4P1GA

Crystal structure of the bateman domain of murine magnesium transporter cnnm2 bound to amp
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
152
structure length
152
Chain Sequence
MEELNIIQGALELRTKTVEDVMTPLRDCFMITGEAILDFNTMSEIMESGYTRIPVFEGERSNIVDLLFVKDLAFVDPDDCTPLKTITKFYNHPLHFVFNDTKLDAMLEEFKKGKSHLAIVQRVNNEGEGDPFYEVLGIVTLEDVIEEIIKSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural and ligand binding properties of the Bateman domain of human magnesium transporters CNNM2 and CNNM4
rcsb
molecule keywords Metal transporter CNNM2
molecule tags Transport protein
source organism Mus musculus
total genus 43
structure length 152
sequence length 152
ec nomenclature
pdb deposition date 2014-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00571 CBS CBS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.580.10 Alpha Beta Roll CBS-domain CBS-domain 4p1gA00
2UV6A 4PCUA 4COOA 2UV7A 2D4ZA 2YVYA 2QREE 3PC2A 2YVZA 4ESYB 3OI8A 2RC3A 3LHHA 5K23C 3K6EA 2QRDE 5K24C 2QRCE 3FWSA 4GQVA 2RIHA 4NOCA 5K25C 1YAVA 3L2BA 4IYSA 2OOYE 5K22B 3PC4A 2OOXE 4DQWA 3KXRA 1XKFA 5MMZA 2EF7A 2NYCA 1Y5HA 2YVXA 3LV9A 4GQWA 5KS7A 2RIFA 2QH1A 5IIPA 3I8NA 3KH5A 3K2VA 1O50A 5LXQA 3KPDA 3T4NC 3SL7A 2YZQA 2ZY9A 3OCOA 2P9MA 4HG0A 1PVMA 3PC3A 4IY0A 2QLVC 2NYEA 2UV5A 3L31A 2EMQA 2QR1E 2PFIA 4ESYA 4P1GA 3LQNA 4L28A 3FV6A 3LFZA 4L27A 3TE5C 3GBYA 4IY4A 3FWRA 3HF7A 3TDHC 4P1OA 3FHMA 4UUUA 4L3VA 4IY3A 2OUXA 4O9KA 4GQYA 3FNAA 4FRYA 3KPCA 2O16A 2YZIA 3OCMA 4L0DA 4IY2A 1PBJA 4FXSA 3DDJA 2UV4A 3ORGA 3KPBA
chains in the Genus database with same CATH superfamily
2UV6A 4PCUA 4COOA 2UV7A 2D4ZA 2YVYA 2QREE 3PC2A 2YVZA 4ESYB 2J9LA 3OI8A 2RC3A 3LHHA 5K23C 3K6EA 2QRDE 5K24C 2QRCE 3FWSA 4GQVA 2RIHA 4NOCA 5K25C 1YAVA 3L2BA 4IYSA 2OOYE 5K22B 3PC4A 2OOXE 4DQWA 3KXRA 1XKFA 5MMZA 2EF7A 2NYCA 1Y5HA 2YVXA 3LV9A 4GQWA 5KS7A 2RIFA 2QH1A 5IIPA 3I8NA 3KH5A 3K2VA 1O50A 5LXQA 3KPDA 3T4NC 3SL7A 2YZQA 2ZY9A 3OCOA 2P9MA 4HG0A 1PVMA 3PC3A 4IY0A 2QLVC 2NYEA 2UV5A 3L31A 2EMQA 2QR1E 2PFIA 4ESYA 4P1GA 3LQNA 4L28A 3FV6A 3LFZA 4L27A 3TE5C 3GBYA 4IY4A 3FWRA 3HF7A 2JA3A 3TDHC 4P1OA 3FHMA 4UUUA 4L3VA 4IY3A 2OUXA 4O9KA 4GQYA 3FNAA 4FRYA 3KPCA 2O16A 2YZIA 3OCMA 4L0DA 4IY2A 1PBJA 4FXSA 3DDJA 2UV4A 3ORGA 3KPBA
chains in the Genus database with same CATH topology
2UV6A 4PCUA 4COOA 2UV7A 2D4ZA 2YVYA 2QREE 3PC2A 2YVZA 4ESYB 2J9LA 3OI8A 2RC3A 3LHHA 5K23C 3K6EA 2QRDE 5K24C 2QRCE 3FWSA 4GQVA 2RIHA 4NOCA 5K25C 1YAVA 3L2BA 4IYSA 2OOYE 5K22B 3PC4A 2OOXE 4DQWA 3KXRA 1XKFA 5MMZA 2EF7A 2NYCA 1Y5HA 2YVXA 3LV9A 4GQWA 5KS7A 2RIFA 2QH1A 5IIPA 3I8NA 3KH5A 3K2VA 1O50A 5LXQA 3KPDA 3T4NC 3SL7A 2YZQA 2ZY9A 3OCOA 2P9MA 4HG0A 1PVMA 3PC3A 4IY0A 2QLVC 2NYEA 2UV5A 3L31A 2EMQA 2QR1E 2PFIA 4ESYA 4P1GA 3LQNA 4L28A 3FV6A 3LFZA 4L27A 3TE5C 3GBYA 4IY4A 3FWRA 3HF7A 2JA3A 3TDHC 4P1OA 3FHMA 4UUUA 4L3VA 4IY3A 2OUXA 4O9KA 4GQYA 3FNAA 4FRYA 3KPCA 2O16A 2YZIA 3OCMA 4L0DA 4IY2A 1PBJA 4FXSA 3DDJA 2UV4A 3ORGA 3KPBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UV6 A;  4PCU A;  4COO A;  2UV7 A;  2D4Z A;  2YVY A;  2QRE E;  3PC2 A;  2YVZ A;  4ESY B;  3OI8 A;  2RC3 A;  3LHH A;  5K23 C;  3K6E A;  2QRD E;  5K24 C;  2QRC E;  3FWS A;  4GQV A;  2RIH A;  4NOC A;  5K25 C;  1YAV A;  3L2B A;  4IYS A;  2OOY E;  5K22 B;  3PC4 A;  2OOX E;  4DQW A;  3KXR A;  1XKF A;  5MMZ A;  2EF7 A;  2NYC A;  1Y5H A;  2YVX A;  3LV9 A;  4GQW A;  5KS7 A;  2RIF A;  2QH1 A;  5IIP A;  3I8N A;  3KH5 A;  3K2V A;  1O50 A;  5LXQ A;  3KPD A;  3T4N C;  3SL7 A;  2YZQ A;  2ZY9 A;  3OCO A;  2P9M A;  4HG0 A;  1PVM A;  3PC3 A;  4IY0 A;  2QLV C;  2NYE A;  2UV5 A;  3L31 A;  2EMQ A;  2QR1 E;  2PFI A;  4ESY A;  4P1G A;  3LQN A;  4L28 A;  3FV6 A;  3LFZ A;  4L27 A;  3TE5 C;  3GBY A;  4IY4 A;  3FWR A;  3HF7 A;  3TDH C;  4P1O A;  3FHM A;  4UUU A;  4L3V A;  4IY3 A;  2OUX A;  4O9K A;  4GQY A;  3FNA A;  4FRY A;  3KPC A;  2O16 A;  2YZI A;  3OCM A;  4L0D A;  4IY2 A;  1PBJ A;  4FXS A;  3DDJ A;  2UV4 A;  3ORG A;  3KPB A; 
#chains in the Genus database with same CATH topology
 2UV6 A;  4PCU A;  4COO A;  2UV7 A;  2D4Z A;  2YVY A;  2QRE E;  3PC2 A;  2YVZ A;  4ESY B;  2J9L A;  3OI8 A;  2RC3 A;  3LHH A;  5K23 C;  3K6E A;  2QRD E;  5K24 C;  2QRC E;  3FWS A;  4GQV A;  2RIH A;  4NOC A;  5K25 C;  1YAV A;  3L2B A;  4IYS A;  2OOY E;  5K22 B;  3PC4 A;  2OOX E;  4DQW A;  3KXR A;  1XKF A;  5MMZ A;  2EF7 A;  2NYC A;  1Y5H A;  2YVX A;  3LV9 A;  4GQW A;  5KS7 A;  2RIF A;  2QH1 A;  5IIP A;  3I8N A;  3KH5 A;  3K2V A;  1O50 A;  5LXQ A;  3KPD A;  3T4N C;  3SL7 A;  2YZQ A;  2ZY9 A;  3OCO A;  2P9M A;  4HG0 A;  1PVM A;  3PC3 A;  4IY0 A;  2QLV C;  2NYE A;  2UV5 A;  3L31 A;  2EMQ A;  2QR1 E;  2PFI A;  4ESY A;  4P1G A;  3LQN A;  4L28 A;  3FV6 A;  3LFZ A;  4L27 A;  3TE5 C;  3GBY A;  4IY4 A;  3FWR A;  3HF7 A;  2JA3 A;  3TDH C;  4P1O A;  3FHM A;  4UUU A;  4L3V A;  4IY3 A;  2OUX A;  4O9K A;  4GQY A;  3FNA A;  4FRY A;  3KPC A;  2O16 A;  2YZI A;  3OCM A;  4L0D A;  4IY2 A;  1PBJ A;  4FXS A;  3DDJ A;  2UV4 A;  3ORG A;  3KPB A; 
#chains in the Genus database with same CATH homology
 2UV6 A;  4PCU A;  4COO A;  2UV7 A;  2D4Z A;  2YVY A;  2QRE E;  3PC2 A;  2YVZ A;  4ESY B;  2J9L A;  3OI8 A;  2RC3 A;  3LHH A;  5K23 C;  3K6E A;  2QRD E;  5K24 C;  2QRC E;  3FWS A;  4GQV A;  2RIH A;  4NOC A;  5K25 C;  1YAV A;  3L2B A;  4IYS A;  2OOY E;  5K22 B;  3PC4 A;  2OOX E;  4DQW A;  3KXR A;  1XKF A;  5MMZ A;  2EF7 A;  2NYC A;  1Y5H A;  2YVX A;  3LV9 A;  4GQW A;  5KS7 A;  2RIF A;  2QH1 A;  5IIP A;  3I8N A;  3KH5 A;  3K2V A;  1O50 A;  5LXQ A;  3KPD A;  3T4N C;  3SL7 A;  2YZQ A;  2ZY9 A;  3OCO A;  2P9M A;  4HG0 A;  1PVM A;  3PC3 A;  4IY0 A;  2QLV C;  2NYE A;  2UV5 A;  3L31 A;  2EMQ A;  2QR1 E;  2PFI A;  4ESY A;  4P1G A;  3LQN A;  4L28 A;  3FV6 A;  3LFZ A;  4L27 A;  3TE5 C;  3GBY A;  4IY4 A;  3FWR A;  3HF7 A;  2JA3 A;  3TDH C;  4P1O A;  3FHM A;  4UUU A;  4L3V A;  4IY3 A;  2OUX A;  4O9K A;  4GQY A;  3FNA A;  4FRY A;  3KPC A;  2O16 A;  2YZI A;  3OCM A;  4L0D A;  4IY2 A;  1PBJ A;  4FXS A;  3DDJ A;  2UV4 A;  3ORG A;  3KPB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...