO A;  3BX1 C;  3WA1 A;  4X37 A;  3S8K A;  1HCD A;  1PC8 B;  3FJ9 A;  1PWA A;  3VT0 A;  4EFP A;  1BFC A;  3CA3 A;  3UJ4 A;  4A7Z A;  3CA0 A;  3N7M A;  3BRF A;  3F1R A;  1BAS A;  4EEE B;  1AVX B;  4JP0 A;  4LO8 B;  2D20 A;  2YUG A;  2DRY A;  3AZV A;  4HR6 C;  1II4 A;  1P63 A;  5BXT A;  5D63 A;  2FFV A;  3V0B B;  2AXM A;  5BP5 C;  4IQP A;  5BQU A;  4ZFU B;  2D23 A;  1DIW A;  1PUM B;  2D24 A;  3QR5 A;  3AZW A;  2BEB A;  2GO2 A;  3WMV A;  1IOB A;  3HSM A;  3FUO A;  4IZE A;  1ONK B;  4FVV A;  4GAF A;  5B2H A; 
#chains in the Genus database with same CATH topology
 1DQG A;  7I1B A;  4CJM A;  4ZOT A;  2NVH A;  1JY0 A;  1S0L A;  1AFC A;  1Q1U A;  1FMM S;  3POK A;  1BLA A;  1JT7 A;  1IT0 A;  2Z49 A;  4D0Z A;  1PUU B;  2D22 A;  2QN4 A;  2UUS A;  5F90 A;  4QD2 B;  2X2S A;  3CRI A;  4I4S A;  3BA5 A;  21BI A;  2XOA A;  1AVA C;  4X38 A;  3AKG A;  1DQO A;  4J2K A;  1ISV A;  1SR4 A;  3RTJ B;  3AJ5 A;  4I8M A;  1VCL A;  3FJH A;  1IHK A;  4L4I A;  1K5U A;  3B9U A;  1BA7 A;  3FJJ A;  3F62 B;  1I1E A;  4QBV A;  2RG9 B;  5D61 A;  1F31 A;  3WMU A;  41BI A;  1G9C A;  3CA5 A;  5G00 A;  4OWL A;  4I6I A;  3UD8 A;  1V6X A;  3FFZ A;  3Q7X A;  5FZU A;  1JQZ A;  4XFT A;  3ZC9 A;  4IZX A;  4ZGR B;  4X3A A;  1FV3 A;  4XKI A;  4YOL A;  3CAH A;  2VSA A;  1HWO B;  4DCK C;  4OEG A;  1J0S A;  5JLV A;  1BLD A;  1I1B A;  1MC9 A;  1DFC A;  2IWT B;  2K43 A;  3O4D A;  3FJI A;  2HW9 A;  3BB2 A;  3AKI A;  4G9M A;  4R6U B;  2E4M C;  5DUY A;  4A7Y A;  3CQA A;  3ILA A;  4I4Q A;  4QBC A;  4KEI A;  1T4Q A;  2KLL A;  4XFU A;  3EF2 A;  3FJA A;  5DSS B;  2VLC A;  5BP5 A;  4ISQ A;  3E8L C;  4LO3 C;  3OGG A;  1EV2 A;  1DZD A;  5FNW A;  1M2T B;  2HZ9 A;  4END A;  2FO1 A;  1V6U A;  3IIR A;  3OBR A;  4I4R A;  3FJB A;  3N7J A;  1TWM A;  1DLL A;  1R8O A;  4I4P A;  1OQL B;  4KEK A;  3CA6 A;  2LIQ A;  3Q7Y A;  2ESU A;  1S0G A;  4I4U A;  2K8R A;  2Q3N B;  1XZZ A;  1ITB A;  1CE7 B;  1YF8 B;  2AFG A;  3IAG C;  3A22 A;  3VT1 A;  5I1B A;  4QAL A;  3O4C A;  3WO3 A;  4A7K A;  2J3P A;  1CVS A;  4LO7 C;  1V6V A;  1XYF A;  1L2H A;  1M16 A;  9ILB A;  4J2S A;  2D7R A;  2AAI B;  1TTU A;  3HBW A;  3I2A A;  4P0K A;  3HMY A;  4OW4 A;  1YTO A;  4Q9P A;  4OEE A;  4EFR A;  2KH2 A;  5DZU A;  3BAU A;  4F83 A;  2VSE A;  3WIN C;  3OJM A;  4JQ0 A;  1SZ6 B;  1YXW A;  3H6S E;  1AVW B;  1S0B A;  2DS0 A;  2KI4 A;  4LO1 C;  5D62 A;  4IY8 A;  4MZG B;  5EG6 C;  2NYY A;  3FJD A;  3MPP G;  5FZZ A;  4LO0 C;  2NP0 A;  4J23 B;  4EKX B;  1WD4 A;  2BFH A;  3NBD A;  2R9K B;  5FZY A;  4USO A;  3FGM A;  1TFM B;  4I0Y A;  1NZK A;  1GGP B;  4ZBV B;  2E4M A;  3VUO A;  3D7W B;  4AN6 A;  4JKQ A;  1TWE A;  1T9F A;  2AQZ A;  5EC5 A;  3BRG C;  1S0F A;  3QYD A;  4QKS A;  4LO3 A;  4J2Y A;  2F2F C;  4ZA3 B;  3PHZ A;  3RTI B;  1BFB A;  3BA7 A;  4GOV A;  3HN1 A;  4I1E A;  5E24 E;  3BAD A;  3AH1 A;  1WBA A;  3O4B A;  3NBE A;  3FUQ A;  4PC4 A;  1HWP B;  4I1B A;  1BFF A;  3C9Z A;  1WD3 A;  1HWN B;  1EVT A;  1G82 A;  2ZR1 B;  3NJ5 A;  4LO7 B;  1D0H A;  2KI6 B;  2NS2 A;  4P0L A;  4EFQ A;  5BXR A;  2Y9W C;  1RY7 A;  1AVU A;  3CA4 A;  3JRR A;  1XHB A;  5BVP I;  3UD9 A;  1ISX A;  2GZB A;  3V0A A;  2D1Z A;  4X39 A;  3WIN A;  4AN7 B;  3WO2 A;  4Q91 A;  3FJ8 A;  3BTA A;  2HWM A;  3ZXD A;  1G9D A;  1Z0H A;  1TP0 A;  1JLX A;  2I1B A;  1IJT A;  4LO1 A;  2Z48 A;  2FGF A;  4IY9 A;  2P23 A;  1S0D A;  4LO0 A;  5EHA A;  1HCE A;  2RST A;  3IM5 A;  1HWM B;  2DRZ A;  5F8Y A;  4IHZ A;  1BAR A;  5GAQ A;  4I3N A;  4USP A;  3Q7W A;  3AJ6 A;  1IRA X;  2DRE A;  4H9W A;  1Z2V A;  4P6A A;  3VT2 A;  4QKR A;  3OBT A;  4JRA A;  1G9B A;  1JT5 A;  3A23 A;  3UD7 A;  2HWA A;  1FWV A;  3CA1 A;  1KNM A;  2P39 A;  4GP3 A;  1FMZ A;  3AH4 A;  1R8N A;  3FJE A;  3N0K A;  3O4A A;  2MLL B;  4LO2 C;  2F2F A;  3VSF A;  1A8D A;  3N7L A;  2VXR A;  1YBI A;  4G6M A;  31BI A;  1FWU A;  1QXM A;  1JT3 A;  3BRD A;  3AKF A;  1DJS B;  2L5X A;  3BAV A;  3V79 C;  1ABR B;  5DVH A;  2K4A B;  3S8J A;  1NUN A;  1ILR 1;  3R4S A;  1W3A A;  3O44 A;  4GAI A;  4I4Y A;  2BEA A;  4F34 A;  3I29 B;  1HKN A;  2Y9X E;  3BAG A;  2F8X C;  1MD6 A;  3MAL A;  1QQL A;  1S0E A;  4OEF A;  3BAH A;  3CRH A;  3I2X A;  1QQK A;  3A21 A;  1IRP A;  1FQ9 A;  4MZH A;  4WBC A;  3NBN A;  4IYB A;  3VEQ A;  8I1B A;  1UPS A;  1W3F A;  2Y9G A;  3T8S A;  3N7K A;  4ZKT B;  1W3G A;  2NTD A;  5BOW A;  1EYL A;  1JLY A;  2KKI A;  5JMC A;  2WBC A;  1PZZ A;  1G9A A;  3W9T A;  3V0B A;  1YYN A;  1FGA A;  1TOO A;  2RQ9 A;  3FJC A;  2MC2 A;  3H6Q A;  3BA4 A;  4QC4 A;  4I4O A;  1N4K A;  3OJV A;  3O5W B;  2VU9 A;  1Q04 A;  3OGF A;  4GP0 A;  1DFQ A;  1JT4 A;  3AH2 A;  4DEP A;  4ISR A;  4I4V A;  4KEJ A;  4H75 A;  1EPW A;  3OJ2 A;  4GOY A;  2IHO A;  1RG8 A;  2D7I A;  3O3Q A;  3AKH A;  3VWC A;  3A07 A;  2VUA A;  3PUB A;  4MZF B;  4G6J A;  2Q9X A;  2D44 A;  1K5V A;  5BXS A;  4LO2 A;  1FV2 A;  3ZXG A;  4XFS A;  2ZQN A;  3ZX7 A;  1S0C A;  4JKX B;  3PG0 A;  4Z9W B;  2WRY A;  5FNX A;  4OUJ A;  1AF9 A;  3FJF A;  4EB2 B;  1V6W A;  3V0A B;  3ZC8 A;  4Q9G A;  3IM7 A;  1AXM A;  1ISW A;  2X2T A;  2Y9F A;  3IM6 A;  4D8H A;  1RML A;  5F8W A;  4ZFY B;  2D43 A;  4TLP A;  4HA2 A;  4DEN A;  5BQU C;  1E0O A;  4P0J A;  3RMY A;  1Z4S A;  3CU1 B;  3O49 A;  4FGF A;  1ISZ A;  4JPZ A;  1Q03 A;  3BAO A;  3BAQ A;  4QO3 A;  4Z8S B;  3WO4 A;  1HIB A;  2NZ9 A;  4J2X A;  5BXP A;  3CRG A;  1FN0 A;  3LTQ A;  4HJJ A;  3O4O A;  6I1B A;  4ZFW B;  3TC2 A;  2QYI B;  3RSJ A;  4G1R A;  4ZLB B;  4QD2 C;  4I7I A;  1ISY A;  4OWJ A;  4ION A;  3H6R A;  3P6J A;  3PME A;  5HPZ A;  4I4X A;  1BFG A;  1XG6 A;  2ERM A;  3HOM A;  2FFU A;  3UDA A;  3K1X A;  2NM1 A;  3H6R B;  4I37 A;  1RZO B;  1DZC A;  2VXT I;  1WBC A;  3HAL A;  1SR4 C;  2ET2 A;  4KBB A;  3RMX A;  2MIB A;  4G9N A;  3UJ0 A;  5F8S A;  3JUT A;  3SNV A;  4I2S A;  4UY4 A;  1JTC A;  4H04 A;  3P6I A;  3FJK A;  2M49 A;  4L4H A;  3P53 A;  4I96 A;  4II0 A;  1TIE A;  3VSZ A;  3LLP A;  4OWK A;  2FDB M;  1IIL A;  2LIE A;  4D0T A;  3KMV A;  3R4U A;  3NBC A;  4JAW A;  4KC3 A;  2ZQO A;  3BX1 C;  3WA1 A;  4X37 A;  3S8K A;  1HCD A;  1PC8 B;  3FJ9 A;  1PWA A;  3VT0 A;  4EFP A;  1BFC A;  3CA3 A;  3UJ4 A;  4A7Z A;  3CA0 A;  3N7M A;  3BRF A;  3F1R A;  1BAS A;  4EEE B;  1AVX B;  4JP0 A;  4LO8 B;  2D20 A;  2YUG A;  2DRY A;  3AZV A;  4HR6 C;  1II4 A;  1P63 A;  5BXT A;  5D63 A;  2FFV A;  3V0B B;  2AXM A;  5BP5 C;  4IQP A;  5BQU A;  4ZFU B;  2D23 A;  1DIW A;  1PUM B;  2D24 A;  3QR5 A;  3AZW A;  2BEB A;  2GO2 A;  3WMV A;  1IOB A;  3HSM A;  3FUO A;  4IZE A;  1ONK B;  4FVV A;  4GAF A;  5B2H A; 
#chains in the Genus database with same CATH homology
 1DQG A;  7I1B A;  4CJM A;  4ZOT A;  2NVH A;  1JY0 A;  1S0L A;  1AFC A;  1Q1U A;  1FMM S;  3POK A;  1BLA A;  1JT7 A;  1IT0 A;  2Z49 A;  4D0Z A;  1PUU B;  2D22 A;  2QN4 A;  2UUS A;  5F90 A;  4QD2 B;  2X2S A;  3CRI A;  4I4S A;  3BA5 A;  21BI A;  2XOA A;  1AVA C;  4X38 A;  3AKG A;  1DQO A;  4J2K A;  1ISV A;  1SR4 A;  3RTJ B;  3AJ5 A;  4I8M A;  1VCL A;  3FJH A;  1IHK A;  4L4I A;  1K5U A;  3B9U A;  1BA7 A;  3FJJ A;  3F62 B;  1I1E A;  4QBV A;  2RG9 B;  5D61 A;  1F31 A;  3WMU A;  41BI A;  1G9C A;  3CA5 A;  5G00 A;  4OWL A;  4I6I A;  3UD8 A;  1V6X A;  3FFZ A;  3Q7X A;  5FZU A;  1JQZ A;  4XFT A;  3ZC9 A;  4IZX A;  4ZGR B;  4X3A A;  1FV3 A;  4XKI A;  4YOL A;  3CAH A;  2VSA A;  1HWO B;  4DCK C;  4OEG A;  1J0S A;  5JLV A;  1BLD A;  1I1B A;  1MC9 A;  1DFC A;  2IWT B;  2K43 A;  3O4D A;  3FJI A;  2HW9 A;  3BB2 A;  3AKI A;  4G9M A;  4R6U B;  2E4M C;  5DUY A;  4A7Y A;  3CQA A;  3ILA A;  4I4Q A;  4QBC A;  4KEI A;  1T4Q A;  2KLL A;  4XFU A;  3EF2 A;  3FJA A;  5DSS B;  2VLC A;  5BP5 A;  4ISQ A;  3E8L C;  4LO3 C;  3OGG A;  1EV2 A;  1DZD A;  5FNW A;  1M2T B;  2HZ9 A;  4END A;  2FO1 A;  1V6U A;  3IIR A;  3OBR A;  4I4R A;  3FJB A;  3N7J A;  1TWM A;  1DLL A;  1R8O A;  4I4P A;  1OQL B;  4KEK A;  3CA6 A;  2LIQ A;  3Q7Y A;  2ESU A;  1S0G A;  4I4U A;  2K8R A;  2Q3N B;  1XZZ A;  1ITB A;  1CE7 B;  1YF8 B;  2AFG A;  3IAG C;  3A22 A;  3VT1 A;  5I1B A;  4QAL A;  3O4C A;  3WO3 A;  4A7K A;  2J3P A;  1CVS A;  4LO7 C;  1V6V A;  1XYF A;  1L2H A;  1M16 A;  9ILB A;  4J2S A;  2D7R A;  2AAI B;  1TTU A;  3HBW A;  3I2A A;  4P0K A;  3HMY A;  4OW4 A;  1YTO A;  4Q9P A;  4OEE A;  4EFR A;  2KH2 A;  5DZU A;  3BAU A;  4F83 A;  2VSE A;  3WIN C;  3OJM A;  4JQ0 A;  1SZ6 B;  1YXW A;  3H6S E;  1AVW B;  1S0B A;  2DS0 A;  2KI4 A;  4LO1 C;  5D62 A;  4IY8 A;  4MZG B;  5EG6 C;  2NYY A;  3FJD A;  3MPP G;  5FZZ A;  4LO0 C;  2NP0 A;  4J23 B;  4EKX B;  1WD4 A;  2BFH A;  3NBD A;  2R9K B;  5FZY A;  4USO A;  3FGM A;  1TFM B;  4I0Y A;  1NZK A;  1GGP B;  4ZBV B;  2E4M A;  3VUO A;  3D7W B;  4AN6 A;  4JKQ A;  1TWE A;  1T9F A;  2AQZ A;  5EC5 A;  3BRG C;  1S0F A;  3QYD A;  4QKS A;  4LO3 A;  4J2Y A;  2F2F C;  4ZA3 B;  3PHZ A;  3RTI B;  1BFB A;  3BA7 A;  4GOV A;  3HN1 A;  4I1E A;  5E24 E;  3BAD A;  3AH1 A;  1WBA A;  3O4B A;  3NBE A;  3FUQ A;  4PC4 A;  1HWP B;  4I1B A;  1BFF A;  3C9Z A;  1WD3 A;  1HWN B;  1EVT A;  1G82 A;  2ZR1 B;  3NJ5 A;  4LO7 B;  1D0H A;  2KI6 B;  2NS2 A;  4P0L A;  4EFQ A;  5BXR A;  2Y9W C;  1RY7 A;  1AVU A;  3CA4 A;  3JRR A;  1XHB A;  5BVP I;  3UD9 A;  1ISX A;  2GZB A;  3V0A A;  2D1Z A;  4X39 A;  3WIN A;  4AN7 B;  3WO2 A;  4Q91 A;  3FJ8 A;  3BTA A;  2HWM A;  3ZXD A;  1G9D A;  1Z0H A;  1TP0 A;  1JLX A;  2I1B A;  1IJT A;  4LO1 A;  2Z48 A;  2FGF A;  4IY9 A;  2P23 A;  1S0D A;  4LO0 A;  5EHA A;  1HCE A;  2RST A;  3IM5 A;  1HWM B;  2DRZ A;  5F8Y A;  4IHZ A;  1BAR A;  5GAQ A;  4I3N A;  4USP A;  3Q7W A;  3AJ6 A;  1IRA X;  2DRE A;  4H9W A;  1Z2V A;  4P6A A;  3VT2 A;  4QKR A;  3OBT A;  4JRA A;  1G9B A;  1JT5 A;  3A23 A;  3UD7 A;  2HWA A;  1FWV A;  3CA1 A;  1KNM A;  2P39 A;  4GP3 A;  1FMZ A;  3AH4 A;  1R8N A;  3FJE A;  3N0K A;  3O4A A;  2MLL B;  4LO2 C;  2F2F A;  3VSF A;  1A8D A;  3N7L A;  2VXR A;  1YBI A;  4G6M A;  31BI A;  1FWU A;  1QXM A;  1JT3 A;  3BRD A;  3AKF A;  1DJS B;  2L5X A;  3BAV A;  3V79 C;  1ABR B;  5DVH A;  2K4A B;  3S8J A;  1NUN A;  1ILR 1;  3R4S A;  1W3A A;  3O44 A;  4GAI A;  4I4Y A;  2BEA A;  4F34 A;  3I29 B;  1HKN A;  2Y9X E;  3BAG A;  2F8X C;  1MD6 A;  3MAL A;  1QQL A;  1S0E A;  4OEF A;  3BAH A;  3CRH A;  3I2X A;  1QQK A;  3A21 A;  1IRP A;  1FQ9 A;  4MZH A;  4WBC A;  3NBN A;  4IYB A;  3VEQ A;  8I1B A;  1UPS A;  1W3F A;  2Y9G A;  3T8S A;  3N7K A;  4ZKT B;  1W3G A;  2NTD A;  5BOW A;  1EYL A;  1JLY A;  2KKI A;  5JMC A;  2WBC A;  1PZZ A;  1G9A A;  3W9T A;  3V0B A;  1YYN A;  1FGA A;  1TOO A;  2RQ9 A;  3FJC A;  2MC2 A;  3H6Q A;  3BA4 A;  4QC4 A;  4I4O A;  1N4K A;  3OJV A;  3O5W B;  2VU9 A;  1Q04 A;  3OGF A;  4GP0 A;  1DFQ A;  1JT4 A;  3AH2 A;  4DEP A;  4ISR A;  4I4V A;  4KEJ A;  4H75 A;  1EPW A;  3OJ2 A;  4GOY A;  2IHO A;  1RG8 A;  2D7I A;  3O3Q A;  3AKH A;  3VWC A;  3A07 A;  2VUA A;  3PUB A;  4MZF B;  4G6J A;  2Q9X A;  2D44 A;  1K5V A;  5BXS A;  4LO2 A;  1FV2 A;  3ZXG A;  4XFS A;  2ZQN A;  3ZX7 A;  1S0C A;  4JKX B;  3PG0 A;  4Z9W B;  2WRY A;  5FNX A;  4OUJ A;  1AF9 A;  3FJF A;  4EB2 B;  1V6W A;  3V0A B;  3ZC8 A;  4Q9G A;  3IM7 A;  1AXM A;  1ISW A;  2X2T A;  2Y9F A;  3IM6 A;  4D8H A;  1RML A;  5F8W A;  4ZFY B;  2D43 A;  4TLP A;  4HA2 A;  4DEN A;  5BQU C;  1E0O A;  4P0J A;  3RMY A;  1Z4S A;  3CU1 B;  3O49 A;  4FGF A;  1ISZ A;  4JPZ A;  1Q03 A;  3BAO A;  3BAQ A;  4QO3 A;  4Z8S B;  3WO4 A;  1HIB A;  2NZ9 A;  4J2X A;  5BXP A;  3CRG A;  1FN0 A;  3LTQ A;  4HJJ A;  3O4O A;  6I1B A;  4ZFW B;  3TC2 A;  2QYI B;  3RSJ A;  4G1R A;  4ZLB B;  4QD2 C;  4I7I A;  1ISY A;  4OWJ A;  4ION A;  3H6R A;  3P6J A;  3PME A;  5HPZ A;  4I4X A;  1BFG A;  1XG6 A;  2ERM A;  3HOM A;  2FFU A;  3UDA A;  3K1X A;  2NM1 A;  3H6R B;  4I37 A;  1RZO B;  1DZC A;  2VXT I;  1WBC A;  3HAL A;  1SR4 C;  2ET2 A;  4KBB A;  3RMX A;  2MIB A;  4G9N A;  3UJ0 A;  5F8S A;  3JUT A;  3SNV A;  4I2S A;  4UY4 A;  1JTC A;  4H04 A;  3P6I A;  3FJK A;  2M49 A;  4L4H A;  3P53 A;  4I96 A;  4II0 A;  1TIE A;  3VSZ A;  3LLP A;  4OWK A;  2FDB M;  1IIL A;  2LIE A;  4D0T A;  3KMV A;  3R4U A;  3NBC A;  4JAW A;  4KC3 A;  2ZQO A;  3BX1 C;  3WA1 A;  4X37 A;  3S8K A;  1HCD A;  1PC8 B;  3FJ9 A;  1PWA A;  3VT0 A;  4EFP A;  1BFC A;  3CA3 A;  3UJ4 A;  4A7Z A;  3CA0 A;  3N7M A;  3BRF A;  3F1R A;  1BAS A;  4EEE B;  1AVX B;  4JP0 A;  4LO8 B;  2D20 A;  2YUG A;  2DRY A;  3AZV A;  4HR6 C;  1II4 A;  1P63 A;  5BXT A;  5D63 A;  2FFV A;  3V0B B;  2AXM A;  5BP5 C;  4IQP A;  5BQU A;  4ZFU B;  2D23 A;  1DIW A;  1PUM B;  2D24 A;  3QR5 A;  3AZW A;  2BEB A;  2GO2 A;  3WMV A;  1IOB A;  3HSM A;  3FUO A;  4IZE A;  1ONK B;  4FVV A;  4GAF A;  5B2H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...