4P1BC

Crystal structure of the toluene 4-monooxygenase hydroxylase-ferredoxin c7s e16c c84a c85a variant electron-transfer complex
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
82
structure length
82
Chain Sequence
SAFPVHAAFEKDFLVQLVVVDLNDSMDQVAEKVAYHCVNRRVAPREGVMRVRKHRSTELFPRDMTIAESGLNPTEVIDVVFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Toluene-4-monooxygenase system protein A
publication title Structural basis for biomolecular recognition in overlapping binding sites in a diiron enzyme system.
pubmed doi rcsb
source organism Pseudomonas mendocina
molecule tags Oxidoreductase
total genus 23
structure length 82
sequence length 82
chains with identical sequence F
ec nomenclature ec 1.14.13.236: Toluene 4-monooxygenase.
pdb deposition date 2014-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF06234 TmoB Toluene-4-monooxygenase system protein B (TmoB)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.270 Alpha Beta Roll Ubiquitin-like (UB roll) TmoB-like 4p1bC00
1T0QC 4P1CC 3Q2AC 3I5JC 3RNCC 1T0RC 3RNAC 3N1YC 2INCC 3GE8C 3N1ZC 3Q14C 3DHGC 3I63C 3Q3OC 2INDC 3RN9C 3Q3NC 3N20C 2RDBC 3Q3MC 3RI7C 3N1XC 4P1BC 3RMKC 3RNBC 3DHHC 3RNGC 1T0SC 3RNEC 3RNFC 3DHIC 3GE3C
chains in the Genus database with same CATH superfamily
2G45B 4FHJA 2JRIB 3L54A 1B1ZA 2KQ7A 5BYQA 2AL3A 1L0VB 1HE8A 2L0TA 1I4GA 1RLFA 1IBXA 3W2DA 1S1QB 3VXWA 1I4QA 2KC2A 2Y3AA 2WXMA 3URYA 1N63A 4K7SA 3ENEA 3ZRFA 2MP2B 2K6DB 1NBFC 3A9KA 5T8IA 4AP4C 3NUHB 2DYOA 1QF6A 1L4DB 2D3CA 4W9LA 1RAXA 1P7FA 2DAFA 4IWOA 4MJSB 1WGRA 4F1SA 1V1OA 1J7CA 5E6JA 1QOFA 1E7UA 2RR9A 3R7RA 3DQVA 3RPFC 5CX3A 1IGCA 3AE1B 4YXDB 3QHTA 1V80A 4KX6B 3D32A 4W9JA 4ANXA 5BYSA 1Y56A 4GDKB 4B95A 2V1YA 2LZ6A 2C7MB 4EZKA 4HKQA 2WXRA 1WJ4A 2H89B 3UI3A 2N0SB 2HE7A 1PGBA 2DWQA 2NPTA 4MH0E 2OEDA 2N7EA 2MH7A 4K7UA 3VTWA 4YSYB 5AZFA 1V6EA 2VRRB 2BYVE 3VR9B 1AARA 3S2AA 2KDEB 2LGSA 4A3OA 3AE3B 5GMVA 2CJNA 3L10B 1TY2A 4AS1A 4A9AA 3KUZA 4XE0A 3SFDB 1D3ZA 1AYFA 3R7QA 3AE6B 2BS2B 4PS7A 1PGAA 3ZGZA 3QIJA 3AE8B 1I4PA 5KHQA 4A55A 2ASQA 4HEA1 4FULA 3DVGX 2MBBB 1GB4A 4WAFA 4EFOA 2FIFA 4HLEA 2DNFA 1I35A 2OJRA 3TIXA 2D3GA 3ZXVA 2LVPA 4RGOS 2GMIC 1PFDA 2HDEA 5AUIA 2CHWA 4FJZA 2EKEC 4YT0B 2LD9A 2WQYB 1RFKA 4MGYE 1WE7A 2BW2A 3TSSA 3OLMD 2A5UA 2VZKB 3RZWC 2SEBD 4DHJB 4XC2A 1YQBA 3ONSA 3MTNB 4O1NA 4RFBA 2KMCA 2J52A 3HHMA 1TBEA 1KLUD 2CR5A 1WSPA 2V9HA 4ANUA 2PIAA 3NVVA 1I42A 3TJPA 4AOFA 1QQRA 3APCA 5FKAC 1ZUD2 5C2TB 2ZCBA 4W9CA 1E5WA 1V5TA 4DHZE 1XLOA 3V05A 2XNAC 1WXMA 3P4QB 3N1XC 4J6IA 4NAMA 2AQ2B 1WRIA 1SE2A 3AN1A 4FLHA 3C8YA 4MEMA 1D6EC 2J0MA 1KM7A 4LNKA 2GB1A 4YTMB 4DHZB 3H8HA 2INNE 2PJHA 1GUAB 2KHWB 1GPXA 1WMHB 2OJWA 2KYWA 4JL9A 3KQ4A 3W5VB 2G4SA 2IJ0A 3Q6BA 1WH3A 2ON8A 2BKFA 2GBKA 1WX8A 2N1VA 1WGDA 4HROA 2MBEA 3BYTB 3DBRB 3ZQ4A 4NJ6A 3TCAA 2E6XA 5BYRA 1F9JA 4RM8A 3AMZA 2ZW0A 3GE3C 4BFRA 3HK0A 3PHXB 4EEWA 3NY5A 3PSEB 3M3JA 1CZPA 4PT5A 1VJKA 4LJPB 4CO7A 4W9GA 1DYQA 2W54A 3VUXA 3P4PB 4G0NB 1NI2A 4BKGA 1JROA 3DBHI 1TS5A 1TJEA 1FEHA 2DZJA 4L23A 2KMAA 3Q8EA 3MFGA 1E8YA 3VUWA 2MSED 4KSKC 2KFKA 3N20C 3HM6X 1EUVB 1QLBB 4YSXB 5JH5C 2GOWA 3BK1A 2L83A 4AQ7A 5J17A 1UGJA 2PKOA 3EHVA 4KSLC 4W9EA 3B0AA 5BMHA 3WAOA 1PGXA 2CU1A 3Q14C 4ZHPA 1L0XB 3E56A 1WXAA 1FCLA 3PVLA 3RMKC 3ZTCA 5EE0A 3AULA 4C4VB 4KKJA 4FADA 4BOSC 5J18A 1YQ3B 1X1MA 2MP2A 3BIID 2KANA 3Q8AA 4I6PA 3WA0A 1SB3C 2KN4A 5C3JB 1L6UA 1WGKA 2QCZA 1N62A 1PDXA 1TZ1A 3Q3NC 2KFJA 4MJSA 1YD8U 3VVWB 5D6JB 4YL8A 2D10A 3PHWB 2KDMA 1WR6E 1E90A 1KOTA 1WZ3A 2KDIA 2MBQA 3NHEB 2C7HA 2OHFA 3EGRA 5EE1A 3DBLB 2NBVB 1EF1A 4JIOU 2MX2A 3I63C 4GDKA 2DLBA 2ZZPB 3PS6A 4D2KA 1RM6C 2Z59B 2YEPB 3AECB 3KLSX 4MGIE 5DPTA 1P98A 2JPHA 4GIVA 2KVZA 4IC7B 4ZHOA 3RNGC 4H2AA 2JYEA 1VCBA 1Q10A 2RDGA 3BZDB 5DPWA 1FM0D 3BVGA 2K5PA 2ZW1A 4N6EB 3SD5A 4P7IA 2KXJA 2BS3B 4EOYA 3Q3FA 2UYZB 2JU6X 2JRHA 2K22A 4DBGA 1ZKHA 2KT7A 4W9KA 1JWMD 4TQ0A 3MHSD 4RGNA 5LXIB 2IBIB 3PRPB 3EFCA 2PEAA 4C7YA 4NQLB 1D5ZC 2C9WB 3MHZA 3EUB2 4TSSA 2SAKA 3GS2A 2KQ4X 3VTUA 2JY6A 2PVOD 1F2RI 1WXQA 1QOBA 2NTSA 3PZ7A 3A1QB 1JALA 3M95A 4ZYSA 2V0GA 2VZKD 3N3KB 2JZZA 3A9JB 5IAAC 4DHJD 1UBIA 1V9JA 2DZMA 1L7YA 1ROEA 3HRDD 2TSSA 2KVRA 4A20A 3R3MA 3NVZA 3C19A 2RMMA 3U8ZA 1U4AA 1F52A 1J0GA 1YIWA 3AU4A 2K8BA 4KDIC 1IP9A 3N30A 3QARA 4ITKA 3K9PB 4E3CA 3AU5A 5EE9A 2LVOA 1C78A 3KUCB 4OVVA 2RSUA 3E9SA 1FNVA 3GZNI 4ZRKA 3QC8B 3CSTA 1ET6A 4JPSA 1HZ6A 1WX9A 1MG8A 2AYOB 4KZCA 1MG4A 1TTNA 3QJZA 3ZRCA 3V60A 1XT9B 2IY1B 3RNFC 1N5XA 1XLPA 1EWYC 2DYMA 4WWNA 2KDFB 4EUTA 1BMLC 2KO3A 2E3TA 4FJVB 1FXAA 5CHVC 3SDLC 1SXTA 1WWTA 1FFUA 1IYFA 3ZXRA 2KZRA 3IFWB 2INCC 1WM3A 3EC8A 1PUTA 3TEXA 3IT4B 3ZKJC 1QKZA 2KWDA 2N9KA 1BT0A 2LEKA 3GB1A 4BVUC 3AEAB 2IGHA 5CHFA 1MI0A 2W3SA 2D11A 2N7JA 2WX0A 1FNUA 4RMAA 3GE8C 3H6NA 2FIDA 2WXHA 2N7DA 3BY4B 4HKZE 2ZPNA 3VDZA 2MQJA 4G11A 1M4VA 3ZNHB 1OGWA 2PVGC 1AWDA 3QK0A 1NYQA 2LJ5A 4HJGE 3PTFC 4GXBA 5E6OA 2MJ3A 4XX5A 4RM9A 2ZNVB 3U52E 3JW0X 2WXFA 2AL6A 4AUQC 1XF5L 1M94A 1FXIA 4A3PA 3Q8FA 4HXDA 5J2RA 4HPMB 4LLGM 4IUMB 2JXXA 2I1KA 4BAXA 3DBHB 5LNK1 4AJYB 1JWAD 1FPYA 1TS3A 4WIPA 2M0XA 2MCNB 3SEBA 4HK2A 2QHOA 3R66C 4MT5A 2Y5CA 4PK1A 4QAYA 3EFUA 1YN4A 3BVZA 1SJED 2L0FA 4N9F4 3VUYA 2XN9C 1YX6B 3WAPA 2ZCCA 3M63B 2GBNA 3BVMA 3ZO5B 2REXA 1L6VA 3DCGA 2ACZB 5HHDG 2ZPYA 3I5JC 1E10A 1YX5B 2RGFA 1NVID 3Q69A 2EKIA 2JQRB 2G1EA 1XD3B 1TGZB 2N9XA 4PYZA 2JXTA 2K0PA 2JWUA 4B9KA 1XLQA 2C60A 4ZRQA 1T0QC 3MP9A 2LRWA 4URKA 3AV8A 4II2B 1TKYA 3VH4B 3T8MA 3PLVA 1FD6A 2LFIA 1L5PA 4OZBA 2KK8A 4LNNA 2RDBC 1XQQA 1NENB 1WJ6A 2V3NA 2RD0A 2FCMA 5BO4B 2Y5BB 2GBMA 1Q0WB 2LHDA 1N6ZA 1MHHE 3N1YC 4L1BA 1SEBD 5FR3A 1QZEA 4A6QA 3W1SA 3QX1A 2BB6A 2MWSB 3T3NA 1WZ0A 4C56C 1NEKB 4LDTB 1UNSA 1TZOA 4MGZE 4B0MA 2DYBA 1IPGA 1H4RA 3C0RB 3DBSA 3ALBA 4KGSA 3LJ3A 2BWES 1YN3A 3AEEB 1RFAA 2BQQA 2WYQA 5D3IB 1J7BA 1CJEA 1S3SG 4MM3B 4M0WB 3RT3B 1JWUD 3VHTC 2OOBB 1OEYA 1Z5SB 2NS5A 3A1QA 1C4AA 3PRZA 2LUEA 3A9JA 2GBJA 2BS4B 3U4EG 3OJ3A 4WWMA 2XK5B 4LK0M 2WU5B 2ZVNA 3QCAA 2M19A 5IP4D 4WQMA 4NQKE 3HIZA 2K8HA 4G50A 5IOIA 1QT9A 3TEWA 4CYEA 4ZRJA 4P1CC 2V3SA 1NDDA 4JE3B 5E6NA 4B0EA 4ZYNA 4FHKA 2J4XA 2Z0EB 3JYUA 4OZCA 1XEEA 5AZGA 1CMXB 3FC4A 3AE7B 1QOAA 5G55A 3RZFA 1NYRA 1J19A 2KOXA 1HTOA 1FCCC 3GZNB 4KGRA 2KQSA 2KAJA 5FK9C 3NVYA 4F8CB 1DGJA 3CIRB 2EMSA 4IOIE 4K1RB 3IT6B 4L2YA 2WXLA 3VRBB 1VD2A 1F77A 1I7HA 1OQQA 3UIPB 1GB1A 2QMTA 4C00A 2RDHA 1WM2A 4RF1A 5C1ZA 2WXNA 3APFA 5JXVA 3AE5B 3KVFB 1GJZA 1OQRA 1PQSA 4HWIB 4NY0A 4S17A 1EM7A 4II3B 3P4SB 1LGRA 3VAWA 1F0ZA 2ONQA 1FFVA 3EECA 3SU8X 1C4CA 4BKSD 1E7VA 2WXGA 4A90A 1F1HA 2JWZA 1OTRB 3LB8C 1ZXHA 3RD2A 4BKSA 2HJ1A 4PS8A 2X38A 3MJWA 1MFWA 2MHJA 2LGXA 3OWEB 4LCDE 2PLPA 2FCNA 2Z0DB 2D2QA 4HRSA 2L8JA 4LNFA 4TUUA 1I4XA 2ZEQA 5IA7A 3L16A 5G2NA 5H92C 3VH3B 2VH2A 4FXCA 1GG3A 2M17A 2XEWA 3B2GA 1LO5D 3NS1A 4WJOA 2A4ZA 3Q3MC 1YMHE 1SIFA 4ANVA 2BT6A 2LGIA 2LVQA 1T0SC 2IYDB 4YTPB 1VZ7A 2K1FA 2NTTA 5HKHA 1OFFA 4KVGB 1SGHA 4RCOA 3QWZB 2N9PC 5GXGB 2KJHB 3IAS1 4MELA 2B3AA 1FXTB 1E6EB 3R8BA 3U7DA 3PO0A 1SSNA 3AM9A 5L83A 3SFEB 2ZVOA 1I4HA 2QIEB 1FRRA 3H1UA 4W9IA 3NZUA 4MSQB 5EDSA 1STEA 2JUOA 3L4PA 2WXPA 2L32A 1V8CA 3RCZA 2D07B 4RGTA 1DOXA 3APDA 1KH0A 3L08A 2MW5A 1UELA 1C4PA 2BYEA 2V4IB 1V49A 1WXSA 2DAJA 4KDLB 3WCQA 3UQAA 2KWUB 2WS3B 3KYDD 2WLBA 2IPKD 3AE9B 4WH4A 3ETRA 1WYWB 2PE6B 3RULA 1FIQA 2KJRA 3U30A 2CJOA 2DZIA 4LDTD 1WY8A 3B9JA 2KTRB 1ZGUB 2FCSA 2W82A 3WALA 3ML9A 1J7AA 4X57B 1TS4A 4C7ZA 3GOEA 2MBOA 4PYUA 3H7PB 2JZPA 1N60A 2WXIA 1HEZE 4WJPA 3MJ5A 4LNOA 5AUKA 2VH1A 4JWUC 3RN9C 2J7QB 4N59A 2CHXA 2I38A 1ENFA 2HTME 2IZVB 2Q5WD 4WWPA 3TBLD 3ZVVA 1EU4A 2Y5PA 4EZLA 4MM3A 4M0WA 3I9V1 2WDQB 2K6QA 3PGEA 3ZNZB 4DXAB 2BWFA 2D3AA 4YSZB 1BUIC 3VR8B 4PS3A 4KIKB 4NJCA 2KMMA 1YOVB 3IAM1 2C5LC 4WQOB 2XK5A 1E8WA 4IM0A 2W9NA 3DVGY 3VQIA 1HQRD 4LTUA 2UU7A 4YTNB 3H7SA 4MDKE 4OHJA 5IKCM 1C76A 1L2NA 4IKGA 4USAA 3AE4B 2N4FA 3ZNID 2NMQA 2KJ6A 1AN8A 2QEJC 5CTRC 3IXSA 4TMAB 2IGGA 2MA9B 4US9A 3RUIB 4CQNA 4MH8A 1AW7A 1UUPA 3V61A 2ZJDA 2CS4A 2GBRA 4GLSC 4ICUA 1PYWD 5G5HA 2JF5A 2WDVB 4RH6A 2CU3A 3KW5B 2IO3B 3V62A 4JWSC 3HVDA 1ISNA 2MJDA 3PZ8A 2BKRB 1B9RA 5TSSA 1EO6A 2J53A 3K9OB 5LLIA 1JWSD 2HJ8A 1UBQA 5FR6A 2DHZA 4JLCA 2X8XX 2J0KA 1GC6A 1UD7A 3BYYB 1K50A 1WMHA 5D7GA 3L0WB 2LXAA 5HG2A 3ZJVA 4RNAA 2WGSA 2JVCA 4HPLB 4ZDVA 1RRBA 1ZP0B 4HCPB 3H9DA 1JRPA 4GN1A 2KTFA 4GSWA 1P0RA 3IVFA 1JRUA 4C80A 2GLSA 2K8CA 3OG5A 2O2VB 1WGGA 3RNEC 3W1SC 5EE3A 1DOIA 4IG7B 5D3DA 5DPRA 3ZTDA 2L05A 4KZ0A 4ZRPA 4WAAA 3FKYA 3T3OA 4EE2A 2INDC 1JMLA 3SR6A 4P6VF 2IO1B 4GMVA 3P63A 2IY0B 2I1JA 4M8MA 1V5OA 4IW0A 2GI9A 3P4RB 1FO4A 2FAZA 4RF0A 3MC9A 4BBNF 4BZAA 3KH0A 2JT4B 1WYGA 2CHZA 1ZE3D 4DQOC 3PT2B 2HTHA 4KV2A 1HZ5A 4IWQA 3HUIA 2DZKA 2WNMA 3DWGC 3BINA 2IO0B 4W9DA 1G6JA 1KFYB 3A33B 1IUEA 3V6EB 2AEHA 2LASA 1D4BA 5LXHA 1H8CA 4C4VA 2AQ1B 3UF8A 4XZ4A 1ZOYB 3WAMA 3NZSA 1WX7A 2MBHA 5DCNA 3I57A 3U2SC 3LYYA 4W9FA 4WURA 2W55A 2KWVB 4W9HA 1KTKA 3ML8A 1UWXA 1ACCA 4GB9A 1SBBB 2WXKA 2NCNA 4ANWA 1C77A 3ZJTA 3DHGC 1ZW7A 1VLBA 4ICVA 1D5XC 2LUMA 3UQBA 2MEKA 2KTRA 1QOGA 1UH6A 1ZXIA 1K8RB 1R4MI 3Q3JA 3A4RA 3O13A 3CF6E 3NZ3A 3H7PA 1SF0A 3IHPC 3DBLI 3JVZX 1SE4A 4OZAA 3WANA 4AJWA 4MSMB 3Q3OC 1VZ6A 2N9EB 1KF6B 1UGMA 1N5WA 1LXDA 2WWZA 1MVKA 2K25A 1RWSA 1E0ZA 1L0YB 2BB5A 4M02A 4EZJA 1KLGD 2MLBA 1E9MA 1P7EA 1V97A 2LI5A 1WFYA 3M62B 2Z8LA 2FCQA 3NVWA 2ZNVC 4A8XC 4I6NB 2G4DB 3UGBB 1WGYA 3KWVA 4KIKA 4J3OD 4NNJB 2FBWB 1CK1A 2LWPA 1L4ZB 2O6VB 1ET9A 3FILB 1LFDA 1C79A 1E8ZA 1GAQB 3ZUNA 3DHIC 2D3BA 1WR1A 1WJUA 1T3QA 5TR5A 1EU3A 1JQ4A 2NVUI 3B1LX 5JHBA 4DK5A 4ARIA 4XDDA 2MJEA 1XO3A 2KD0A 3RI7C 1T5XD 2YVCA 3W1YA 1FNWA 2JZ3B 5H8YE 3ZDTA 3AEFB 4JQWC 3L13A 4TQ1A 3Q8BA 4K3CA 2FE8A 2KC1A 4FJYA 2V4LA 3AXCA 3FAHA 1NI3A 2LRUA 2LHEA 2JYTA 1TKEA 3R2TA 2IDYA 3RNBC 4OVUA 3DHHC 2BYTA 1A70A 1TS2A 2R61A 3TEYA 3QA8A 1YQ4B 4YWGG 3GP7A 1TYGB 1T0RC 3T9LA 1VDVA 3AEGB 2QILA 1Y8RC 2UWQA 4WWOA 3PREA 3EA6A 2NBUA 4KGTA 1JWBD 1MJDA 4OVZA 3DWMA 3MC0B 3OJ4B 2K9XA 4M01A 3J9CA 4IDIA 4ACFA 3B08A 1R4NI 4BKTA 4NAWB 1T6BX 1TT5B 1YJJA 4WJQA 2LMCA 2O2VA 1V1PB 2KLCA 2PMVA 1HTQA 1J8CA 1DOYA 3IG3A 3AEDB 3N1ZC 4TV3A 4IM2A 3SHQA 3LDZE 3PPAA 2HD5B 1KLVA 1WRDB 3UIOB 2IGDA 4P1BC 4FBJB 2R2OA 4M00A 2KWCA 3TEZA 3OAWA 4FN2A 4HVBA 5DPSA 2AWTA 2CKHB 4MACA 1XLNA 2BVCA 4E71A 1TKGA 3ECIA 1D5MC 2V3PA 1T0YA 1BXTA 4B6WA 2N9LA 2WXJA 3N32A 1K53A 2M0AA 1F2RC 2L52A 4RGMA 5CHWA 1KRHA 2WXOA 4DXFA 1HA5A 2FUHB 3AB5A 3RYTA 3KYCD 4HPPA 3P42A 4GDLB 3AE2B 3BWUD 4ZOHC 2FNJB 3BK2A 4HCNB 3JSVB 3PV1A 4CHKA 2ICIA 1WE6A 4F7ZA 3VFKA 3VTVA 1WIAA 4GU2A 4AWJA 2NBWB 3I3TB 5IN7A 2BPSA 1V2YA 2XBBC 1VRAB 3KWLA 1C3TA 4NZLB 3U7ZA 5HI1A 1VZ8A 2B76B 4LNIA 2J0JA 2M1MA 2QDFA 3DVNV 1C1YB 5AZHA 2PTLA 2RPQA 3W9CB 1JCKB 2BF8B 3N9YC 1TIFA 2K39A 4S0RA 2N1WA 1K52A 2QC8A 5I4DA 3P1MA 1QILA 2QSDA 4GGQA 4UDUC 1WXVA 3HM3A 3V3XA 2KACA 1IBXB 2C7NB 4OW0A 1K51A 1MHXA 5IO9A 3PRMB 5C23A 2LJIA 4WJNA 3RFZB 5AEKB 2M4NA 4XWTA 2WXQA 3A9KB 2BBCA 1R4MB 4G3XB 3CSFA 4LJOB 1E8XA 2O6VD 3DVNU 2NR2A 4ASWC 3ZJUA 5JZEB 1P1AA 1UWMA 2EMTA 1WJNA 3WIMA 2D5GA 5BMIA 3PLUA 3QAQA 1YJ1A 2O6VA 3FILA 2WHIA 3AI5A 3TUOA 3W5UB 1V81A 1YN5A 2I2YA 1UF0A 2NPTB 5HFYA 2DX5B 1HXYD 2WP9B 4R3DA 3MC8A 4XYCA 2JSVX 3CWIA 4MGKE 2YLMA 1ZDVA 1XCTL 2JX5A 3PZDA 3Q2AC 3KUDB 3ZLZA 5E6PA 4XDCA 3X0WA 3ZDMC 3NG0A 3DPDA 1GOZA 1IGDA 3DOWA 1RYJA 1Q5WB 4ZRIA 4HDQA 1CQVA 1Q1OA 3ZNGC 2H88B 3NS8A 2INPE 1N61A 1SJHD 4K7WA 4ARCA 1XCQL 1E7PB 3IBEA 2WDRB 3NOBA 3HVZA 4US8A 4FA6A 2QJLA 2KN5A 2BGFA 2KDBA 1VR9A 4K81A 4EKUA 3ABVB 3P2BA 1MPEA 3TMPB 5L95C 1ZDXA 2WDTB 2W3RA 3UINB 2M56B 1SE9A 2WX1A 1V86A 5JHAA 1WGHA 2BYFA 4TKNA 1LQBA 4BOZB 1SIJA 4I6LB 1I4RA 3LXFA 1Z2MA 3B2FA 1EWCA 4N58A 3R2IA 4NAWA 4M8NA 4DXGA 4DWFA 2K3UA 4BBNC 1GNUA 1V1PA 2PW9A 2L76A 4NJ7A 2AX5A 2L00B 1R4NB 2LGYA 2LGDA 2BTEA 1ESFA 3L17A 4IWPA 3ZIMA 3DBRI 4E74A 4JX1C 1FMAD 3AH7A 5D2MB 3TL5A 1GC7A 1JW9D 2WU2B 1LM8B 4IM3A 3O65B 4HDOA 3NRZA 3X23A 3RNCC 2J42A 2DBYA 5BMGA 3DDCB 1YJIA 2KNBA 4GOCA 1P9DU 2EELA 2PE9A 4P16A 2KX0A 1OQYA 4DDGD 4NPNA 2IO2B 2RPVA 3CMMB 4XGAB 4KKIA 3Q8CA 1OEYJ 2R2QA 4REZA 2L3ZA 1WI0A 1A5RA 4JGHB 3RNAC 1WF9A 4GDLA 1ZPSA 3NJTA 3QQ8B 1FRDA 4Q2JA 2KX3A 3ZYYX 5KHOA 1SE3A 1C9FA 1P3QU 3AEBB 5D94A 3JSVA 3A4SC 2G3QB 2YEPF 2AQ3B 2GRIA 2L7RA 2FUG1 1R7SA 1UZXB 3V6CB 2KKCA 4K3BA 5G5GA 1EF5A 4HJKA 2M8SA 2KFKB 2LXCA 1TY0A 2DENB 1YNTE 3VRAB 4XWWA 2KLGA 2MRPA 1KJTA 2L1AA 3ZW3A 2G9HD 2PPHA 5MPOA 1XXGA 4DDID
chains in the Genus database with same CATH topology
1T0QC 4P1CC 3Q2AC 3I5JC 3RNCC 1T0RC 3RNAC 3N1YC 2INCC 3GE8C 3N1ZC 3Q14C 3DHGC 3I63C 3Q3OC 2INDC 3RN9C 3Q3NC 3N20C 2RDBC 3Q3MC 3RI7C 3N1XC 4P1BC 3RMKC 3RNBC 3DHHC 3RNGC 1T0SC 3RNEC 3RNFC 3DHIC 3GE3C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T0Q C;  4P1C C;  3Q2A C;  3I5J C;  3RNC C;  1T0R C;  3RNA C;  3N1Y C;  2INC C;  3GE8 C;  3N1Z C;  3Q14 C;  3DHG C;  3I63 C;  3Q3O C;  2IND C;  3RN9 C;  3Q3N C;  3N20 C;  2RDB C;  3Q3M C;  3RI7 C;  3N1X C;  4P1B C;  3RMK C;  3RNB C;  3DHH C;  3RNG C;  1T0S C;  3RNE C;  3RNF C;  3DHI C;  3GE3 C; 
#chains in the Genus database with same CATH topology
 2G45 B;  4FHJ A;  2JRI B;  3L54 A;  1B1Z A;  2KQ7 A;  5BYQ A;  2AL3 A;  1L0V B;  1HE8 A;  2L0T A;  1I4G A;  1RLF A;  1IBX A;  3W2D A;  1S1Q B;  3VXW A;  1I4Q A;  2KC2 A;  2Y3A A;  2WXM A;  3URY A;  1N63 A;  4K7S A;  3ENE A;  3ZRF A;  2MP2 B;  2K6D B;  1NBF C;  3A9K A;  5T8I A;  4AP4 C;  3NUH B;  2DYO A;  1QF6 A;  1L4D B;  2D3C A;  4W9L A;  1RAX A;  1P7F A;  2DAF A;  4IWO A;  4MJS B;  1WGR A;  4F1S A;  1V1O A;  1J7C A;  5E6J A;  1QOF A;  1E7U A;  2RR9 A;  3R7R A;  3DQV A;  3RPF C;  5CX3 A;  1IGC A;  3AE1 B;  4YXD B;  3QHT A;  1V80 A;  4KX6 B;  3D32 A;  4W9J A;  4ANX A;  5BYS A;  1Y56 A;  4GDK B;  4B95 A;  2V1Y A;  2LZ6 A;  2C7M B;  4EZK A;  4HKQ A;  2WXR A;  1WJ4 A;  2H89 B;  3UI3 A;  2N0S B;  2HE7 A;  1PGB A;  2DWQ A;  2NPT A;  4MH0 E;  2OED A;  2N7E A;  2MH7 A;  4K7U A;  3VTW A;  4YSY B;  5AZF A;  1V6E A;  2VRR B;  2BYV E;  3VR9 B;  1AAR A;  3S2A A;  2KDE B;  2LGS A;  4A3O A;  3AE3 B;  5GMV A;  2CJN A;  3L10 B;  1TY2 A;  4AS1 A;  4A9A A;  3KUZ A;  4XE0 A;  3SFD B;  1D3Z A;  1AYF A;  3R7Q A;  3AE6 B;  2BS2 B;  4PS7 A;  1PGA A;  3ZGZ A;  3QIJ A;  3AE8 B;  1I4P A;  5KHQ A;  4A55 A;  2ASQ A;  4HEA 1;  4FUL A;  3DVG X;  2MBB B;  1GB4 A;  4WAF A;  4EFO A;  2FIF A;  4HLE A;  2DNF A;  1I35 A;  2OJR A;  3TIX A;  2D3G A;  3ZXV A;  2LVP A;  4RGO S;  2GMI C;  1PFD A;  2HDE A;  5AUI A;  2CHW A;  4FJZ A;  2EKE C;  4YT0 B;  2LD9 A;  2WQY B;  1RFK A;  4MGY E;  1WE7 A;  2BW2 A;  3TSS A;  3OLM D;  2A5U A;  2VZK B;  3RZW C;  2SEB D;  4DHJ B;  4XC2 A;  1YQB A;  3ONS A;  3MTN B;  4O1N A;  4RFB A;  2KMC A;  2J52 A;  3HHM A;  1TBE A;  1KLU D;  2CR5 A;  1WSP A;  2V9H A;  4ANU A;  2PIA A;  3NVV A;  1I42 A;  3TJP A;  4AOF A;  1QQR A;  3APC A;  5FKA C;  1ZUD 2;  5C2T B;  2ZCB A;  4W9C A;  1E5W A;  1V5T A;  4DHZ E;  1XLO A;  3V05 A;  2XNA C;  1WXM A;  3P4Q B;  3N1X C;  4J6I A;  4NAM A;  2AQ2 B;  1WRI A;  1SE2 A;  3AN1 A;  4FLH A;  3C8Y A;  4MEM A;  1D6E C;  2J0M A;  1KM7 A;  4LNK A;  2GB1 A;  4YTM B;  4DHZ B;  3H8H A;  2INN E;  2PJH A;  1GUA B;  2KHW B;  1GPX A;  1WMH B;  2OJW A;  2KYW A;  4JL9 A;  3KQ4 A;  3W5V B;  2G4S A;  2IJ0 A;  3Q6B A;  1WH3 A;  2ON8 A;  2BKF A;  2GBK A;  1WX8 A;  2N1V A;  1WGD A;  4HRO A;  2MBE A;  3BYT B;  3DBR B;  3ZQ4 A;  4NJ6 A;  3TCA A;  2E6X A;  5BYR A;  1F9J A;  4RM8 A;  3AMZ A;  2ZW0 A;  3GE3 C;  4BFR A;  3HK0 A;  3PHX B;  4EEW A;  3NY5 A;  3PSE B;  3M3J A;  1CZP A;  4PT5 A;  1VJK A;  4LJP B;  4CO7 A;  4W9G A;  1DYQ A;  2W54 A;  3VUX A;  3P4P B;  4G0N B;  1NI2 A;  4BKG A;  1JRO A;  3DBH I;  1TS5 A;  1TJE A;  1FEH A;  2DZJ A;  4L23 A;  2KMA A;  3Q8E A;  3MFG A;  1E8Y A;  3VUW A;  2MSE D;  4KSK C;  2KFK A;  3N20 C;  3HM6 X;  1EUV B;  1QLB B;  4YSX B;  5JH5 C;  2GOW A;  3BK1 A;  2L83 A;  4AQ7 A;  5J17 A;  1UGJ A;  2PKO A;  3EHV A;  4KSL C;  4W9E A;  3B0A A;  5BMH A;  3WAO A;  1PGX A;  2CU1 A;  3Q14 C;  4ZHP A;  1L0X B;  3E56 A;  1WXA A;  1FCL A;  3PVL A;  3RMK C;  3ZTC A;  5EE0 A;  3AUL A;  4C4V B;  4KKJ A;  4FAD A;  4BOS C;  5J18 A;  1YQ3 B;  1X1M A;  2MP2 A;  3BII D;  2KAN A;  3Q8A A;  4I6P A;  3WA0 A;  1SB3 C;  2KN4 A;  5C3J B;  1L6U A;  1WGK A;  2QCZ A;  1N62 A;  1PDX A;  1TZ1 A;  3Q3N C;  2KFJ A;  4MJS A;  1YD8 U;  3VVW B;  5D6J B;  4YL8 A;  2D10 A;  3PHW B;  2KDM A;  1WR6 E;  1E90 A;  1KOT A;  1WZ3 A;  2KDI A;  2MBQ A;  3NHE B;  2C7H A;  2OHF A;  3EGR A;  5EE1 A;  3DBL B;  2NBV B;  1EF1 A;  4JIO U;  2MX2 A;  3I63 C;  4GDK A;  2DLB A;  2ZZP B;  3PS6 A;  4D2K A;  1RM6 C;  2Z59 B;  2YEP B;  3AEC B;  3KLS X;  4MGI E;  5DPT A;  1P98 A;  2JPH A;  4GIV A;  2KVZ A;  4IC7 B;  4ZHO A;  3RNG C;  4H2A A;  2JYE A;  1VCB A;  1Q10 A;  2RDG A;  3BZD B;  5DPW A;  1FM0 D;  3BVG A;  2K5P A;  2ZW1 A;  4N6E B;  3SD5 A;  4P7I A;  2KXJ A;  2BS3 B;  4EOY A;  3Q3F A;  2UYZ B;  2JU6 X;  2JRH A;  2K22 A;  4DBG A;  1ZKH A;  2KT7 A;  4W9K A;  1JWM D;  4TQ0 A;  3MHS D;  4RGN A;  5LXI B;  2IBI B;  3PRP B;  3EFC A;  2PEA A;  4C7Y A;  4NQL B;  1D5Z C;  2C9W B;  3MHZ A;  3EUB 2;  4TSS A;  2SAK A;  3GS2 A;  2KQ4 X;  3VTU A;  2JY6 A;  2PVO D;  1F2R I;  1WXQ A;  1QOB A;  2NTS A;  3PZ7 A;  3A1Q B;  1JAL A;  3M95 A;  4ZYS A;  2V0G A;  2VZK D;  3N3K B;  2JZZ A;  3A9J B;  5IAA C;  4DHJ D;  1UBI A;  1V9J A;  2DZM A;  1L7Y A;  1ROE A;  3HRD D;  2TSS A;  2KVR A;  4A20 A;  3R3M A;  3NVZ A;  3C19 A;  2RMM A;  3U8Z A;  1U4A A;  1F52 A;  1J0G A;  1YIW A;  3AU4 A;  2K8B A;  4KDI C;  1IP9 A;  3N30 A;  3QAR A;  4ITK A;  3K9P B;  4E3C A;  3AU5 A;  5EE9 A;  2LVO A;  1C78 A;  3KUC B;  4OVV A;  2RSU A;  3E9S A;  1FNV A;  3GZN I;  4ZRK A;  3QC8 B;  3CST A;  1ET6 A;  4JPS A;  1HZ6 A;  1WX9 A;  1MG8 A;  2AYO B;  4KZC A;  1MG4 A;  1TTN A;  3QJZ A;  3ZRC A;  3V60 A;  1XT9 B;  2IY1 B;  3RNF C;  1N5X A;  1XLP A;  1EWY C;  2DYM A;  4WWN A;  2KDF B;  4EUT A;  1BML C;  2KO3 A;  2E3T A;  4FJV B;  1FXA A;  5CHV C;  3SDL C;  1SXT A;  1WWT A;  1FFU A;  1IYF A;  3ZXR A;  2KZR A;  3IFW B;  2INC C;  1WM3 A;  3EC8 A;  1PUT A;  3TEX A;  3IT4 B;  3ZKJ C;  1QKZ A;  2KWD A;  2N9K A;  1BT0 A;  2LEK A;  3GB1 A;  4BVU C;  3AEA B;  2IGH A;  5CHF A;  1MI0 A;  2W3S A;  2D11 A;  2N7J A;  2WX0 A;  1FNU A;  4RMA A;  3GE8 C;  3H6N A;  2FID A;  2WXH A;  2N7D A;  3BY4 B;  4HKZ E;  2ZPN A;  3VDZ A;  2MQJ A;  4G11 A;  1M4V A;  3ZNH B;  1OGW A;  2PVG C;  1AWD A;  3QK0 A;  1NYQ A;  2LJ5 A;  4HJG E;  3PTF C;  4GXB A;  5E6O A;  2MJ3 A;  4XX5 A;  4RM9 A;  2ZNV B;  3U52 E;  3JW0 X;  2WXF A;  2AL6 A;  4AUQ C;  1XF5 L;  1M94 A;  1FXI A;  4A3P A;  3Q8F A;  4HXD A;  5J2R A;  4HPM B;  4LLG M;  4IUM B;  2JXX A;  2I1K A;  4BAX A;  3DBH B;  5LNK 1;  4AJY B;  1JWA D;  1FPY A;  1TS3 A;  4WIP A;  2M0X A;  2MCN B;  3SEB A;  4HK2 A;  2QHO A;  3R66 C;  4MT5 A;  2Y5C A;  4PK1 A;  4QAY A;  3EFU A;  1YN4 A;  3BVZ A;  1SJE D;  2L0F A;  4N9F 4;  3VUY A;  2XN9 C;  1YX6 B;  3WAP A;  2ZCC A;  3M63 B;  2GBN A;  3BVM A;  3ZO5 B;  2REX A;  1L6V A;  3DCG A;  2ACZ B;  5HHD G;  2ZPY A;  3I5J C;  1E10 A;  1YX5 B;  2RGF A;  1NVI D;  3Q69 A;  2EKI A;  2JQR B;  2G1E A;  1XD3 B;  1TGZ B;  2N9X A;  4PYZ A;  2JXT A;  2K0P A;  2JWU A;  4B9K A;  1XLQ A;  2C60 A;  4ZRQ A;  1T0Q C;  3MP9 A;  2LRW A;  4URK A;  3AV8 A;  4II2 B;  1TKY A;  3VH4 B;  3T8M A;  3PLV A;  1FD6 A;  2LFI A;  1L5P A;  4OZB A;  2KK8 A;  4LNN A;  2RDB C;  1XQQ A;  1NEN B;  1WJ6 A;  2V3N A;  2RD0 A;  2FCM A;  5BO4 B;  2Y5B B;  2GBM A;  1Q0W B;  2LHD A;  1N6Z A;  1MHH E;  3N1Y C;  4L1B A;  1SEB D;  5FR3 A;  1QZE A;  4A6Q A;  3W1S A;  3QX1 A;  2BB6 A;  2MWS B;  3T3N A;  1WZ0 A;  4C56 C;  1NEK B;  4LDT B;  1UNS A;  1TZO A;  4MGZ E;  4B0M A;  2DYB A;  1IPG A;  1H4R A;  3C0R B;  3DBS A;  3ALB A;  4KGS A;  3LJ3 A;  2BWE S;  1YN3 A;  3AEE B;  1RFA A;  2BQQ A;  2WYQ A;  5D3I B;  1J7B A;  1CJE A;  1S3S G;  4MM3 B;  4M0W B;  3RT3 B;  1JWU D;  3VHT C;  2OOB B;  1OEY A;  1Z5S B;  2NS5 A;  3A1Q A;  1C4A A;  3PRZ A;  2LUE A;  3A9J A;  2GBJ A;  2BS4 B;  3U4E G;  3OJ3 A;  4WWM A;  2XK5 B;  4LK0 M;  2WU5 B;  2ZVN A;  3QCA A;  2M19 A;  5IP4 D;  4WQM A;  4NQK E;  3HIZ A;  2K8H A;  4G50 A;  5IOI A;  1QT9 A;  3TEW A;  4CYE A;  4ZRJ A;  4P1C C;  2V3S A;  1NDD A;  4JE3 B;  5E6N A;  4B0E A;  4ZYN A;  4FHK A;  2J4X A;  2Z0E B;  3JYU A;  4OZC A;  1XEE A;  5AZG A;  1CMX B;  3FC4 A;  3AE7 B;  1QOA A;  5G55 A;  3RZF A;  1NYR A;  1J19 A;  2KOX A;  1HTO A;  1FCC C;  3GZN B;  4KGR A;  2KQS A;  2KAJ A;  5FK9 C;  3NVY A;  4F8C B;  1DGJ A;  3CIR B;  2EMS A;  4IOI E;  4K1R B;  3IT6 B;  4L2Y A;  2WXL A;  3VRB B;  1VD2 A;  1F77 A;  1I7H A;  1OQQ A;  3UIP B;  1GB1 A;  2QMT A;  4C00 A;  2RDH A;  1WM2 A;  4RF1 A;  5C1Z A;  2WXN A;  3APF A;  5JXV A;  3AE5 B;  3KVF B;  1GJZ A;  1OQR A;  1PQS A;  4HWI B;  4NY0 A;  4S17 A;  1EM7 A;  4II3 B;  3P4S B;  1LGR A;  3VAW A;  1F0Z A;  2ONQ A;  1FFV A;  3EEC A;  3SU8 X;  1C4C A;  4BKS D;  1E7V A;  2WXG A;  4A90 A;  1F1H A;  2JWZ A;  1OTR B;  3LB8 C;  1ZXH A;  3RD2 A;  4BKS A;  2HJ1 A;  4PS8 A;  2X38 A;  3MJW A;  1MFW A;  2MHJ A;  2LGX A;  3OWE B;  4LCD E;  2PLP A;  2FCN A;  2Z0D B;  2D2Q A;  4HRS A;  2L8J A;  4LNF A;  4TUU A;  1I4X A;  2ZEQ A;  5IA7 A;  3L16 A;  5G2N A;  5H92 C;  3VH3 B;  2VH2 A;  4FXC A;  1GG3 A;  2M17 A;  2XEW A;  3B2G A;  1LO5 D;  3NS1 A;  4WJO A;  2A4Z A;  3Q3M C;  1YMH E;  1SIF A;  4ANV A;  2BT6 A;  2LGI A;  2LVQ A;  1T0S C;  2IYD B;  4YTP B;  1VZ7 A;  2K1F A;  2NTT A;  5HKH A;  1OFF A;  4KVG B;  1SGH A;  4RCO A;  3QWZ B;  2N9P C;  5GXG B;  2KJH B;  3IAS 1;  4MEL A;  2B3A A;  1FXT B;  1E6E B;  3R8B A;  3U7D A;  3PO0 A;  1SSN A;  3AM9 A;  5L83 A;  3SFE B;  2ZVO A;  1I4H A;  2QIE B;  1FRR A;  3H1U A;  4W9I A;  3NZU A;  4MSQ B;  5EDS A;  1STE A;  2JUO A;  3L4P A;  2WXP A;  2L32 A;  1V8C A;  3RCZ A;  2D07 B;  4RGT A;  1DOX A;  3APD A;  1KH0 A;  3L08 A;  2MW5 A;  1UEL A;  1C4P A;  2BYE A;  2V4I B;  1V49 A;  1WXS A;  2DAJ A;  4KDL B;  3WCQ A;  3UQA A;  2KWU B;  2WS3 B;  3KYD D;  2WLB A;  2IPK D;  3AE9 B;  4WH4 A;  3ETR A;  1WYW B;  2PE6 B;  3RUL A;  1FIQ A;  2KJR A;  3U30 A;  2CJO A;  2DZI A;  4LDT D;  1WY8 A;  3B9J A;  2KTR B;  1ZGU B;  2FCS A;  2W82 A;  3WAL A;  3ML9 A;  1J7A A;  4X57 B;  1TS4 A;  4C7Z A;  3GOE A;  2MBO A;  4PYU A;  3H7P B;  2JZP A;  1N60 A;  2WXI A;  1HEZ E;  4WJP A;  3MJ5 A;  4LNO A;  5AUK A;  2VH1 A;  4JWU C;  3RN9 C;  2J7Q B;  4N59 A;  2CHX A;  2I38 A;  1ENF A;  2HTM E;  2IZV B;  2Q5W D;  4WWP A;  3TBL D;  3ZVV A;  1EU4 A;  2Y5P A;  4EZL A;  4MM3 A;  4M0W A;  3I9V 1;  2WDQ B;  2K6Q A;  3PGE A;  3ZNZ B;  4DXA B;  2BWF A;  2D3A A;  4YSZ B;  1BUI C;  3VR8 B;  4PS3 A;  4KIK B;  4NJC A;  2KMM A;  1YOV B;  3IAM 1;  2C5L C;  4WQO B;  2XK5 A;  1E8W A;  4IM0 A;  2W9N A;  3DVG Y;  3VQI A;  1HQR D;  4LTU A;  2UU7 A;  4YTN B;  3H7S A;  4MDK E;  4OHJ A;  5IKC M;  1C76 A;  1L2N A;  4IKG A;  4USA A;  3AE4 B;  2N4F A;  3ZNI D;  2NMQ A;  2KJ6 A;  1AN8 A;  2QEJ C;  5CTR C;  3IXS A;  4TMA B;  2IGG A;  2MA9 B;  4US9 A;  3RUI B;  4CQN A;  4MH8 A;  1AW7 A;  1UUP A;  3V61 A;  2ZJD A;  2CS4 A;  2GBR A;  4GLS C;  4ICU A;  1PYW D;  5G5H A;  2JF5 A;  2WDV B;  4RH6 A;  2CU3 A;  3KW5 B;  2IO3 B;  3V62 A;  4JWS C;  3HVD A;  1ISN A;  2MJD A;  3PZ8 A;  2BKR B;  1B9R A;  5TSS A;  1EO6 A;  2J53 A;  3K9O B;  5LLI A;  1JWS D;  2HJ8 A;  1UBQ A;  5FR6 A;  2DHZ A;  4JLC A;  2X8X X;  2J0K A;  1GC6 A;  1UD7 A;  3BYY B;  1K50 A;  1WMH A;  5D7G A;  3L0W B;  2LXA A;  5HG2 A;  3ZJV A;  4RNA A;  2WGS A;  2JVC A;  4HPL B;  4ZDV A;  1RRB A;  1ZP0 B;  4HCP B;  3H9D A;  1JRP A;  4GN1 A;  2KTF A;  4GSW A;  1P0R A;  3IVF A;  1JRU A;  4C80 A;  2GLS A;  2K8C A;  3OG5 A;  2O2V B;  1WGG A;  3RNE C;  3W1S C;  5EE3 A;  1DOI A;  4IG7 B;  5D3D A;  5DPR A;  3ZTD A;  2L05 A;  4KZ0 A;  4ZRP A;  4WAA A;  3FKY A;  3T3O A;  4EE2 A;  2IND C;  1JML A;  3SR6 A;  4P6V F;  2IO1 B;  4GMV A;  3P63 A;  2IY0 B;  2I1J A;  4M8M A;  1V5O A;  4IW0 A;  2GI9 A;  3P4R B;  1FO4 A;  2FAZ A;  4RF0 A;  3MC9 A;  4BBN F;  4BZA A;  3KH0 A;  2JT4 B;  1WYG A;  2CHZ A;  1ZE3 D;  4DQO C;  3PT2 B;  2HTH A;  4KV2 A;  1HZ5 A;  4IWQ A;  3HUI A;  2DZK A;  2WNM A;  3DWG C;  3BIN A;  2IO0 B;  4W9D A;  1G6J A;  1KFY B;  3A33 B;  1IUE A;  3V6E B;  2AEH A;  2LAS A;  1D4B A;  5LXH A;  1H8C A;  4C4V A;  2AQ1 B;  3UF8 A;  4XZ4 A;  1ZOY B;  3WAM A;  3NZS A;  1WX7 A;  2MBH A;  5DCN A;  3I57 A;  3U2S C;  3LYY A;  4W9F A;  4WUR A;  2W55 A;  2KWV B;  4W9H A;  1KTK A;  3ML8 A;  1UWX A;  1ACC A;  4GB9 A;  1SBB B;  2WXK A;  2NCN A;  4ANW A;  1C77 A;  3ZJT A;  3DHG C;  1ZW7 A;  1VLB A;  4ICV A;  1D5X C;  2LUM A;  3UQB A;  2MEK A;  2KTR A;  1QOG A;  1UH6 A;  1ZXI A;  1K8R B;  1R4M I;  3Q3J A;  3A4R A;  3O13 A;  3CF6 E;  3NZ3 A;  3H7P A;  1SF0 A;  3IHP C;  3DBL I;  3JVZ X;  1SE4 A;  4OZA A;  3WAN A;  4AJW A;  4MSM B;  3Q3O C;  1VZ6 A;  2N9E B;  1KF6 B;  1UGM A;  1N5W A;  1LXD A;  2WWZ A;  1MVK A;  2K25 A;  1RWS A;  1E0Z A;  1L0Y B;  2BB5 A;  4M02 A;  4EZJ A;  1KLG D;  2MLB A;  1E9M A;  1P7E A;  1V97 A;  2LI5 A;  1WFY A;  3M62 B;  2Z8L A;  2FCQ A;  3NVW A;  2ZNV C;  4A8X C;  4I6N B;  2G4D B;  3UGB B;  1WGY A;  3KWV A;  4KIK A;  4J3O D;  4NNJ B;  2FBW B;  1CK1 A;  2LWP A;  1L4Z B;  2O6V B;  1ET9 A;  3FIL B;  1LFD A;  1C79 A;  1E8Z A;  1GAQ B;  3ZUN A;  3DHI C;  2D3B A;  1WR1 A;  1WJU A;  1T3Q A;  5TR5 A;  1EU3 A;  1JQ4 A;  2NVU I;  3B1L X;  5JHB A;  4DK5 A;  4ARI A;  4XDD A;  2MJE A;  1XO3 A;  2KD0 A;  3RI7 C;  1T5X D;  2YVC A;  3W1Y A;  1FNW A;  2JZ3 B;  5H8Y E;  3ZDT A;  3AEF B;  4JQW C;  3L13 A;  4TQ1 A;  3Q8B A;  4K3C A;  2FE8 A;  2KC1 A;  4FJY A;  2V4L A;  3AXC A;  3FAH A;  1NI3 A;  2LRU A;  2LHE A;  2JYT A;  1TKE A;  3R2T A;  2IDY A;  3RNB C;  4OVU A;  3DHH C;  2BYT A;  1A70 A;  1TS2 A;  2R61 A;  3TEY A;  3QA8 A;  1YQ4 B;  4YWG G;  3GP7 A;  1TYG B;  1T0R C;  3T9L A;  1VDV A;  3AEG B;  2QIL A;  1Y8R C;  2UWQ A;  4WWO A;  3PRE A;  3EA6 A;  2NBU A;  4KGT A;  1JWB D;  1MJD A;  4OVZ A;  3DWM A;  3MC0 B;  3OJ4 B;  2K9X A;  4M01 A;  3J9C A;  4IDI A;  4ACF A;  3B08 A;  1R4N I;  4BKT A;  4NAW B;  1T6B X;  1TT5 B;  1YJJ A;  4WJQ A;  2LMC A;  2O2V A;  1V1P B;  2KLC A;  2PMV A;  1HTQ A;  1J8C A;  1DOY A;  3IG3 A;  3AED B;  3N1Z C;  4TV3 A;  4IM2 A;  3SHQ A;  3LDZ E;  3PPA A;  2HD5 B;  1KLV A;  1WRD B;  3UIO B;  2IGD A;  4P1B C;  4FBJ B;  2R2O A;  4M00 A;  2KWC A;  3TEZ A;  3OAW A;  4FN2 A;  4HVB A;  5DPS A;  2AWT A;  2CKH B;  4MAC A;  1XLN A;  2BVC A;  4E71 A;  1TKG A;  3ECI A;  1D5M C;  2V3P A;  1T0Y A;  1BXT A;  4B6W A;  2N9L A;  2WXJ A;  3N32 A;  1K53 A;  2M0A A;  1F2R C;  2L52 A;  4RGM A;  5CHW A;  1KRH A;  2WXO A;  4DXF A;  1HA5 A;  2FUH B;  3AB5 A;  3RYT A;  3KYC D;  4HPP A;  3P42 A;  4GDL B;  3AE2 B;  3BWU D;  4ZOH C;  2FNJ B;  3BK2 A;  4HCN B;  3JSV B;  3PV1 A;  4CHK A;  2ICI A;  1WE6 A;  4F7Z A;  3VFK A;  3VTV A;  1WIA A;  4GU2 A;  4AWJ A;  2NBW B;  3I3T B;  5IN7 A;  2BPS A;  1V2Y A;  2XBB C;  1VRA B;  3KWL A;  1C3T A;  4NZL B;  3U7Z A;  5HI1 A;  1VZ8 A;  2B76 B;  4LNI A;  2J0J A;  2M1M A;  2QDF A;  3DVN V;  1C1Y B;  5AZH A;  2PTL A;  2RPQ A;  3W9C B;  1JCK B;  2BF8 B;  3N9Y C;  1TIF A;  2K39 A;  4S0R A;  2N1W A;  1K52 A;  2QC8 A;  5I4D A;  3P1M A;  1QIL A;  2QSD A;  4GGQ A;  4UDU C;  1WXV A;  3HM3 A;  3V3X A;  2KAC A;  1IBX B;  2C7N B;  4OW0 A;  1K51 A;  1MHX A;  5IO9 A;  3PRM B;  5C23 A;  2LJI A;  4WJN A;  3RFZ B;  5AEK B;  2M4N A;  4XWT A;  2WXQ A;  3A9K B;  2BBC A;  1R4M B;  4G3X B;  3CSF A;  4LJO B;  1E8X A;  2O6V D;  3DVN U;  2NR2 A;  4ASW C;  3ZJU A;  5JZE B;  1P1A A;  1UWM A;  2EMT A;  1WJN A;  3WIM A;  2D5G A;  5BMI A;  3PLU A;  3QAQ A;  1YJ1 A;  2O6V A;  3FIL A;  2WHI A;  3AI5 A;  3TUO A;  3W5U B;  1V81 A;  1YN5 A;  2I2Y A;  1UF0 A;  2NPT B;  5HFY A;  2DX5 B;  1HXY D;  2WP9 B;  4R3D A;  3MC8 A;  4XYC A;  2JSV X;  3CWI A;  4MGK E;  2YLM A;  1ZDV A;  1XCT L;  2JX5 A;  3PZD A;  3Q2A C;  3KUD B;  3ZLZ A;  5E6P A;  4XDC A;  3X0W A;  3ZDM C;  3NG0 A;  3DPD A;  1GOZ A;  1IGD A;  3DOW A;  1RYJ A;  1Q5W B;  4ZRI A;  4HDQ A;  1CQV A;  1Q1O A;  3ZNG C;  2H88 B;  3NS8 A;  2INP E;  1N61 A;  1SJH D;  4K7W A;  4ARC A;  1XCQ L;  1E7P B;  3IBE A;  2WDR B;  3NOB A;  3HVZ A;  4US8 A;  4FA6 A;  2QJL A;  2KN5 A;  2BGF A;  2KDB A;  1VR9 A;  4K81 A;  4EKU A;  3ABV B;  3P2B A;  1MPE A;  3TMP B;  5L95 C;  1ZDX A;  2WDT B;  2W3R A;  3UIN B;  2M56 B;  1SE9 A;  2WX1 A;  1V86 A;  5JHA A;  1WGH A;  2BYF A;  4TKN A;  1LQB A;  4BOZ B;  1SIJ A;  4I6L B;  1I4R A;  3LXF A;  1Z2M A;  3B2F A;  1EWC A;  4N58 A;  3R2I A;  4NAW A;  4M8N A;  4DXG A;  4DWF A;  2K3U A;  4BBN C;  1GNU A;  1V1P A;  2PW9 A;  2L76 A;  4NJ7 A;  2AX5 A;  2L00 B;  1R4N B;  2LGY A;  2LGD A;  2BTE A;  1ESF A;  3L17 A;  4IWP A;  3ZIM A;  3DBR I;  4E74 A;  4JX1 C;  1FMA D;  3AH7 A;  5D2M B;  3TL5 A;  1GC7 A;  1JW9 D;  2WU2 B;  1LM8 B;  4IM3 A;  3O65 B;  4HDO A;  3NRZ A;  3X23 A;  3RNC C;  2J42 A;  2DBY A;  5BMG A;  3DDC B;  1YJI A;  2KNB A;  4GOC A;  1P9D U;  2EEL A;  2PE9 A;  4P16 A;  2KX0 A;  1OQY A;  4DDG D;  4NPN A;  2IO2 B;  2RPV A;  3CMM B;  4XGA B;  4KKI A;  3Q8C A;  1OEY J;  2R2Q A;  4REZ A;  2L3Z A;  1WI0 A;  1A5R A;  4JGH B;  3RNA C;  1WF9 A;  4GDL A;  1ZPS A;  3NJT A;  3QQ8 B;  1FRD A;  4Q2J A;  2KX3 A;  3ZYY X;  5KHO A;  1SE3 A;  1C9F A;  1P3Q U;  3AEB B;  5D94 A;  3JSV A;  3A4S C;  2G3Q B;  2YEP F;  2AQ3 B;  2GRI A;  2L7R A;  2FUG 1;  1R7S A;  1UZX B;  3V6C B;  2KKC A;  4K3B A;  5G5G A;  1EF5 A;  4HJK A;  2M8S A;  2KFK B;  2LXC A;  1TY0 A;  2DEN B;  1YNT E;  3VRA B;  4XWW A;  2KLG A;  2MRP A;  1KJT A;  2L1A A;  3ZW3 A;  2G9H D;  2PPH A;  5MPO A;  1XXG A;  4DDI D; 
#chains in the Genus database with same CATH homology
 1T0Q C;  4P1C C;  3Q2A C;  3I5J C;  3RNC C;  1T0R C;  3RNA C;  3N1Y C;  2INC C;  3GE8 C;  3N1Z C;  3Q14 C;  3DHG C;  3I63 C;  3Q3O C;  2IND C;  3RN9 C;  3Q3N C;  3N20 C;  2RDB C;  3Q3M C;  3RI7 C;  3N1X C;  4P1B C;  3RMK C;  3RNB C;  3DHH C;  3RNG C;  1T0S C;  3RNE C;  3RNF C;  3DHI C;  3GE3 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...