4P1QA

Green fluorescent protein e222h variant
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
228
structure length
227
Chain Sequence
GKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFVQCFSRYPDHMKRHDFFKSAMPEGYVQERTISFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYITADKQKNGIKANFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLHFVTAAGITH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Green fluorescent protein
publication title Replacement of Highly Conserved E222 by the Photostable Non-photoconvertible Histidine in GFP.
pubmed doi rcsb
source organism Aequorea victoria
molecule tags Luminescent protein
total genus 65
structure length 227
sequence length 228
ec nomenclature
pdb deposition date 2014-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01353 GFP Green fluorescent protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.155.10 Mainly Beta Beta Barrel Green Fluorescent Protein Green fluorescent protein 4p1qA00
2AWMA 3O78A 5EXCI 4LJBA 1OXFA 5DPHA 1Q4AA 1KYRA 4DXMA 5DTLA 3DQAA 1EMGA 3ST2A 2IOVA 2H9WA 3SVNA 2QU1A 4RYSA 3IR8A 5FVFA 2HGYA 2PXSA 4Q7RA 4W72A 2HFCA 2DUIA 4W6SA 3SVEA 2OKYA 1EMAA 5BTTB 4U2VA 1YHIA 2IE2A 2O29A 3DQDA 3PJBA 2A50B 3NEZA 1Q4DA 3DQ5A 1ZGPA 5BTTA 1XMZA 1H4UA 4ANJA 3DQOA 3U8PA 3RWTA 4H48A 4PPKA 2HJOA 4EDOA 1MOVA 2AWLA 4KF5A 3SSHA 2A56B 3OSRA 4PFEA 1RMOA 3GJ1A 3CD9A 4GOBA 5HW9A 2C9JA 2G2SB 4H3NA 1JBZA 5HZOA 3RWAA 5T3IA 2YE1A 4H3LA 3LF3A 3TMRA 2A48A 3ADFA 3LA1A 3GL4A 4J8AA 3BXAA 2WISA 4LJDA 2A46A 3BXCA 3VHTA 2O2BA 3M22A 4OQWA 2QLHA 4R6BA 2AWJA 2VZXA 3EKJA 1B9CA 2IB6A 4JGEA 3NT9A 4L12A 3EVRA 3LVCA 3DQCA 3SS0A 4LJCA 2YE0A 1MOUA 4RYWA 2VAEA 4ZINA 1EMFA 1Z1QA 1YHGA 2QT2A 4DXPA 3ZUJA 3SVDA 3UG0A 2OGRA 2HQKA 3DQFA 4GESB 3DQ6A 3W1CA 3EVUA 3DQ2A 4W6PA 4KGEA 2VVJA 3G9AA 5LK4A 2OTBA 3DPWA 2A53B 3PIBA 3ST3A 4KEXA 3ZTFA 4ZFSA 3U8CA 2B3QA 3OGOA 1Z1PA 4DXNA 2OTEA 2VADA 2V4EC 4W6AA 3GJ2A 5DPGA 1QY3A 2DD7A 4Z4KA 4N3DA 4R6DA 2IB5A 2Q6PA 2HGDA 4KA9A 4KPIA 2GW3A 3H1OA 2G6YA 4P76A 3DQHA 3DQ9A 5HBDA 3SVBA 4TZAA 3SG5A 1RMPA 2WSOA 3WLCA 5HGEA 1KYSA 3EK8A 1JC1A 4IK9A 3KCSA 2FZUA 5F9GA 4W6IA 5EB7A 4NWSA 2H6VA 3VK1A 3S05A 1ZUXA 4XOWA 3DQ4A 1KP5A 2BTJA 1HCJA 2JADA 3LVAA 2Z6XA 4W7FA 3CGLA 4HE4A 1XQMA 1YJ2A 3SG2A 1EMEA 4W75A 1YFPA 2WHTA 4W77A 2H5OA 2GX2A 3SVRA 3ZUFA 2ZO7A 3TMTA 2DDDA 3EK7A 2OKWA 2ICRA 4JFGA 3NT3A 5LTPA 4IK3A 4W6RA 3ZULA 3DQIA 2AH8A 3SG3A 2A47A 3CD1A 3DQEA 3VHTB 1W7UA 3BXBA 3DQNA 5EBJA 3NEDA 5EHUA 1RM9A 2RH7A 4Q9WA 3GEXA 4EMQA 1Q4CA 2DUFA 3DPZA 2WSNA 4RTCA 1BFPA 1W7SA 4DXIA 4IK5A 3E5WA 3UFZA 4ZF5A 2HRSA 1OXDA 5FVIA 2H8QA 2G3DB 2O24A 1G7KA 5H87A 2ARLA 5DY6A 3W1DA 3K1KA 2HPWA 5DPJA 5DPIA 3M24A 4Q9XA 2H5PA 4HQ8A 2VVHA 1C4FA 3U0KA 4W6LA 1QYOA 3GB3A 2Z6YA 4H47A 4JEOA 4W7XA 3V3DA 4DKNA 2A52B 3WCKA 4ZB1A 3O77A 3SSVA 2OJKA 4OY4A 4IZNA 4ZF4A 1JBYA 4IK4A 4JRBA 5FHVA 2B3PA 4L1IA 3CBEA 4LJDC 4W7EA 5BT0A 2WHSA 3ED8A 2Q57A 4W6UA 3DPXA 3SVCA 5KTGA 4IK8A 5J2OA 4W6CA 1YJFA 2V4EA 1OXEA 4KF4A 4XGYA 4W6BA 3EVPA 3AI4A 3CFAA 4Q7TA 5AQBB 4KW9A 5DTZA 1ZGQA 3DQUA 4UTSA 2G5ZB 4W6KA 3SSLA 5DTXA 2WHUA 1YZWA 2DUHA 2H5QA 1EMCA 4I2YA 4J88A 2QRFA 3LS3A 4PPJA 2FL1A 4OJ0A 4W7RA 2EMDA 4HQCA 3AKOA 4W74A 4DXOA 4OGSA 4KW4A 1F09A 4W7AA 2DUEA 3SSKA 3DQLA 4LQTA 3IP2A 2DDCA 4JF9A 3CFHA 4AR7A 3E5VA 5LTQA 2YFPA 4H3MA 2DUGA 3SSTA 2HQZA 3DQMA 2POXA 2WURA 4KAGA 3SG4A 3LSAA 3SRYA 4XVPA 2Z6ZA 3OSQA 3U0LA 4AS8A 2H5RA 5H89A 3E5TA 2G16B 4W7CA 2P4MA 2PXWA 1RRXA 2AWKA 5HZTA 4L13A 4EN1A 4B30B 2G6XA 4DKMA 3NF0A 1EMLA 2QLEA 1H6RA 2EMNA 3SG6A 1GFLA 3SSYA 4KW8A 1Q4BA 4W6GA 4W6OA 3SSPA 3CFFA 2ZO6A 5H88A 4B30A 1EMBA 4P1QA 1UISA 3DQKA 4ZIOA 2ZMUA 4W6MA 3EVVA 3H1RA 4XOVA 1JC0A 3SG7A 4HQ9A 2VVIA 2YDZA 1Q73A 3SV5A 1XSSA 1EMMA 2Y0GA 1QXTA 3BX9A 3SVSA 2DD9A 5DU0A 4HVFA 1Q4EA 5EXUA 3DQ7A 4W6NA 4J89A 2QLGB 4ZF3A 1GL4A 2AHAA 1F0BA 4KF5C 2HCGA 5DQBA 2WIQA 4KGFA 2G3OA 2ZMWA 4W73A 5BQLA 2QLGA 3DQ3A 5DTYA 3CB9A 1S6ZA 4IK1A 4TZGA 4Z4MA 4GF6B 4EDSA 4W6TA 4W76A 3U0NA 4W6JA 1HUYA 3P8UA 3A8SA 2V4EB 1QYFA 1EMKA 2GX0A 2G6EA 1W7TA 3U0MA 2QLIA 3EKHA 1GGXA 1XA9A 5EB6A 4LW5A 3DQ1A 2Z1OA 5EXBA 3KCTA 5DRFA 4W6FA 5DRGA 2GW4B 4B5YA 2EMOA 5DQMA 2FWQA 5HZUA 3PJ5A 3PJ7A 5FVGA 1XAEA 3DQJA 3U8AA 1CV7A 3EK4A 3DQ8A 5HZSA 4PPLA 4XL5A 2C9IA 3AI5A 3SVOA 3LF4B 1MYWA 3VICA 2A54B 1QYQA 4ORNA 5LTRA 2QZ0A 4JC2A 4BDUA 3P28A 3SVUA 3ST0A 4W6HA 3MGFA 5EJUA 4OHSA 3ST4A 4Q7UA 4W6DA 1ZGOA 4W7DA 1YHHA 4LQUA 3WLDA 4DXQA 3LVDA 4W69A 1KYPA 4EULA 1RMMA 4ZBLA 3I19A
chains in the Genus database with same CATH superfamily
2AWMA 3O78A 5EXCI 4LJBA 1OXFA 5DPHA 1Q4AA 1KYRA 4DXMA 5DTLA 3DQAA 1EMGA 3ST2A 2IOVA 2H9WA 3SVNA 2QU1A 4RYSA 3IR8A 5FVFA 2HGYA 2PXSA 4Q7RA 4W72A 2HFCA 2DUIA 4W6SA 3SVEA 2OKYA 1EMAA 5BTTB 4U2VA 1YHIA 2IE2A 2O29A 3DQDA 3PJBA 2A50B 3NEZA 1Q4DA 3DQ5A 1ZGPA 5BTTA 1XMZA 1H4UA 4ANJA 3DQOA 3U8PA 3RWTA 4H48A 4PPKA 2HJOA 4EDOA 1MOVA 2AWLA 4KF5A 3SSHA 2A56B 3OSRA 4PFEA 1RMOA 3GJ1A 3CD9A 4GOBA 5HW9A 2C9JA 2G2SB 4H3NA 1JBZA 5HZOA 3RWAA 5T3IA 2YE1A 4H3LA 3LF3A 3TMRA 2A48A 3ADFA 3LA1A 3GL4A 4J8AA 3BXAA 2WISA 4LJDA 2A46A 3BXCA 3VHTA 2O2BA 3M22A 4OQWA 2QLHA 4R6BA 2AWJA 2VZXA 3EKJA 1B9CA 2IB6A 4JGEA 3NT9A 4L12A 3EVRA 3LVCA 3DQCA 3SS0A 4LJCA 2YE0A 1MOUA 4RYWA 2VAEA 4ZINA 1EMFA 1Z1QA 1YHGA 2QT2A 4DXPA 3ZUJA 3SVDA 3UG0A 2OGRA 2HQKA 3DQFA 4GESB 3DQ6A 3W1CA 3EVUA 3DQ2A 4W6PA 4KGEA 2VVJA 3G9AA 5LK4A 2OTBA 3DPWA 2A53B 3PIBA 3ST3A 4KEXA 3ZTFA 4ZFSA 3U8CA 2B3QA 3OGOA 1Z1PA 4DXNA 2OTEA 2VADA 2V4EC 4W6AA 3GJ2A 5DPGA 1QY3A 2DD7A 4Z4KA 4N3DA 4R6DA 2IB5A 2Q6PA 2HGDA 4KA9A 4KPIA 2GW3A 3H1OA 2G6YA 4P76A 3DQHA 3DQ9A 5HBDA 3SVBA 4TZAA 3SG5A 1RMPA 2WSOA 3WLCA 5HGEA 1KYSA 3EK8A 1JC1A 4IK9A 3KCSA 2FZUA 5F9GA 4W6IA 5EB7A 4NWSA 2H6VA 3VK1A 3S05A 1ZUXA 4XOWA 3DQ4A 1KP5A 2BTJA 1HCJA 2JADA 3LVAA 2Z6XA 4W7FA 3CGLA 4HE4A 1XQMA 1YJ2A 3SG2A 1EMEA 4W75A 1YFPA 2WHTA 4W77A 2H5OA 2GX2A 3SVRA 3ZUFA 2ZO7A 3TMTA 2DDDA 3EK7A 2OKWA 2ICRA 4JFGA 3NT3A 5LTPA 4IK3A 4W6RA 3ZULA 3DQIA 2AH8A 3SG3A 2A47A 3CD1A 3DQEA 3VHTB 1W7UA 3BXBA 3DQNA 5EBJA 3NEDA 5EHUA 1RM9A 2RH7A 4Q9WA 3GEXA 4EMQA 1Q4CA 2DUFA 3DPZA 2WSNA 4RTCA 1BFPA 1W7SA 4DXIA 4IK5A 3E5WA 3UFZA 4ZF5A 2HRSA 1OXDA 5FVIA 2H8QA 2G3DB 2O24A 1G7KA 5H87A 2ARLA 5DY6A 3W1DA 3K1KA 2HPWA 5DPJA 5DPIA 3M24A 4Q9XA 2H5PA 4HQ8A 2VVHA 1C4FA 3U0KA 4W6LA 1QYOA 3GB3A 2Z6YA 4H47A 4JEOA 4W7XA 3V3DA 4DKNA 2A52B 3WCKA 4ZB1A 3O77A 3SSVA 2OJKA 4OY4A 4IZNA 4ZF4A 1JBYA 4IK4A 4JRBA 5FHVA 2B3PA 4L1IA 3CBEA 4LJDC 4W7EA 5BT0A 2WHSA 3ED8A 2Q57A 4W6UA 3DPXA 3SVCA 5KTGA 4IK8A 5J2OA 4W6CA 1YJFA 2V4EA 1OXEA 4KF4A 4XGYA 4W6BA 3EVPA 3AI4A 3CFAA 4Q7TA 5AQBB 4KW9A 5DTZA 1ZGQA 3DQUA 4UTSA 2G5ZB 4W6KA 3SSLA 5DTXA 2WHUA 1YZWA 2DUHA 2H5QA 1EMCA 4I2YA 4J88A 2QRFA 3LS3A 4PPJA 2FL1A 4OJ0A 4W7RA 2EMDA 4HQCA 3AKOA 4W74A 4DXOA 4OGSA 4KW4A 1F09A 4W7AA 2DUEA 3SSKA 3DQLA 4LQTA 3IP2A 2DDCA 4JF9A 3CFHA 4AR7A 3E5VA 5LTQA 2YFPA 4H3MA 2DUGA 3SSTA 2HQZA 3DQMA 2POXA 2WURA 4KAGA 3SG4A 3LSAA 3SRYA 4XVPA 2Z6ZA 3OSQA 3U0LA 4AS8A 2H5RA 5H89A 3E5TA 2G16B 4W7CA 2P4MA 2PXWA 1RRXA 2AWKA 5HZTA 4L13A 4EN1A 4B30B 2G6XA 4DKMA 3NF0A 1EMLA 2QLEA 1H6RA 2EMNA 3SG6A 1GFLA 3SSYA 4KW8A 1Q4BA 4W6GA 4W6OA 3SSPA 3CFFA 2ZO6A 5H88A 4B30A 1EMBA 4P1QA 1UISA 3DQKA 4ZIOA 2ZMUA 4W6MA 3EVVA 3H1RA 4XOVA 1JC0A 3SG7A 4HQ9A 2VVIA 2YDZA 1Q73A 3SV5A 1XSSA 1EMMA 2Y0GA 1QXTA 3BX9A 3SVSA 2DD9A 5DU0A 4HVFA 1Q4EA 5EXUA 3DQ7A 4W6NA 4J89A 2QLGB 4ZF3A 1GL4A 2AHAA 1F0BA 4KF5C 2HCGA 5DQBA 2WIQA 4KGFA 2G3OA 2ZMWA 4W73A 5BQLA 2QLGA 3DQ3A 5DTYA 3CB9A 1S6ZA 4IK1A 4TZGA 4Z4MA 4GF6B 4EDSA 4W6TA 4W76A 3U0NA 4W6JA 1HUYA 3P8UA 3A8SA 2V4EB 1QYFA 1EMKA 2GX0A 2G6EA 1W7TA 3U0MA 2QLIA 3EKHA 1GGXA 1XA9A 5EB6A 4LW5A 3DQ1A 2Z1OA 5EXBA 3KCTA 5DRFA 4W6FA 5DRGA 2GW4B 4B5YA 2EMOA 5DQMA 2FWQA 5HZUA 3PJ5A 3PJ7A 5FVGA 1XAEA 3DQJA 3U8AA 1CV7A 3EK4A 3DQ8A 5HZSA 4PPLA 4XL5A 2C9IA 3AI5A 3SVOA 3LF4B 1MYWA 3VICA 2A54B 1QYQA 4ORNA 5LTRA 2QZ0A 4JC2A 4BDUA 3P28A 3SVUA 3ST0A 4W6HA 3MGFA 5EJUA 4OHSA 3ST4A 4Q7UA 4W6DA 1ZGOA 4W7DA 1YHHA 4LQUA 3WLDA 4DXQA 3LVDA 4W69A 1KYPA 4EULA 1RMMA 4ZBLA 3I19A
chains in the Genus database with same CATH topology
2AWMA 3O78A 5EXCI 4LJBA 1OXFA 5DPHA 1Q4AA 1KYRA 4DXMA 5DTLA 3DQAA 1EMGA 3ST2A 2IOVA 2H9WA 3SVNA 2QU1A 4RYSA 3IR8A 5FVFA 2HGYA 2PXSA 4Q7RA 4W72A 2HFCA 2DUIA 4W6SA 3SVEA 2OKYA 1EMAA 5BTTB 4U2VA 1YHIA 2IE2A 2O29A 3DQDA 3PJBA 2A50B 3NEZA 1Q4DA 3DQ5A 1ZGPA 5BTTA 1XMZA 1H4UA 4ANJA 3DQOA 3U8PA 3RWTA 4H48A 4PPKA 2HJOA 4EDOA 1MOVA 2AWLA 4KF5A 3SSHA 2A56B 3OSRA 4PFEA 1RMOA 3GJ1A 3CD9A 4GOBA 5HW9A 2C9JA 2G2SB 4H3NA 1JBZA 5HZOA 3RWAA 5T3IA 2YE1A 4H3LA 3LF3A 3TMRA 2A48A 3ADFA 3LA1A 3GL4A 4J8AA 3BXAA 2WISA 4LJDA 2A46A 3BXCA 3VHTA 2O2BA 3M22A 4OQWA 2QLHA 4R6BA 2AWJA 2VZXA 3EKJA 1B9CA 2IB6A 4JGEA 3NT9A 4L12A 3EVRA 3LVCA 3DQCA 3SS0A 4LJCA 2YE0A 1MOUA 4RYWA 2VAEA 4ZINA 1EMFA 1Z1QA 1YHGA 2QT2A 4DXPA 3ZUJA 3SVDA 3UG0A 2OGRA 2HQKA 3DQFA 4GESB 3DQ6A 3W1CA 3EVUA 3DQ2A 4W6PA 4KGEA 2VVJA 3G9AA 5LK4A 2OTBA 3DPWA 2A53B 3PIBA 3ST3A 4KEXA 3ZTFA 4ZFSA 3U8CA 2B3QA 3OGOA 1Z1PA 4DXNA 2OTEA 2VADA 2V4EC 4W6AA 3GJ2A 5DPGA 1QY3A 2DD7A 4Z4KA 4N3DA 4R6DA 2IB5A 2Q6PA 2HGDA 4KA9A 4KPIA 2GW3A 3H1OA 2G6YA 4P76A 3DQHA 3DQ9A 5HBDA 3SVBA 4TZAA 3SG5A 1RMPA 2WSOA 3WLCA 5HGEA 1KYSA 3EK8A 1JC1A 4IK9A 3KCSA 2FZUA 5F9GA 4W6IA 5EB7A 4NWSA 2H6VA 3VK1A 3S05A 1ZUXA 4XOWA 3DQ4A 1KP5A 2BTJA 1HCJA 2JADA 3LVAA 2Z6XA 4W7FA 3CGLA 4HE4A 1XQMA 1YJ2A 3SG2A 1EMEA 4W75A 1YFPA 2WHTA 4W77A 2H5OA 2GX2A 3SVRA 3ZUFA 2ZO7A 3TMTA 2DDDA 3EK7A 2OKWA 2ICRA 4JFGA 3NT3A 5LTPA 4IK3A 4W6RA 3ZULA 3DQIA 2AH8A 3SG3A 2A47A 3CD1A 3DQEA 3VHTB 1W7UA 3BXBA 3DQNA 5EBJA 3NEDA 5EHUA 1RM9A 2RH7A 4Q9WA 3GEXA 4EMQA 1Q4CA 2DUFA 3DPZA 2WSNA 4RTCA 1BFPA 1W7SA 4DXIA 4IK5A 3E5WA 3UFZA 4ZF5A 2HRSA 1OXDA 5FVIA 2H8QA 2G3DB 2O24A 1G7KA 5H87A 2ARLA 5DY6A 3W1DA 3K1KA 2HPWA 5DPJA 5DPIA 3M24A 4Q9XA 2H5PA 4HQ8A 2VVHA 1C4FA 3U0KA 4W6LA 1QYOA 3GB3A 2Z6YA 4H47A 4JEOA 4W7XA 3V3DA 4DKNA 2A52B 3WCKA 4ZB1A 3O77A 3SSVA 2OJKA 4OY4A 4IZNA 4ZF4A 1JBYA 4IK4A 4JRBA 5FHVA 2B3PA 4L1IA 3CBEA 4LJDC 4W7EA 5BT0A 2WHSA 3ED8A 2Q57A 4W6UA 3DPXA 3SVCA 5KTGA 4IK8A 5J2OA 4W6CA 1YJFA 2V4EA 1OXEA 4KF4A 4XGYA 4W6BA 3EVPA 3AI4A 3CFAA 4Q7TA 5AQBB 4KW9A 5DTZA 1ZGQA 3DQUA 4UTSA 2G5ZB 4W6KA 3SSLA 5DTXA 2WHUA 1YZWA 2DUHA 2H5QA 1EMCA 4I2YA 4J88A 2QRFA 3LS3A 4PPJA 2FL1A 4OJ0A 4W7RA 2EMDA 4HQCA 3AKOA 4W74A 4DXOA 4OGSA 4KW4A 1F09A 4W7AA 2DUEA 3SSKA 3DQLA 4LQTA 3IP2A 2DDCA 4JF9A 3CFHA 4AR7A 3E5VA 5LTQA 2YFPA 4H3MA 2DUGA 3SSTA 2HQZA 3DQMA 2POXA 2WURA 4KAGA 3SG4A 3LSAA 3SRYA 4XVPA 2Z6ZA 3OSQA 3U0LA 4AS8A 2H5RA 5H89A 3E5TA 2G16B 4W7CA 2P4MA 2PXWA 1RRXA 2AWKA 5HZTA 4L13A 4EN1A 4B30B 2G6XA 4DKMA 3NF0A 1EMLA 2QLEA 1H6RA 2EMNA 3SG6A 1GFLA 3SSYA 4KW8A 1Q4BA 4W6GA 4W6OA 3SSPA 3CFFA 2ZO6A 5H88A 4B30A 1EMBA 4P1QA 1UISA 3DQKA 4ZIOA 2ZMUA 4W6MA 3EVVA 3H1RA 4XOVA 1JC0A 3SG7A 4HQ9A 2VVIA 2YDZA 1Q73A 3SV5A 1XSSA 1EMMA 2Y0GA 1QXTA 3BX9A 3SVSA 2DD9A 5DU0A 4HVFA 1Q4EA 5EXUA 3DQ7A 4W6NA 4J89A 2QLGB 4ZF3A 1GL4A 2AHAA 1F0BA 4KF5C 2HCGA 5DQBA 2WIQA 4KGFA 2G3OA 2ZMWA 4W73A 5BQLA 2QLGA 3DQ3A 5DTYA 3CB9A 1S6ZA 4IK1A 4TZGA 4Z4MA 4GF6B 4EDSA 4W6TA 4W76A 3U0NA 4W6JA 1HUYA 3P8UA 3A8SA 2V4EB 1QYFA 1EMKA 2GX0A 2G6EA 1W7TA 3U0MA 2QLIA 3EKHA 1GGXA 1XA9A 5EB6A 4LW5A 3DQ1A 2Z1OA 5EXBA 3KCTA 5DRFA 4W6FA 5DRGA 2GW4B 4B5YA 2EMOA 5DQMA 2FWQA 5HZUA 3PJ5A 3PJ7A 5FVGA 1XAEA 3DQJA 3U8AA 1CV7A 3EK4A 3DQ8A 5HZSA 4PPLA 4XL5A 2C9IA 3AI5A 3SVOA 3LF4B 1MYWA 3VICA 2A54B 1QYQA 4ORNA 5LTRA 2QZ0A 4JC2A 4BDUA 3P28A 3SVUA 3ST0A 4W6HA 3MGFA 5EJUA 4OHSA 3ST4A 4Q7UA 4W6DA 1ZGOA 4W7DA 1YHHA 4LQUA 3WLDA 4DXQA 3LVDA 4W69A 1KYPA 4EULA 1RMMA 4ZBLA 3I19A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AWM A;  3O78 A;  5EXC I;  4LJB A;  1OXF A;  5DPH A;  1Q4A A;  1KYR A;  4DXM A;  5DTL A;  3DQA A;  1EMG A;  3ST2 A;  2IOV A;  2H9W A;  3SVN A;  2QU1 A;  4RYS A;  3IR8 A;  5FVF A;  2HGY A;  2PXS A;  4Q7R A;  4W72 A;  2HFC A;  2DUI A;  4W6S A;  3SVE A;  2OKY A;  1EMA A;  5BTT B;  4U2V A;  1YHI A;  2IE2 A;  2O29 A;  3DQD A;  3PJB A;  2A50 B;  3NEZ A;  1Q4D A;  3DQ5 A;  1ZGP A;  5BTT A;  1XMZ A;  1H4U A;  4ANJ A;  3DQO A;  3U8P A;  3RWT A;  4H48 A;  4PPK A;  2HJO A;  4EDO A;  1MOV A;  2AWL A;  4KF5 A;  3SSH A;  2A56 B;  3OSR A;  4PFE A;  1RMO A;  3GJ1 A;  3CD9 A;  4GOB A;  5HW9 A;  2C9J A;  2G2S B;  4H3N A;  1JBZ A;  5HZO A;  3RWA A;  5T3I A;  2YE1 A;  4H3L A;  3LF3 A;  3TMR A;  2A48 A;  3ADF A;  3LA1 A;  3GL4 A;  4J8A A;  3BXA A;  2WIS A;  4LJD A;  2A46 A;  3BXC A;  3VHT A;  2O2B A;  3M22 A;  4OQW A;  2QLH A;  4R6B A;  2AWJ A;  2VZX A;  3EKJ A;  1B9C A;  2IB6 A;  4JGE A;  3NT9 A;  4L12 A;  3EVR A;  3LVC A;  3DQC A;  3SS0 A;  4LJC A;  2YE0 A;  1MOU A;  4RYW A;  2VAE A;  4ZIN A;  1EMF A;  1Z1Q A;  1YHG A;  2QT2 A;  4DXP A;  3ZUJ A;  3SVD A;  3UG0 A;  2OGR A;  2HQK A;  3DQF A;  4GES B;  3DQ6 A;  3W1C A;  3EVU A;  3DQ2 A;  4W6P A;  4KGE A;  2VVJ A;  3G9A A;  5LK4 A;  2OTB A;  3DPW A;  2A53 B;  3PIB A;  3ST3 A;  4KEX A;  3ZTF A;  4ZFS A;  3U8C A;  2B3Q A;  3OGO A;  1Z1P A;  4DXN A;  2OTE A;  2VAD A;  2V4E C;  4W6A A;  3GJ2 A;  5DPG A;  1QY3 A;  2DD7 A;  4Z4K A;  4N3D A;  4R6D A;  2IB5 A;  2Q6P A;  2HGD A;  4KA9 A;  4KPI A;  2GW3 A;  3H1O A;  2G6Y A;  4P76 A;  3DQH A;  3DQ9 A;  5HBD A;  3SVB A;  4TZA A;  3SG5 A;  1RMP A;  2WSO A;  3WLC A;  5HGE A;  1KYS A;  3EK8 A;  1JC1 A;  4IK9 A;  3KCS A;  2FZU A;  5F9G A;  4W6I A;  5EB7 A;  4NWS A;  2H6V A;  3VK1 A;  3S05 A;  1ZUX A;  4XOW A;  3DQ4 A;  1KP5 A;  2BTJ A;  1HCJ A;  2JAD A;  3LVA A;  2Z6X A;  4W7F A;  3CGL A;  4HE4 A;  1XQM A;  1YJ2 A;  3SG2 A;  1EME A;  4W75 A;  1YFP A;  2WHT A;  4W77 A;  2H5O A;  2GX2 A;  3SVR A;  3ZUF A;  2ZO7 A;  3TMT A;  2DDD A;  3EK7 A;  2OKW A;  2ICR A;  4JFG A;  3NT3 A;  5LTP A;  4IK3 A;  4W6R A;  3ZUL A;  3DQI A;  2AH8 A;  3SG3 A;  2A47 A;  3CD1 A;  3DQE A;  3VHT B;  1W7U A;  3BXB A;  3DQN A;  5EBJ A;  3NED A;  5EHU A;  1RM9 A;  2RH7 A;  4Q9W A;  3GEX A;  4EMQ A;  1Q4C A;  2DUF A;  3DPZ A;  2WSN A;  4RTC A;  1BFP A;  1W7S A;  4DXI A;  4IK5 A;  3E5W A;  3UFZ A;  4ZF5 A;  2HRS A;  1OXD A;  5FVI A;  2H8Q A;  2G3D B;  2O24 A;  1G7K A;  5H87 A;  2ARL A;  5DY6 A;  3W1D A;  3K1K A;  2HPW A;  5DPJ A;  5DPI A;  3M24 A;  4Q9X A;  2H5P A;  4HQ8 A;  2VVH A;  1C4F A;  3U0K A;  4W6L A;  1QYO A;  3GB3 A;  2Z6Y A;  4H47 A;  4JEO A;  4W7X A;  3V3D A;  4DKN A;  2A52 B;  3WCK A;  4ZB1 A;  3O77 A;  3SSV A;  2OJK A;  4OY4 A;  4IZN A;  4ZF4 A;  1JBY A;  4IK4 A;  4JRB A;  5FHV A;  2B3P A;  4L1I A;  3CBE A;  4LJD C;  4W7E A;  5BT0 A;  2WHS A;  3ED8 A;  2Q57 A;  4W6U A;  3DPX A;  3SVC A;  5KTG A;  4IK8 A;  5J2O A;  4W6C A;  1YJF A;  2V4E A;  1OXE A;  4KF4 A;  4XGY A;  4W6B A;  3EVP A;  3AI4 A;  3CFA A;  4Q7T A;  5AQB B;  4KW9 A;  5DTZ A;  1ZGQ A;  3DQU A;  4UTS A;  2G5Z B;  4W6K A;  3SSL A;  5DTX A;  2WHU A;  1YZW A;  2DUH A;  2H5Q A;  1EMC A;  4I2Y A;  4J88 A;  2QRF A;  3LS3 A;  4PPJ A;  2FL1 A;  4OJ0 A;  4W7R A;  2EMD A;  4HQC A;  3AKO A;  4W74 A;  4DXO A;  4OGS A;  4KW4 A;  1F09 A;  4W7A A;  2DUE A;  3SSK A;  3DQL A;  4LQT A;  3IP2 A;  2DDC A;  4JF9 A;  3CFH A;  4AR7 A;  3E5V A;  5LTQ A;  2YFP A;  4H3M A;  2DUG A;  3SST A;  2HQZ A;  3DQM A;  2POX A;  2WUR A;  4KAG A;  3SG4 A;  3LSA A;  3SRY A;  4XVP A;  2Z6Z A;  3OSQ A;  3U0L A;  4AS8 A;  2H5R A;  5H89 A;  3E5T A;  2G16 B;  4W7C A;  2P4M A;  2PXW A;  1RRX A;  2AWK A;  5HZT A;  4L13 A;  4EN1 A;  4B30 B;  2G6X A;  4DKM A;  3NF0 A;  1EML A;  2QLE A;  1H6R A;  2EMN A;  3SG6 A;  1GFL A;  3SSY A;  4KW8 A;  1Q4B A;  4W6G A;  4W6O A;  3SSP A;  3CFF A;  2ZO6 A;  5H88 A;  4B30 A;  1EMB A;  4P1Q A;  1UIS A;  3DQK A;  4ZIO A;  2ZMU A;  4W6M A;  3EVV A;  3H1R A;  4XOV A;  1JC0 A;  3SG7 A;  4HQ9 A;  2VVI A;  2YDZ A;  1Q73 A;  3SV5 A;  1XSS A;  1EMM A;  2Y0G A;  1QXT A;  3BX9 A;  3SVS A;  2DD9 A;  5DU0 A;  4HVF A;  1Q4E A;  5EXU A;  3DQ7 A;  4W6N A;  4J89 A;  2QLG B;  4ZF3 A;  1GL4 A;  2AHA A;  1F0B A;  4KF5 C;  2HCG A;  5DQB A;  2WIQ A;  4KGF A;  2G3O A;  2ZMW A;  4W73 A;  5BQL A;  2QLG A;  3DQ3 A;  5DTY A;  3CB9 A;  1S6Z A;  4IK1 A;  4TZG A;  4Z4M A;  4GF6 B;  4EDS A;  4W6T A;  4W76 A;  3U0N A;  4W6J A;  1HUY A;  3P8U A;  3A8S A;  2V4E B;  1QYF A;  1EMK A;  2GX0 A;  2G6E A;  1W7T A;  3U0M A;  2QLI A;  3EKH A;  1GGX A;  1XA9 A;  5EB6 A;  4LW5 A;  3DQ1 A;  2Z1O A;  5EXB A;  3KCT A;  5DRF A;  4W6F A;  5DRG A;  2GW4 B;  4B5Y A;  2EMO A;  5DQM A;  2FWQ A;  5HZU A;  3PJ5 A;  3PJ7 A;  5FVG A;  1XAE A;  3DQJ A;  3U8A A;  1CV7 A;  3EK4 A;  3DQ8 A;  5HZS A;  4PPL A;  4XL5 A;  2C9I A;  3AI5 A;  3SVO A;  3LF4 B;  1MYW A;  3VIC A;  2A54 B;  1QYQ A;  4ORN A;  5LTR A;  2QZ0 A;  4JC2 A;  4BDU A;  3P28 A;  3SVU A;  3ST0 A;  4W6H A;  3MGF A;  5EJU A;  4OHS A;  3ST4 A;  4Q7U A;  4W6D A;  1ZGO A;  4W7D A;  1YHH A;  4LQU A;  3WLD A;  4DXQ A;  3LVD A;  4W69 A;  1KYP A;  4EUL A;  1RMM A;  4ZBL A;  3I19 A; 
#chains in the Genus database with same CATH topology
 2AWM A;  3O78 A;  5EXC I;  4LJB A;  1OXF A;  5DPH A;  1Q4A A;  1KYR A;  4DXM A;  5DTL A;  3DQA A;  1EMG A;  3ST2 A;  2IOV A;  2H9W A;  3SVN A;  2QU1 A;  4RYS A;  3IR8 A;  5FVF A;  2HGY A;  2PXS A;  4Q7R A;  4W72 A;  2HFC A;  2DUI A;  4W6S A;  3SVE A;  2OKY A;  1EMA A;  5BTT B;  4U2V A;  1YHI A;  2IE2 A;  2O29 A;  3DQD A;  3PJB A;  2A50 B;  3NEZ A;  1Q4D A;  3DQ5 A;  1ZGP A;  5BTT A;  1XMZ A;  1H4U A;  4ANJ A;  3DQO A;  3U8P A;  3RWT A;  4H48 A;  4PPK A;  2HJO A;  4EDO A;  1MOV A;  2AWL A;  4KF5 A;  3SSH A;  2A56 B;  3OSR A;  4PFE A;  1RMO A;  3GJ1 A;  3CD9 A;  4GOB A;  5HW9 A;  2C9J A;  2G2S B;  4H3N A;  1JBZ A;  5HZO A;  3RWA A;  5T3I A;  2YE1 A;  4H3L A;  3LF3 A;  3TMR A;  2A48 A;  3ADF A;  3LA1 A;  3GL4 A;  4J8A A;  3BXA A;  2WIS A;  4LJD A;  2A46 A;  3BXC A;  3VHT A;  2O2B A;  3M22 A;  4OQW A;  2QLH A;  4R6B A;  2AWJ A;  2VZX A;  3EKJ A;  1B9C A;  2IB6 A;  4JGE A;  3NT9 A;  4L12 A;  3EVR A;  3LVC A;  3DQC A;  3SS0 A;  4LJC A;  2YE0 A;  1MOU A;  4RYW A;  2VAE A;  4ZIN A;  1EMF A;  1Z1Q A;  1YHG A;  2QT2 A;  4DXP A;  3ZUJ A;  3SVD A;  3UG0 A;  2OGR A;  2HQK A;  3DQF A;  4GES B;  3DQ6 A;  3W1C A;  3EVU A;  3DQ2 A;  4W6P A;  4KGE A;  2VVJ A;  3G9A A;  5LK4 A;  2OTB A;  3DPW A;  2A53 B;  3PIB A;  3ST3 A;  4KEX A;  3ZTF A;  4ZFS A;  3U8C A;  2B3Q A;  3OGO A;  1Z1P A;  4DXN A;  2OTE A;  2VAD A;  2V4E C;  4W6A A;  3GJ2 A;  5DPG A;  1QY3 A;  2DD7 A;  4Z4K A;  4N3D A;  4R6D A;  2IB5 A;  2Q6P A;  2HGD A;  4KA9 A;  4KPI A;  2GW3 A;  3H1O A;  2G6Y A;  4P76 A;  3DQH A;  3DQ9 A;  5HBD A;  3SVB A;  4TZA A;  3SG5 A;  1RMP A;  2WSO A;  3WLC A;  5HGE A;  1KYS A;  3EK8 A;  1JC1 A;  4IK9 A;  3KCS A;  2FZU A;  5F9G A;  4W6I A;  5EB7 A;  4NWS A;  2H6V A;  3VK1 A;  3S05 A;  1ZUX A;  4XOW A;  3DQ4 A;  1KP5 A;  2BTJ A;  1HCJ A;  2JAD A;  3LVA A;  2Z6X A;  4W7F A;  3CGL A;  4HE4 A;  1XQM A;  1YJ2 A;  3SG2 A;  1EME A;  4W75 A;  1YFP A;  2WHT A;  4W77 A;  2H5O A;  2GX2 A;  3SVR A;  3ZUF A;  2ZO7 A;  3TMT A;  2DDD A;  3EK7 A;  2OKW A;  2ICR A;  4JFG A;  3NT3 A;  5LTP A;  4IK3 A;  4W6R A;  3ZUL A;  3DQI A;  2AH8 A;  3SG3 A;  2A47 A;  3CD1 A;  3DQE A;  3VHT B;  1W7U A;  3BXB A;  3DQN A;  5EBJ A;  3NED A;  5EHU A;  1RM9 A;  2RH7 A;  4Q9W A;  3GEX A;  4EMQ A;  1Q4C A;  2DUF A;  3DPZ A;  2WSN A;  4RTC A;  1BFP A;  1W7S A;  4DXI A;  4IK5 A;  3E5W A;  3UFZ A;  4ZF5 A;  2HRS A;  1OXD A;  5FVI A;  2H8Q A;  2G3D B;  2O24 A;  1G7K A;  5H87 A;  2ARL A;  5DY6 A;  3W1D A;  3K1K A;  2HPW A;  5DPJ A;  5DPI A;  3M24 A;  4Q9X A;  2H5P A;  4HQ8 A;  2VVH A;  1C4F A;  3U0K A;  4W6L A;  1QYO A;  3GB3 A;  2Z6Y A;  4H47 A;  4JEO A;  4W7X A;  3V3D A;  4DKN A;  2A52 B;  3WCK A;  4ZB1 A;  3O77 A;  3SSV A;  2OJK A;  4OY4 A;  4IZN A;  4ZF4 A;  1JBY A;  4IK4 A;  4JRB A;  5FHV A;  2B3P A;  4L1I A;  3CBE A;  4LJD C;  4W7E A;  5BT0 A;  2WHS A;  3ED8 A;  2Q57 A;  4W6U A;  3DPX A;  3SVC A;  5KTG A;  4IK8 A;  5J2O A;  4W6C A;  1YJF A;  2V4E A;  1OXE A;  4KF4 A;  4XGY A;  4W6B A;  3EVP A;  3AI4 A;  3CFA A;  4Q7T A;  5AQB B;  4KW9 A;  5DTZ A;  1ZGQ A;  3DQU A;  4UTS A;  2G5Z B;  4W6K A;  3SSL A;  5DTX A;  2WHU A;  1YZW A;  2DUH A;  2H5Q A;  1EMC A;  4I2Y A;  4J88 A;  2QRF A;  3LS3 A;  4PPJ A;  2FL1 A;  4OJ0 A;  4W7R A;  2EMD A;  4HQC A;  3AKO A;  4W74 A;  4DXO A;  4OGS A;  4KW4 A;  1F09 A;  4W7A A;  2DUE A;  3SSK A;  3DQL A;  4LQT A;  3IP2 A;  2DDC A;  4JF9 A;  3CFH A;  4AR7 A;  3E5V A;  5LTQ A;  2YFP A;  4H3M A;  2DUG A;  3SST A;  2HQZ A;  3DQM A;  2POX A;  2WUR A;  4KAG A;  3SG4 A;  3LSA A;  3SRY A;  4XVP A;  2Z6Z A;  3OSQ A;  3U0L A;  4AS8 A;  2H5R A;  5H89 A;  3E5T A;  2G16 B;  4W7C A;  2P4M A;  2PXW A;  1RRX A;  2AWK A;  5HZT A;  4L13 A;  4EN1 A;  4B30 B;  2G6X A;  4DKM A;  3NF0 A;  1EML A;  2QLE A;  1H6R A;  2EMN A;  3SG6 A;  1GFL A;  3SSY A;  4KW8 A;  1Q4B A;  4W6G A;  4W6O A;  3SSP A;  3CFF A;  2ZO6 A;  5H88 A;  4B30 A;  1EMB A;  4P1Q A;  1UIS A;  3DQK A;  4ZIO A;  2ZMU A;  4W6M A;  3EVV A;  3H1R A;  4XOV A;  1JC0 A;  3SG7 A;  4HQ9 A;  2VVI A;  2YDZ A;  1Q73 A;  3SV5 A;  1XSS A;  1EMM A;  2Y0G A;  1QXT A;  3BX9 A;  3SVS A;  2DD9 A;  5DU0 A;  4HVF A;  1Q4E A;  5EXU A;  3DQ7 A;  4W6N A;  4J89 A;  2QLG B;  4ZF3 A;  1GL4 A;  2AHA A;  1F0B A;  4KF5 C;  2HCG A;  5DQB A;  2WIQ A;  4KGF A;  2G3O A;  2ZMW A;  4W73 A;  5BQL A;  2QLG A;  3DQ3 A;  5DTY A;  3CB9 A;  1S6Z A;  4IK1 A;  4TZG A;  4Z4M A;  4GF6 B;  4EDS A;  4W6T A;  4W76 A;  3U0N A;  4W6J A;  1HUY A;  3P8U A;  3A8S A;  2V4E B;  1QYF A;  1EMK A;  2GX0 A;  2G6E A;  1W7T A;  3U0M A;  2QLI A;  3EKH A;  1GGX A;  1XA9 A;  5EB6 A;  4LW5 A;  3DQ1 A;  2Z1O A;  5EXB A;  3KCT A;  5DRF A;  4W6F A;  5DRG A;  2GW4 B;  4B5Y A;  2EMO A;  5DQM A;  2FWQ A;  5HZU A;  3PJ5 A;  3PJ7 A;  5FVG A;  1XAE A;  3DQJ A;  3U8A A;  1CV7 A;  3EK4 A;  3DQ8 A;  5HZS A;  4PPL A;  4XL5 A;  2C9I A;  3AI5 A;  3SVO A;  3LF4 B;  1MYW A;  3VIC A;  2A54 B;  1QYQ A;  4ORN A;  5LTR A;  2QZ0 A;  4JC2 A;  4BDU A;  3P28 A;  3SVU A;  3ST0 A;  4W6H A;  3MGF A;  5EJU A;  4OHS A;  3ST4 A;  4Q7U A;  4W6D A;  1ZGO A;  4W7D A;  1YHH A;  4LQU A;  3WLD A;  4DXQ A;  3LVD A;  4W69 A;  1KYP A;  4EUL A;  1RMM A;  4ZBL A;  3I19 A; 
#chains in the Genus database with same CATH homology
 2AWM A;  3O78 A;  5EXC I;  4LJB A;  1OXF A;  5DPH A;  1Q4A A;  1KYR A;  4DXM A;  5DTL A;  3DQA A;  1EMG A;  3ST2 A;  2IOV A;  2H9W A;  3SVN A;  2QU1 A;  4RYS A;  3IR8 A;  5FVF A;  2HGY A;  2PXS A;  4Q7R A;  4W72 A;  2HFC A;  2DUI A;  4W6S A;  3SVE A;  2OKY A;  1EMA A;  5BTT B;  4U2V A;  1YHI A;  2IE2 A;  2O29 A;  3DQD A;  3PJB A;  2A50 B;  3NEZ A;  1Q4D A;  3DQ5 A;  1ZGP A;  5BTT A;  1XMZ A;  1H4U A;  4ANJ A;  3DQO A;  3U8P A;  3RWT A;  4H48 A;  4PPK A;  2HJO A;  4EDO A;  1MOV A;  2AWL A;  4KF5 A;  3SSH A;  2A56 B;  3OSR A;  4PFE A;  1RMO A;  3GJ1 A;  3CD9 A;  4GOB A;  5HW9 A;  2C9J A;  2G2S B;  4H3N A;  1JBZ A;  5HZO A;  3RWA A;  5T3I A;  2YE1 A;  4H3L A;  3LF3 A;  3TMR A;  2A48 A;  3ADF A;  3LA1 A;  3GL4 A;  4J8A A;  3BXA A;  2WIS A;  4LJD A;  2A46 A;  3BXC A;  3VHT A;  2O2B A;  3M22 A;  4OQW A;  2QLH A;  4R6B A;  2AWJ A;  2VZX A;  3EKJ A;  1B9C A;  2IB6 A;  4JGE A;  3NT9 A;  4L12 A;  3EVR A;  3LVC A;  3DQC A;  3SS0 A;  4LJC A;  2YE0 A;  1MOU A;  4RYW A;  2VAE A;  4ZIN A;  1EMF A;  1Z1Q A;  1YHG A;  2QT2 A;  4DXP A;  3ZUJ A;  3SVD A;  3UG0 A;  2OGR A;  2HQK A;  3DQF A;  4GES B;  3DQ6 A;  3W1C A;  3EVU A;  3DQ2 A;  4W6P A;  4KGE A;  2VVJ A;  3G9A A;  5LK4 A;  2OTB A;  3DPW A;  2A53 B;  3PIB A;  3ST3 A;  4KEX A;  3ZTF A;  4ZFS A;  3U8C A;  2B3Q A;  3OGO A;  1Z1P A;  4DXN A;  2OTE A;  2VAD A;  2V4E C;  4W6A A;  3GJ2 A;  5DPG A;  1QY3 A;  2DD7 A;  4Z4K A;  4N3D A;  4R6D A;  2IB5 A;  2Q6P A;  2HGD A;  4KA9 A;  4KPI A;  2GW3 A;  3H1O A;  2G6Y A;  4P76 A;  3DQH A;  3DQ9 A;  5HBD A;  3SVB A;  4TZA A;  3SG5 A;  1RMP A;  2WSO A;  3WLC A;  5HGE A;  1KYS A;  3EK8 A;  1JC1 A;  4IK9 A;  3KCS A;  2FZU A;  5F9G A;  4W6I A;  5EB7 A;  4NWS A;  2H6V A;  3VK1 A;  3S05 A;  1ZUX A;  4XOW A;  3DQ4 A;  1KP5 A;  2BTJ A;  1HCJ A;  2JAD A;  3LVA A;  2Z6X A;  4W7F A;  3CGL A;  4HE4 A;  1XQM A;  1YJ2 A;  3SG2 A;  1EME A;  4W75 A;  1YFP A;  2WHT A;  4W77 A;  2H5O A;  2GX2 A;  3SVR A;  3ZUF A;  2ZO7 A;  3TMT A;  2DDD A;  3EK7 A;  2OKW A;  2ICR A;  4JFG A;  3NT3 A;  5LTP A;  4IK3 A;  4W6R A;  3ZUL A;  3DQI A;  2AH8 A;  3SG3 A;  2A47 A;  3CD1 A;  3DQE A;  3VHT B;  1W7U A;  3BXB A;  3DQN A;  5EBJ A;  3NED A;  5EHU A;  1RM9 A;  2RH7 A;  4Q9W A;  3GEX A;  4EMQ A;  1Q4C A;  2DUF A;  3DPZ A;  2WSN A;  4RTC A;  1BFP A;  1W7S A;  4DXI A;  4IK5 A;  3E5W A;  3UFZ A;  4ZF5 A;  2HRS A;  1OXD A;  5FVI A;  2H8Q A;  2G3D B;  2O24 A;  1G7K A;  5H87 A;  2ARL A;  5DY6 A;  3W1D A;  3K1K A;  2HPW A;  5DPJ A;  5DPI A;  3M24 A;  4Q9X A;  2H5P A;  4HQ8 A;  2VVH A;  1C4F A;  3U0K A;  4W6L A;  1QYO A;  3GB3 A;  2Z6Y A;  4H47 A;  4JEO A;  4W7X A;  3V3D A;  4DKN A;  2A52 B;  3WCK A;  4ZB1 A;  3O77 A;  3SSV A;  2OJK A;  4OY4 A;  4IZN A;  4ZF4 A;  1JBY A;  4IK4 A;  4JRB A;  5FHV A;  2B3P A;  4L1I A;  3CBE A;  4LJD C;  4W7E A;  5BT0 A;  2WHS A;  3ED8 A;  2Q57 A;  4W6U A;  3DPX A;  3SVC A;  5KTG A;  4IK8 A;  5J2O A;  4W6C A;  1YJF A;  2V4E A;  1OXE A;  4KF4 A;  4XGY A;  4W6B A;  3EVP A;  3AI4 A;  3CFA A;  4Q7T A;  5AQB B;  4KW9 A;  5DTZ A;  1ZGQ A;  3DQU A;  4UTS A;  2G5Z B;  4W6K A;  3SSL A;  5DTX A;  2WHU A;  1YZW A;  2DUH A;  2H5Q A;  1EMC A;  4I2Y A;  4J88 A;  2QRF A;  3LS3 A;  4PPJ A;  2FL1 A;  4OJ0 A;  4W7R A;  2EMD A;  4HQC A;  3AKO A;  4W74 A;  4DXO A;  4OGS A;  4KW4 A;  1F09 A;  4W7A A;  2DUE A;  3SSK A;  3DQL A;  4LQT A;  3IP2 A;  2DDC A;  4JF9 A;  3CFH A;  4AR7 A;  3E5V A;  5LTQ A;  2YFP A;  4H3M A;  2DUG A;  3SST A;  2HQZ A;  3DQM A;  2POX A;  2WUR A;  4KAG A;  3SG4 A;  3LSA A;  3SRY A;  4XVP A;  2Z6Z A;  3OSQ A;  3U0L A;  4AS8 A;  2H5R A;  5H89 A;  3E5T A;  2G16 B;  4W7C A;  2P4M A;  2PXW A;  1RRX A;  2AWK A;  5HZT A;  4L13 A;  4EN1 A;  4B30 B;  2G6X A;  4DKM A;  3NF0 A;  1EML A;  2QLE A;  1H6R A;  2EMN A;  3SG6 A;  1GFL A;  3SSY A;  4KW8 A;  1Q4B A;  4W6G A;  4W6O A;  3SSP A;  3CFF A;  2ZO6 A;  5H88 A;  4B30 A;  1EMB A;  4P1Q A;  1UIS A;  3DQK A;  4ZIO A;  2ZMU A;  4W6M A;  3EVV A;  3H1R A;  4XOV A;  1JC0 A;  3SG7 A;  4HQ9 A;  2VVI A;  2YDZ A;  1Q73 A;  3SV5 A;  1XSS A;  1EMM A;  2Y0G A;  1QXT A;  3BX9 A;  3SVS A;  2DD9 A;  5DU0 A;  4HVF A;  1Q4E A;  5EXU A;  3DQ7 A;  4W6N A;  4J89 A;  2QLG B;  4ZF3 A;  1GL4 A;  2AHA A;  1F0B A;  4KF5 C;  2HCG A;  5DQB A;  2WIQ A;  4KGF A;  2G3O A;  2ZMW A;  4W73 A;  5BQL A;  2QLG A;  3DQ3 A;  5DTY A;  3CB9 A;  1S6Z A;  4IK1 A;  4TZG A;  4Z4M A;  4GF6 B;  4EDS A;  4W6T A;  4W76 A;  3U0N A;  4W6J A;  1HUY A;  3P8U A;  3A8S A;  2V4E B;  1QYF A;  1EMK A;  2GX0 A;  2G6E A;  1W7T A;  3U0M A;  2QLI A;  3EKH A;  1GGX A;  1XA9 A;  5EB6 A;  4LW5 A;  3DQ1 A;  2Z1O A;  5EXB A;  3KCT A;  5DRF A;  4W6F A;  5DRG A;  2GW4 B;  4B5Y A;  2EMO A;  5DQM A;  2FWQ A;  5HZU A;  3PJ5 A;  3PJ7 A;  5FVG A;  1XAE A;  3DQJ A;  3U8A A;  1CV7 A;  3EK4 A;  3DQ8 A;  5HZS A;  4PPL A;  4XL5 A;  2C9I A;  3AI5 A;  3SVO A;  3LF4 B;  1MYW A;  3VIC A;  2A54 B;  1QYQ A;  4ORN A;  5LTR A;  2QZ0 A;  4JC2 A;  4BDU A;  3P28 A;  3SVU A;  3ST0 A;  4W6H A;  3MGF A;  5EJU A;  4OHS A;  3ST4 A;  4Q7U A;  4W6D A;  1ZGO A;  4W7D A;  1YHH A;  4LQU A;  3WLD A;  4DXQ A;  3LVD A;  4W69 A;  1KYP A;  4EUL A;  1RMM A;  4ZBL A;  3I19 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...