4P2HA

Structure of human dna polymerase complexed with n7mg in the template opposite to incoming non-hydrolyzable ttp with manganese in the active site
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
326
structure length
324
Chain Sequence
b'TLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESQPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKNDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase beta
publication title Transition-state destabilization reveals how human DNA polymerase beta proceeds across the chemically unstable lesion N7-methylguanine.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/dna
total genus 109
structure length 324
sequence length 326
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2014-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4p2hA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4p2hA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4p2hA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4p2hA03
2ZH9A 4YXJA 3GIMA 3GV5B 4NLGA 3LK9A 3AQMA 1T3NA 5JUMA 2PXIA 7ICEA 5KFIA 4R64A 2FMQA 5J2IA 5IIMA 4JV2A 7ICJA 2ZH5A 3AU6A 5KFBA 1BPDA 2HHUA 4IR9A 3OUYA 3C1YA 2W9MA 1D9DA 2HHWA 2ZH2A 5J2BA 1U47A 4M6WB 2BQRA 3RBEA 2ISOA 1A77A 5J0PA 4IRDA 1S0VA 4NKTA 4WCWA 4ECQA 3H37A 3H8WA 2VA3A 3GIJA 5KFQA 3B0YA 1NK5A 1RYRA 4DL5A 2PFPA 4Z6EA 4F2RA 7ICQA 5KFZA 4UD5A 4DFJA 4NM1A 9ICIA 3ZD9A 1UEVA 1U49A 1DGSA 1OU5A 3HIYA 4DQSA 4RQ7A 4IQUA 1XS9D 4I2FA 3C2MA 4FO6A 3GFKB 4KLIA 1BVSA 4EBCA 4QZGA 4XA5A 5IINA 4LZGA 1MSWD 3GQCA 4DEZA 1ZQMA 4F3OA 9ICOA 4K4GA 2C22A 4RT3A 9ICQA 3K4GA 3C18A 4UB5A 2UVUA 1ZQWA 4KLMA 1XSPA 3ISDA 4ED6A 1T8EA 5J0RA 1D9FA 5KFHA 1DK2A 1U48A 1SL1A 4TQSA 3SV4A 1SL0A 4JV1A 4JV0A 1EXNA 3TANA 4RWNA 2BE3A 4X4VA 2RFFA 4F5QA 3GIKA 4AT8B 1YLQA 3TARA 2ZHBA 5CJ7A 3ZDEA 4M6WA 5HC9A 1ZJNA 4RPZA 5J0QA 4PGQA 4ED2A 2V4QA 3OHAA 4B9SA 3RRHA 2PBEA 2HHSA 1S0OA 4DL2A 4KLQA 4RPXA 2F1JA 1HUOA 5L1JA 2PFOA 3PW5A 4EZ9A 3AUOA 5KFKA 4G3IA 4WC7A 3RJEA 5F2VO 4M9HA 4X4PA 4DSEA 2LYHA 4X4SA 1UA1A 4PH5A 5KFTA 2FPKA 5CR0A 2XC9A 3MFIA 2DFLA 2HW3A 5HRLA 1UT5A 2XGPA 4ED0A 7ICIA 3OVSA 3T5LA 4I2IA 2Y1IA 2BPGA 4ELVA 1T7PA 2A1JA 8ICBA 3OVBA 2W8LA 3QZ7A 4LT6A 3GV7B 5J0SA 3G6VA 2KZZA 1V4AA 4DL6A 3N97B 5J2CA 4F8RA 1ZQLA 9ICVA 3TAPA 1JAJA 4QW9A 4KLSA 4AT8A 1IXRA 3UQ2A 4I2CA 4MFCA 8ICYA 8ICMA 7ICLA 4ECTA 2ZUDA 4KN4A 3PX6A 1QSSA 5J2HA 1U45A 3H4DA 1WCNA 1TAUA 4M5DA 1S10A 3SV3A 1QSLA 1WCLA 3LQCB 4DFKA 4ED7A 2W9BB 4DS4A 1JQRA 1BNOA 4NLZA 5KFLA 1ZQAA 5HHHA 4O5KA 2ZH1A 1JMSA 2Y1JA 4PPXA 5KFAA 3PNCA 4J9RA 1ZQSA 1C7YA 3M9OB 9ICMA 3M8RA 2ISPA 3PO4A 4F4ZA 1ZQQA 4GC6A 1H38A 4B9MA 8ICKA 4QZFA 4GXIA 9ICNA 2ID1A 3RJKA 9ICSA 2BHNA 2B21A 4UAWA 3TI0A 2I9GA 5KFCA 3RB6A 4KITB 1JXEA 8ICJA 2ZH4A 4RNNA 3KHLA 4RNMA 9ICHA 1ZQUA 4R66A 5HRGA 3UPSA 4WC6A 4TUPA 2W9CA 2NRKA 2BCUA 4RQ6A 4WC5A 4FBUA 5L9XA 1R8CA 1U9LA 1NO5A 3GDXA 4RWOA 1COOA 3RAXA 4ECXA 2HHPA 3OUYB 1DK3A 4K4HA 1ZQGA 2J6UA 3IM1A 4ED1A 4FHWA 3BQTA 3KHGA 4DL7A 2BCQA 4X4OA 2AQ4A 4QW8A 4I2JA 1MQ2A 3SYZA 2M2TA 1XWLA 3PR5B 5D46A 3PW0A 1NJYA 1SL2A 3H7IA 1UETA 2MUTB 3OV7A 4M9LA 3PW7A 5KG2A 5F9LA 3N4MB 4DQQA 1ZQPA 4P4OA 4MF8A 4I27A 3QZ8A 3JPSA 2W9BA 4ECUA 4GXKA 2KZ3A 4YQWA 4FS1A 4JWNA 4FHYA 4BWMA 1KFTA 4RWPA 4YMOA 2UVWA 4X0AA 4IG8A 4QWEA 1K1SA 5DB9A 3AU2A 4DOAA 4F93B 2ASDA 4NKUA 1HUZA 4QZ8A 4I28A 9ICPA 4Z6CA 3T5JA 2ATLA 4DFMA 8ICWA 4LZDA 3GILA 5HRIA 4RQ2A 1ZQYA 4EYHB 3GV8B 3MR5A 3T3FA 2KN7A 2AGQA 3ZD8A 3MR3A 4YVZA 4PHEA 5CHGA 4FHVA 3MDCA 1WOTA 1TVAA 1Y88A 5DKWA 4BDPA 3PY8A 4DSLA 3T5KA 4DF8A 1MIVA 2JZBB 1BPXA 4E0DA 7ICSA 5HRFA 3RJGA 5KFEA 8ICLA 1JX4A 7ICOA 1R8BA 2MUTA 5KFRA 3HPOA 2Q0ZX 4HYKA 5KG3A 3TAQA 4BGDA 4UD4A 4WC1A 3HP6A 4YR3A 5KT4A 1JIHA 2BPCA 1KRPA 4I2DA 4XQ8A 2R8HA 1HJPA 5F9NA 3OSPA 1X9SA 1CEZA 5KFWA 2DR9A 1KNYA 2AGOA 4M04A 4KLLA 1X9MA 1SKSA 5HR9A 4RQ3A 3HX0A 2KFNA 1NKEA 2ZTCA 2F1HA 4TQRA 1ZQBA 4F50A 4I2AA 3Q8PB 5HP4A 3LWMA 3PW4A 2IHNA 4JK1A 4I2HA 4Z6DA 4PHPA 4UQGA 1L3SA 5L1LA 2ZTDA 2NRZA 1BPYA 4YMNA 3RJFA 1ZQFA 5DQHA 3HW8A 4J9LA 7ICNA 4E8FA 4IRKA 2A1JB 4EZ6A 5J0UA 3WFRE 1KSPA 5IIJA 3QEBZ 3M9MB 4E7XA 4QZDA 3LWLA 4DOBA 3RB0A 4R8UB 3KHHA 8ICZA 2J6TA 4RQ5A 3ZDDA 5BOLA 4Q45A 4RU9A 4EBDA 4YMMA 8ICAA 3QEAZ 5KFDA 2R8KA 2ALZA 4I29A 7ICHA 9ICTA 3THVA 2JZBA 3JYYA 4Q8FA 4XQ7A 3MBYA 1XSLA 4O9MA 4J9SA 5CWRA 3C66A 3PX4A 4WBZA 2ZHAA 3WFSC 4F2SA 2ZH8A 2XO7A 3MDAA 3MABA 2DRAA 1SKWA 4J9MA 2J6SA 2ZJ5A 4GC7A 4TUQA 1LB2B 1KEJA 5DEDA 2AQ0A 5DGBA 4RNOA 3JPTA 5J2EA 4RQ1A 3RB3A 4YN4A 3H38A 1A76A 2FPMA 4TUSA 3TFRA 4P4PA 1ZQTA 2BPFA 4YD2A 7ICKA 4QZ9A 3OGUA 1TK5A 5DQGA 4F5RA 1ZQKA 9ICEA 4DQIA 2DPIA 3RJIA 4MFFA 4DQRA 5DLGA 5J29A 2W9CB 4B9TA 5KG5A 4PHDA 9ICJA 3NGDA 5BPCA 1Z3EB 1S77D 2BCVA 5DDMA 4J9PA 5HNKA 1TKDA 3M9NB 1S0MA 5KT6A 5KFFA 4R8UA 5DBBA 1U4BA 1NJWA 4ED8A 2JEJA 3BJYA 3K75D 2NRTA 3C5FA 4PHAA 2XGQA 1TFWA 3V6JA 1MC8A 2ASJA 1RYSA 4R65A 1ZQXA 5IIOA 3H39A 4QZBA 3MGHA 1UT8A 3JPQA 9ICRA 2M2WA 5KFYA 4UBCA 2BKEA 4ECYA 4PGXA 5KFNA 1LV5A 2HHTA 4QZHA 4WC0A 3PW2A 4WBYA 3H8SA 4F5PA 2BR0A 3NTUA 4C8LA 4DQPA 5J0WA 5J0YA 2C2DA 5KT2A 2FMPA 4RQ0A 1ZQNA 3OJUA 4DFPA 2C2RA 4DO9A 3Q8KA 2IMWP 1ZETA 3BDPA 1TFYA 1NKBA 1TK8A 1VFGA 5KTQA 4KLTA 3H40A 2NRWA 3RJHA 2P6RA 9ICXA 5HREA 8ICRA 2FLNA 2DVIA 4PGYA 3KHRA 3RH6A 4NXZA 3UQ0A 4KLEA 4ATBB 4E80A 1ZJMA 3NYBA 2NRXA 4BXOB 4NY8A 1NK6A 4O0IA 4B9LA 2PFQA 1Q78A 4O5EA 4ECWA 4NLNA 4EBJA 4I2GA 1NK4A 4QZCA 1UEUA 5DBAA 3PV8A 4LVSA 5DG8A 2ZJAA 5KG7A 1ZYQA 1XC9A 1Q79A 1JXLA 5DB8A 1BPEA 1N48A 2ZJ8A 4Z6FA 4GXJA 8ICSA 5DB7A 3EPIA 5J2DA 4TURA 3GIIA 3OHBA 1NK7A 3UXOA 4QZAA 4MEYA 2WTFA 3ZDCA 4ELTA 5CB1A 2ZH7A 1PX5A 3V7LA 4EYIB 3UXPA 1VJ7A 3ORYA 3AQLA 4DL3A 4QWDA 4O3RA 4Q8EA 1JN3A 4R63A 5DLFA 1MQ3A 1NK9A 2BDPA 4M0AA 4MF2A 1QSYA 2HVIA 4KTQA 4RWQA 2DRBA 3AQKA 4BWJA 5KFVA 1S9FA 1KLNA 4UB3A 3Q8LA 4F91B 3B0XA 1QLNA 9ICGA 5KT5A 8ICNA 4YR2A 2FPLA 2PFNA 5KT7A 2R8IA 4ED3A 4NLKA 1X2IA 2R8GA 3UPQA 4ELUA 2W9AA 3LDAA 4C8KA 8ICEA 4ATBA 1V9PA 5IILA 4X4TA 3C2KA 1R8AA 3RB4A 3L9DA 3JPOA 2XY5A 5C5JA 3EW9A 4F92B 4RQ4A 4GLXA 2AGPA 1ZQIA 4BXOA 3EYZA 2XCAA 3MGIA 3OSNA 2C28A 1ZQCA 2PI4A 2KTQA 8ICOA 1KTQA 3ISBA 5EWGA 4EEYA 3HJ4A 2RDJA 4AT9B 3C5GA 4C8OA 3ZDAA 4KLFA 4FHPA 1BGXT 4IR1A 4YD1A 5J0OA 4F5OA 5DG9A 4IQTA 4RPYA 4KN7A 5KG4A 4DS5A 5EOZA 5HMLA 4I2EA 5HRDA 5EWEA 1RXWA 8ICCA 9ICUA 3PMNA 3RR8A 2OWOA 3HJ1A 4DSIA 9ICAA 4M2YA 1BPBA 2V9WA 4EP7A 3JPPA 4UB2A 3RR7A 3JPRA 2I1QA 2JEGA 4QZIA 4KMUA 3RRGA 2FMSA 3Q8MA 8ICGA 8ICIA 5KFJA 4UB1A 5EWFA 3PVXA 4F4KA 1ZQVA 5KFPA 3V72A 4J9QA 1N56A 2JEFA 4Q44A 8ICFA 4WC2A 9ICBA 5J2FA 4RT2A 1UA0A 1TFRA 3EPGA 9ICKA 4I2BA 5L1KA 4JUZA 2BCRA 4J9OA 4DL4A 3PX0A 5J0XA 2R8JA 1RXVA 3ZDBA 3JZ0A 4AT7B 3RBDA 3RH4A 7ICUA 4RZRA 2IA6A 3TFSA 4M9GA 2F1IA 7ICPA 4QWCA 4KLOA 2VANA 5TZVA 4K4IA 2H5XA 1NJZA 1NK8A 4ECVA 2ZTEA 4YFKA 4AT9A 3MR6A 5L1IA 5DECA 8ICXA 5J2AA 5IIKA 3TQ1A 1NK0A 5KFSA 2NRVA 3M8SA 4MEXA 5KG1A 5IIIA 1XSNA 4YCXA 4B9NA 4DWIA 8ICVA 2M2UA 2M9NA 2O1PA 4EBKA 5KFGA 8ICPA 8ICUA 4S3NA 4DOCA 3PO5A 1NKCA 5KT3A 2GWSA 4KLJA 4J9NA 5HMMA 4M9JA 4X5VA 2O5AA 7ICRA 3OVAA 2ZUBA 4QWAA 1SZPA 4FBTA 4ECSA 1ZQDA 2BQ3A 5D4BA 4O3PA 2PI5A 1S76D 2HHVA 2BCSA 4O3QA 5KG6A 4WC3A 1ZQHA 4ECZA 2XY7A 2BQUA 3UXNA 1D8LA 5KG0A 4C8MA 4CCHA 3V7KA 5DG7A 1KFSA 5KFUA 3HT3A 4YP3A 1QTMA 1RPLA 7ICMA 2Q66A 4AT7A 4X4NA 2AU0A 3C21A 3EZ5A 4M9NA 5CP2A 5J2JA 5D49A 1XU4A 1FA0A 3ETLA 4X4UA 3SZ2A 4O3NA 4P4MA 4EBEA 3RH5A 4YR0A 4UBBA 3HWTA 9ICLA 4YG2A 3Q8SB 1ZQZA 1L3TA 4NM2A 4B9VA 5DB6A 3PMLA 3V7JA 7ICGA 4Q43A 5J0TA 2W8KA 1CUKA 3ISCA 4B9UA 4DSKA 4O5CA 1T4GA 2VA8A 8ICHA 3H3AA 2AJQA 3WFPA 3SI8A 3IHQB 2DPJA 8ICTA 4C8NA 5HRKA 2JEIA 4JWMA 1B43A 2ZUCA 4RUCA 1ZQRA 2BGWA 3H8JA 3V6HA 1SKRA 4XUSA 5BOMA 4FS2A 2VA2A 4FHXA 2C2EA 4F5NA 4UAZA 7ICFA 3MFHA 2UVRA 5DGAA 3G6YA 3MR2A 1NJXA 4IRCA 5KFOA 3G6XA 3C2LA 4KLGA 2HHQA 9ICFA 1Z00B 4YXMA 3PR4A 3C23A 2HVHA 3RJJA 4P2HA 3RTVA 4KLDA 4DLEA 1BPZA 3H4BA 1MIYA 2KFZA 2DR5A 9ICWA 2DR8A 2P66A 4M47A 5HRHA 4X4RA 3Q8QB 1NZPA 4RQ8A 1KFDA 1S0NA 1ZQEA 1S97A 4IQVA 3V6KA 5J2GA 4DSJA 1F5AA 1ZQOA 2FLPA 5DDYA 4XRHA 4FH5A 4FH3A 4X0BA 2ZH3A 1BNPA 3FYHA 5HHIA 1NOMA 1RZTA 4UAYA 4MFAA 1MIWA 5HRBA 1PZNA 2DR7A 1KDHA 1K1QA 4DSFA 2MAXA 1X9WA 2HHXA 3BQ1A 1XO1A 4UB4A 4F4YA 4DLGA 2XCPA 5CA7A 5DQIA 2KZMA 8ICQA 2RDIA 1D8YA 2XY6A 1TK0A 4QZEA 2FLLA 1DOQA 2V4RA 3RAQA 4IQWA 4KLHA 4ZH4A 4O3SA 1TAQA 3BQ0A 3JPNA 3FDSA 1AROP 3T5HA 7ICTA 3C1ZA 5DBCA 2IHMA 2ASLA 7ICVA 3EWAA 1B22A 4X4QA 1TV9A 4KLUA 3WFQE 1Z00A 2P6UA 4ECRA 3E2EA 4WC4A 3QE9Y 5J2KA 4O3OA 2IBKA 4F4WA 4DF4A 5KFMA 9ICCA 3WFOA 2ZH6A 3Q8RB 1R89A 1L5UA 3AQNA 4J9KA 1ZQJA 3KTQA 5KFXA 3OJSA 1L3UA 2UVVA 1IM4A 4F4XA 2KP7A 1L3VA 4RUAA 2M2VA 4QWBA 3BQ2A
chains in the Genus database with same CATH superfamily
1SB3C 2ZH9A 2QARB 3AQMA 3QXGA 5JUMA 7ICEA 3AMZA 4I0UA 4AYBF 2FMQA 4PZNA 7ICJA 1BPDA 3K1RB 3C1YA 2H3IA 2KICA 3RBEA 5J0PA 1P7DA 3GU3A 4ECQA 3H8WA 2VA3A 2PFPA 4Z6EA 4F2RA 4Y2RA 2KKPA 5ALJA 4LJXA 4O3MA 3H0LB 4DQSA 4RQ7A 4IQUA 4I2FA 1V4AA 3C2MA 4LZGA 2H3QA 4XA5A 4QZGA 2JH7A 3GQCA 4DEZA 2C22A 9ICQA 3K4GA 4KLMA 3ISDA 1D9FA 2WF8A 1U48A 1SL0A 4Y2SA 3J81j 4EGWA 3TANA 2OH2A 2ZHBA 2YB1A 3WKAA 4ED2A 3OHAA 4OJPA 4CF4A 1PK3A 4RPXA 4G3IA 5KFKA 4M9HA 4DSEA 2LYHA 4CRXA 2K60A 2HW3A 3PSFA 2XGPA 4ED0A 3N7PD 2IHOA 3T5LA 2ESEA 3QZ7A 5J0SA 2KZZA 2JMGA 3N97B 5J2CA 9ICVA 4AT8A 7ICLA 5AKZA 1QSSA 1WCNA 1S10A 3NWIA 2W9BB 2BZFA 2ZXIA 4PPXA 4J9RA 4Y2JA 2W7PA 9ICMA 5ALNA 8ICKA 1H38A 4B9MA 2ID1A 2BHNA 2I9GA 4KITB 4WC6A 4K96A 1ZQUA 5AKEA 2W9CA 1RQLA 1R8CA 1U9LA 1COOA 4LEYA 4K4HA 2J6UA 3KHGA 1L7OA 3NVOA 1XWLA 3PW0A 1NJYA 2MUTB 5ALWA 2W54A 4OO1J 3QZ8A 2KZ3A 4FS1A 4BWMA 4RWPA 4YMOA 4IG8A 5DB9A 5AKLA 1T94A 9ICPA 4Z6CA 3T5JA 4A8EA 2ATLA 4LZDA 3GILA 1ZQYA 4LEVA 2F2AB 5CHGA 2ZXHA 1HIWA 3MDCA 3SAGA 1SV4A 5DKWA 5GTHU 1MIVA 2JZBB 4C7YA 5HRFA 7ICSA 3RJGA 8ICLA 3PHZA 1JX4A 3I76A 3TAQA 1X9XA 4HYKA 4I2DA 2DRAA 1HJPA 2EDUA 3OSPA 5KFWA 1VLBA 1X9MA 3HX0A 4TQRA 1ZQBA 4I2AA 4EENA 4B6JA 3PW4A 4Z6DA 4UQGA 3RJFA 3IP4B 4EZ6A 3WKEA 4QZDA 3KHHA 4NXTA 2HOQA 3QU4A 4US8A 1ZD2P 3VC8A 8ICAA 7ICHA 9ICTA 2E8NA 2EZXA 3T79A 2FCLA 4WBZA 3PX4A 3WFSC 4F2SA 2IUBA 1KEJA 2AQ0A 3JPTA 3RB3A 4YN4A 1A76A 4P4PA 1TK5A 4DQIA 4C4TA 4MFFA 4WOYA 1N2XA 4PHDA 1S77D 4QIWC 4EX7A 3M9NB 5KFFA 4ED8A 4C7ZA 3V6JA 1RYSA 4QZBA 1UT8A 3JPQA 9ICRA 5ALDA 1X6IA 2BKEA 1LV5A 3PW2A 4GIBA 1ECWA 3SEIA 4F5PA 5J0YA 2LM4A 3KBBA 1GO3F 5KT2A 4MHVA 1VFGA 3H40A 2NRWA 3RJHA 2ZIVB 4ATBB 4E80A 4GFJA 2OXOA 2NRXA 2A1AA 4BXOB 1NK6A 5T14A 2HOIA 1NK4A 2Z7JA 1Z4NA 1PUZA 4LVSA 1JXLA 4Z6FA 3EPIA 2ZIWA 2EH9A 4RQNA 4NXVA 1PVQA 2R18A 4QZAA 2WTFA 5CRXA 1KW4A 4Q8EA 2BDPA 1L8LA 2DRBA 4KTQA 5KFVA 5AIBA 1S9FA 4UB3A 2R8GA 4ELUA 1F44A 5IILA 3RB4A 2XY5A 5C5JA 3QU5A 3EYZA 2XCAA 3WKDA 4K99A 2KTQA 2W04A 2Y0SF 3ISBA 4EEYA 4C8OA 5J0OA 3BS5A 5HMLA 1ZRMA 2YQEA 5HRDA 1RXWA 2OWOA 3JPRA 1MIWA 1QQ5A 3V72A 4C80A 2HBMA 2F76X 4WC2A 1UA0A 2LYAA 2KD1A 5L1KA 3ER9B 2R8JA 1RXVA 2E8OA 5D62A 7ICUA 2F1IA 2WAQC 1NJZA 1NK8A 2KV2A 4YFKA 3MR6A 4AT9A 8ICXA 5J2AA 5IIKA 4F72A 2NRVA 1SZHA 5KG1A 1XSNA 4B9NA 2IOFA 2RRDA 2W3RA 2M2UA 2M9NA 3HKZF 2O1PA 4S3NA 4KLJA 1OW5A 4X5VA 2O5AA 7ICRA 2ZUBA 5AI6A 4ECSA 4ACOA 5CFUA 2BQ3A 4CCHA 5DG7A 1KFSA 3BZKA 1T3QA 3MC1A 4BX9C 7ICMA 2Q66A 4X4NA 1Z1VA 3EZ5A 2F8KA 2K4HA 2NO4A 5CP2A 2G06A 2A3VA 4EBEA 4UBBA 4ICAA 2K4PA 3H0RB 3ISCA 3H3AA 1ZD5A 2KE7A 2DPJA 8ICTA 5KAIU 3V6HA 1SKRA 4FHXA 4IRCA 1NJXA 4KLGA 3MR2A 2CPRA 3U26A 5KFOA 2HHQA 4YXMA 3C23A 3RTVA 1WG8A 3H4BA 5ALEA 2DKZA 9ICWA 5J8YC 1NZPA 4RQ8A 1KFDA 3CRXA 4IQVA 3V6KA 3SR6A 3TKAA 4OJ5A 2WFAA 1PZNA 4NXXA 1K1QA 1VDVA 3WK7A 2MAXA 2HHXA 1XO1A 4F4YA 2RDIA 1TK0A 4ZH4A 4O3SA 1TAQA 1JROA 5EE1A 3SD7A 1B0XA 4WC4A 2E8MA 4DF4A 4C0ZA 2ZH6A 3BZCA 3AQNA 3OJSA 1L3UA 5AI5A 1IM4A 1L3VA 4RUAA 4YXJA 3LK9A 3LVVA 1T3NA 2DF4B 5KFIA 4US9A 5J2IA 4JV2A 2W11A 4IR9A 1D9DA 2ZH2A 3KZIU 3QUTA 2BQRA 1A77A 1S0VA 1MA7A 2YMQA 3M1YA 3H37A 3RFAA 3GIJA 5KFQA 1RYRA 1NK5A 4DL5A 5KFZA 4NM1A 1UEVA 9ICIA 3F5EA 1U49A 1DGSA 4J03A 1OU5A 3HIYA 1CRXA 1XS9D 4KLIA 1MSWD 4CE6A 2EAMA 5AKKA 2HSZA 4UB5A 2UVUA 4ED6A 1URJA 5J0RA 5KFHA 4TQSA 4MKPA 2BE3A 1J2MA 3N7RC 4AT8B 2NYVA 1YLQA 3VCBA 5CJ7A 4M6WA 3ETRA 1ZJNA 4RPZA 5J0QA 4B9SA 4OAHA 2HDOA 2PFOA 4WC7A 3O0FA 3F2CA 4X4PA 1UA1A 4PH5A 2FPKA 5CR0A 2XC9A 3MFIA 2DFLA 2XVTA 3D6JA 4ELVA 8ICBA 2WF9A 2W8LA 1YZ7A 4EEKA 2GLEA 2OM6A 1ZQLA 1V38A 3WK4A 1JAJA 4KLSA 1L6NA 1IXRA 4KN4A 5J2HA 1U45A 3LQCB 4DFKA 3F2DA 1BNOA 1ZQAA 1ZQSA 1WYGA 3M8RA 1J97A 4F4ZA 4QZFA 2B21A 5B5EU 5KFCA 2LKYA 3R9KA 2NRKA 2BCUA 4RQ6A 2ZIUA 3DDHA 4FBUA 4WC5A 2NV3A 1NO5A 5ALIA 3OUYB 3N28A 1ZQGA 4ED1A 4DL7A 2BCQA 1N62A 2K4EA 3SYZA 1SL2A 5D46A 3OV7A 4OAGA 4I27A 3M7DA 2ODGA 4FHYA 3NVYA 1KFTA 4X0AA 1K1SA 4BUGA 4DOAA 2IOHA 4UB8U 5ALFA 3M6KA 5AKGA 1YZ6A 3GV8B 3MR5A 5D63A 3ZD8A 3MR3A 1SIJA 4FHVA 3OPXA 4Y2PA 5AK6A 1Y88A 2KSOB 5AKJA 3T5KA 1O03A 5AI8A 5KFEA 5AK3A 5KG3A 5G5GA 4UD4A 4WC1A 1JIHA 2BPCA 2B51A 4XQ8A 1X9SA 3WK5A 1KNYA 4M04A 4KLLA 1SKSA 2KFNA 2ZTCA 2F1HA 1QH9A 3Q8PB 3LWMA 3F2BA 4KX5A 1BPYA 5L1LA 1QCKA 1ZQFA 3HW8A 2G08A 1PVRA 2A1JB 2HOFA 5IIJA 4CF5A 8ICZA 4LEZA 1VJ5A 3KKAA 4EBDA 1J2NA 1IG6A 3L3FX 5KFDA 2ALZA 3THVA 4XQ7A 3MBYA 5JU5A 5KL8B 2XO7A 2J6SA 4GC7A 4EX6A 1JRPA 4UB6U 4TUSA 2FPMA 1ZQTA 2QB1A 3OGUA 4F5RA 9ICEA 2DPIA 2LMRA 5DLGA 5J29A 3NGDA 4J9PA 5HNKA 2JXJA 1S0MA 1NJWA 1U4BA 2VIXA 1NZBA 3QX7A 5AK5A 2OEHA 2E1FA 2DQNB 2NRTA 2WF5A 3K75D 4PHAA 3SMVA 3KFUF 2ASJA 3H39A 1TFWA 2BDUA 3MGHA 2HI0A 3OWGA 3QUBA 4UBCA 2ZIWB 3OTQA 2HHTA 3F53A 1JUDA 2B6GA 2BR0A 5J0WA 2C2DA 4XJEA 1RG6A 3OJUA 2KJ8A 2C2RA 3Q8KA 4CDGA 4JMUA 1ZETA 2IMWP 1TFYA 2KKVA 1NKBA 5ALRA 2RP5A 2LYBA 9ICXA 8ICRA 3KHRA 1ZJMA 3NYBA 4NY8A 1Q78A 4O5EA 4NLNA 4EBJA 4I2GA 1RQNA 1ZD3A 3PV8A 2ZJAA 4WH5A 5DB8A 1BPEA 3ALRA 2WF7A 1ZXIA 5J2DA 4TURA 1NK7A 3OHBA 2YTUA 5CB1A 4EYIB 2JR5A 4O3RA 1JN3A 4R63A 4M0AA 4MF2A 4RWQA 3IV6A 4FZNA 8ICNA 4O6AA 5A0LA 2PFNA 5KT7A 2R8IA 4ED3A 1K5OA 1XO0A 4NLKA 2RLTA 1Q8KA 3LDAA 1V9PA 1OXJA 3C2KA 4PJ0U 3JPOA 4F92B 4GLXA 2AGPA 3ZI4A 2C28A 3NASA 2GH1A 2RDJA 4AT9B 4KLFA 1BGXT 4F5OA 5DG9A 4IQTA 4RPYA 4KN7A 5KG4A 5EOZA 4I2EA 4DCCA 5EWEA 8ICCA 9ICUA 3PMNA 1BPBA 2HMXA 1MN8A 2JEGA 2I1QA 2JRZA 4QZIA 8ICGA 8ICIA 3PVXA 5EWFA 2KHQA 2GO7A 5J2FA 3ER8C 3EPGA 4I2BA 4DL4A 4EEDA 3ZDBA 4Y2UA 4Y2VA 3IRUA 3RH4A 3RBDA 3TFSA 4M9GA 1DRGA 3PSIA 5TZVA 1N5XA 2F8LA 2AXTU 5JRTA 2F77X 3TADA 2HBKA 5ALYA 1NK0A 4K97A 5KFSA 3CK6A 4FFDA 2O6KA 2Q4TA 2KMDA 5G5HA 5KFGA 8ICPA 8ICUA 1NKCA 1ZRNA 2GWSA 5HMMA 2WB1C 3PSTA 3OVAA 4FBTA 1ZQDA 4P0PA 5KG6A 2KJ5A 2XY7A 2BQUA 4NL9A 4C8MA 2QKQA 2QLTA 3NS1A 4YP3A 5TISU 1QTMA 2WF6A 2AU0A 5ALUA 1N5WA 4QIWF 5J2JA 5D49A 1XU4A 1FA0A 4RQMA 4X4UA 4O3NA 4YR0A 3QU9A 3HWTA 4YG2A 3Q8SB 1ZQZA 7ICGA 3V7JA 5ALTA 3LYSA 2XIDA 5J0TA 2W8KA 1CUKA 4B9UA 4DSKA 4PL1A 3PZPA 3SI8A 3IHQB 4O68A 1DXSA 4JWMA 3AL0B 2CXYA 1ZQRA 2VA2A 2MRLA 4FS2A 2C2EA 3MFHA 7ICKA 2JHDA 3G6YA 9ICBA 4UASA 3G6XA 2KIWA 2HVHA 3RJJA 1MIYA 4DLEA 1BPZA 2DR5A 2KFZA 2H3VA 4Y2XA 2P66A 1XNSA 5HRHA 4JB3A 1F5AA 5AM5A 1X42A 5DDYA 4X0BA 5ALVA 1A0PA 2ZH3A 1BNPA 3L5KA 2LBOA 1JI7A 2LI6A 4DLGA 5CA7A 5DQIA 4K8VA 1Q3UA 4IQWA 3CP8A 3JPNA 3FDSA 2EAPA 3T5HA 5DBCA 2IHMA 1B22A 1Z00A 5J2KA 5EE0A 9ICCA 3Q8RB 2N1RA 5AM1A 3KTQA 3E0FA 4K9BA 2EZYA 4WQKA 5EE9A 2DBYA 3BQ2A 2E1EA 3NVVA 3GIMA 4O67A 2ZH5A 3AU6A 2HHUA 2HHWA 2W9MA 2JGAA 5J2BA 1N63A 2Y9TA 4M6WB 1U47A 2ISOA 3RF9A 4NKTA 4WCWA 2K8BB 2XI9A 1CI4A 4NL9C 2RHFA 7ICQA 3ZD9A 1SGGA 2OYYA 1BVSA 1UQVA 4F3OA 4UAUA 4K4GA 4RT3A 3C18A 3BS7A 1XSPA 1DK2A 2DGZA 4JV1A 4JV0A 1EXNA 4RWNA 4X4VA 2W03A 2RFFA 3A0HU 2F44A 4PGQA 3C28A 2HHSA 1F5SA 1S0OA 4DL2A 4KLQA 2F1JA 3PW5A 4EZ9A 3AUOA 1PK1B 1RDFA 4X4SA 5HRLA 3AQFA 3NKUA 4I2IA 1RYUA 2Y1IA 2BPGA 2YX8A 4CF3A 3PSPA 5B3QA 4LT6A 3G6VA 3GZFA 4F8RA 5ALXA 2RQ5A 1FFUA 4QW9A 3UQ2A 4I2CA 5H2FU 8ICMA 3PX6A 2EANA 1V85A 5GTIU 3SV3A 1WCLA 3CW2C 4ED7A 3IN5A 4DS4A 1JQRA 5KFLA 4G9BA 2KG5A 2ZH1A 2PMZC 4NLBA 3PNCA 1C7YA 5AKHA 2FDRA 4CGZA 4O69A 3ICXA 4GXIA 4UAWA 9ICJA 3TI0A 3I1YA 1L7NA 4RNNA 3KHLA 5HRGA 4NXUA 3A0BU 4TUPA 5L9XA 4NJ8A 4RWOA 2HHPA 4ECXA 4FHWA 3F5AA 3BQTA 3NRZA 4X4OA 4WJ3B 4QW8A 3WKBA 2M2TA 2MSNA 1UETA 3H7IA 3PW7A 1ZQPA 4P0QA 4MF8A 3JPSA 4JLZA 3K7DA 4YQWA 2UVWA 1UHUA 4F93B 1SXEA 4QZ8A 4I28A 1O08A 5CFTA 4DFMA 8ICWA 3WKCA 5HRIA 4EYHB 1ZOLA 2DKXA 2KN7A 2AGQA 4YVZA 1WOTA 2W55A 5KFRA 2Q0ZX 3ED5A 3I28A 4BGDA 3HP6A 4YR3A 5KT4A 1KRPA 9ICGA 2R8HA 4K98A 4PZOA 2DR9A 2AGOA 4IL6U 1L7MA 5ALMA 4RQ3A 5HR9A 1NKEA 2BBJA 5C0YA 5AKXA 2IHNA 4JK1A 4I2HA 1L3SA 2ZTDA 7ICNA 3WK9A 4J9LA 4E8FA 2FE9A 5ALHA 3WFRE 1IIPA 4E7XA 3LWLA 3RB0A 2J6TA 4RQ5A 1Z4OA 4Q45A 4YMMA 3QEAZ 4IC9A 3JYYA 4Q8FA 5B3PA 3C66A 2G5IB 2ZHAA 2QB0A 2ZH8A 1JALA 3MDAA 3MABA 1SKWA 1IV8A 2ZJ5A 3IDWA 1KQQA 3LVWA 5DEDA 1Q3VA 4RQ1A 3FM9A 2BPFA 4YD2A 2H3FA 1ZQKA 3RJIA 3SENA 2W9CB 5BPCA 2BCVA 5JTIA 1TKDA 5KT6A 4R8UA 1Q46A 1M6YA 3QNMA 1MC8A 5IIOA 3D2QA 2P35A 2K4IA 4ECYA 4WC0A 2DUYA 3H0MB 4HX0A 5HR7A 4WBYA 3H8SA 4C8LA 2KJ9A 4U7CA 1ZQNA 4DFPA 2HCFA 3UMCA 4IS7A 1PVPA 1X6JA 2GA9D 5KTQA 4UAVA 4KLTA 2KVCA 2P6RA 2FLNA 2JH1A 4KLEA 1N61A 4BJQA 2GAFD 4B9LA 4O0IA 2PFQA 4ECWA 2E8PA 2ZG6A 3DV9A 5DBAA 2EAOA 5DG8A 1ZYQA 5KG7A 1N48A 2ZJ8A 4GXJA 4NV0A 2G0AA 3SQIA 8ICSA 2B0CA 2D6FC 5KAFU 3UXOA 5AKYA 5ALLA 3ORYA 4QWDA 4NLCA 5DLFA 1MQ3A 1NK9A 2ES6A 2HVIA 4BWJA 4F91B 3B0XA 5KT5A 1NNLA 5K4LA 2FPLA 2VJ5A 3UPQA 2W9AA 1S8OA 4N7RA 8ICEA 4KMOB 2IOFK 3EW9A 4RQ4A 3AQEA 1L7PA 2OCEA 8ICOA 2F3NA 5AK4A 4AYBC 1LKYA 3C5GA 4QNLA 4CNQA 3RR8A 3HJ1A 4DSIA 9ICAA 4M2YA 2V9WA 3AEVA 2M0NA 7ICOA 3RR7A 3E58A 4KMUA 2FMSA 3NUQA 5KFJA 1ZQVA 4P0PB 1N56A 2JEFA 8ICFA 4RT2A 9ICKA 5AKIA 4UARA 4JUZA 4J9OA 3KOOA 5J0XA 3PX0A 1L8OA 4F71A 1B4FA 2AHOB 7ICPA 4QWCA 4K4IA 2H5XA 5ALGA 5L1IA 2G09A 3M8SA 4DWIA 5IIIA 1ZD4A 3AM9A 2AH5A 3PO5A 3SAFA 1SWVA 2DL0A 2B56A 1SV0A 4QWAA 1SZPA 2FJ6A 4OJ6A 4O3QA 1ZQHA 3UXNA 1D8LA 3V7KA 2CN1A 2EWRA 3CNHA 3D2NA 5E79U 4AT7A 3QU7A 2FI1A 2YN4A 4HAIA 4P4MA 3L4PA 5L1MA 3RH5A 2KVSA 1L3TA 4NM2A 4QJFB 4O5CA 1T4GA 2VA8A 3WFPA 2AJQA 3UMBA 5AI9A 4C8NA 5HRKA 1B43A 2ZUCA 4RUCA 1KN5A 3KD3A 4XUSA 5BOMA 4F5NA 1TAMA 3C2LA 9ICFA 1Z00B 3JCFA 4OJLA 2KOBA 4KLDA 2DR8A 4M47A 4X4RA 3Q8QB 3FAHA 1S0NA 1S97A 5J2GA 1ZQOA 1V97A 4FH3A 3BS5B 3FYHA 1NOMA 2I6XA 5HRBA 1Z19A 2YMLA 2KK0A 3K1ZA 4DSFA 3BQ1A 2I5HA 4UB4A 2KZMA 2XCPA 1D8YA 4PL2A 2FLLA 4KLHA 4OCZA 3BQ0A 1AROP 3ONNA 2ASLA 7ICVA 3EWAA 4DFDA 5AIAA 3WFQE 3KKAC 4O3OA 5KFMA 3UMGA 4J9KA 2UVVA 4Y2YA 3DEEA 5DGBA 2OHFA 4QWBA 2M2VA 3GV5B 4NLGA 2PXIA 2ZIXA 2W7OA 4R64A 5IIMA 2B4VA 5KFBA 3OUYA 4FE3A 1SV0C 4IRDA 3ERCC 3B0YA 2K8AA 2D8CA 4DFJA 4UD5A 2LM1A 4FO6A 3GFKB 4EBCA 5IINA 1ZQMA 9ICOA 3D2SA 1SXDA 5CFSA 1ZQWA 1T8EA 2QARA 1SL1A 3SV4A 4K9AA 3B9JA 4F5QA 5JTGA 3GIKA 3TARA 2KSOA 3ZDEA 5HC9A 2DWQA 5AM2A 2V4QA 3NVZA 3RRHA 2PBEA 2CRXA 1HUOA 2WB1F 5L1JA 3M6ZA 3RJEA 5F2VO 3WK8A 2E3TA 2KEYA 5KFTA 5ALOA 1UT5A 7ICIA 3OVSA 2YMMA 5FP0A 1T7PA 2A1JA 3OVBA 3HJEA 5AI0A 5AICA 3GV7B 2E5SA 4DL6A 3TAPA 3C29A 4MFCA 8ICYA 4ECTA 2VKQA 2ZUDA 3NRWA 3H4DA 4M5DA 1TAUA 1QSLA 1ZQ1C 4P0QB 4NLZA 2EQYA 3QYPA 3SAHA 5HHHA 4O5KA 1JMSA 2Y1JA 5KFAA 5AM4A 3M9OB 2HBLA 2ISPA 1RM6C 3PO4A 1ZQQA 4GC6A 9ICNA 3H8MA 3RJKA 2YY6A 9ICSA 2ZH4A 3RB6A 8ICJA 1JXEA 3UPSA 4RNMA 9ICHA 4R66A 4C4RA 3GDXA 3RAXA 1DK3A 3IM1A 2Y9UA 2MA1A 2AQ4A 4I2JA 1MQ2A 3PR5B 5KNIA 4M9LA 3N4MB 5KG2A 5F9LA 4FZLA 3KZXA 4OD0A 4P4OA 5AM3A 4DQQA 2W9BA 4ECUA 4GXKA 4JWNA 2BBHA 1GPJA 4EV6A 4QWEA 2HBJA 2YB4A 3AU2A 4NKUA 2ASDA 1HUZA 1UCVA 3HILA 3TADC 4RQ2A 2D3DA 1N60A 3T3FA 4JLXA 2Y0SC 4Y2TA 4PHEA 1TVAA 4BDPA 3PY8A 4DSLA 4DF8A 2A19A 1BPXA 5ALZA 2LPEA 4E0DA 1R8BA 2MUTA 5J8YA 3HPOA 2KHVA 2QB0B 2K89A 1CEZA 5F9NA 4C4SA 4NWIA 2EZZA 4F50A 5HP4A 1FFVA 4PHPA 5B66U 4DQPA 2NRZA 4YMNA 5DQHA 4IRKA 5J0UA 1KSPA 3QEBZ 1X40A 3M9MB 2K8CB 2KNJA 4DOBA 4R8UB 2WAQF 1C20A 2WHEA 3ZDDA 1KL9A 5BOLA 3MCRA 4RU9A 4I29A 2R8KA 2JZBA 2XICA 5AM0A 3HKZC 1XSLA 4O9MA 4J9SA 5CWRA 1FIQA 4KB6A 4J9MA 4TUQA 1LB2B 3H38A 4RNOA 5J2EA 3MGVA 4ZOHC 3TFRA 4QZ9A 5DQGA 4NXWA 3CYMA 2VJ4A 4DQRA 4USAA 4B9TA 5KG5A 2ZIUB 1SWWA 1Z3EB 2MU2A 5DDMA 5CEHA 1HEKA 5DBBA 2JEJA 3BJYA 3C5FA 2XGQA 4R65A 1ZQXA 1Z1BA 2KIVA 2M2WA 5KFYA 2PKEA 2YMPA 4PGXA 3TACB 5KFNA 4QZHA 5F3XB 3NTUA 2G07A 3NVWA 2FMPA 4RQ0A 1DGJA 4DO9A 3BDPA 2PMZF 1TK8A 5HREA 2DVIA 5KL1B 4PGYA 3RH6A 4NXZA 3UQ0A 3EF2A 5ALPA 4FZMA 4QZCA 1UEUA 4OAIZ 1Q79A 4WQLA 1XC9A 3AN1A 1LKYB 5HR6A 5CHEA 5DB7A 2NO5A 3GIIA 3ZDCA 4MEYA 4ELTA 2ZH7A 1PX5A 3V7LA 3UXPA 1VJ7A 3AQLA 4KM5A 4DL3A 1QSYA 1WWVA 3AQKA 1KLNA 3Q8LA 1QLNA 4YR2A 4KX3A 1X2IA 2ZIVA 4C8KA 4X4TA 4ATBA 3L9DA 1R8AA 4BXOA 1ZQIA 4UW9A 1FO4A 3MGIA 3OSNA 1ZQCA 2PI4A 1COKA 3QU2A 1WUDA 1KTQA 5EWGA 3HJ4A 2HN1A 3ZDAA 4FHPA 4IR1A 4FO1A 4YD1A 2HN2A 1YT3A 4DS5A 5AHXA 2GOLA 2H3ZA 4EP7A 3JPPA 1QQ7A 1F0MA 4UB2A 3RRGA 4EELA 3IG5A 3Q8MA 4UB1A 4F4KA 5KFPA 4J9QA 3HRDD 4Q44A 1TFRA 2G5HB 2BCRA 5ALQA 3FC4A 3JZ0A 4AT7B 1FEZA 4UATA 4RZRA 2IA6A 4KLOA 2VANA 4ECVA 2ZTEA 5DECA 5ALSA 3TQ1A 1KKXA 3N7SC 4MEXA 2LHTA 3BQ7A 4YCXA 8ICVA 4EBKA 3QUQA 4DOCA 3UM9A 5KT3A 4J9NA 1S5LU 4OJOA 4M9JA 4LEWA 2PI5A 5D4BA 4O3PA 1S76D 2HHVA 2BCSA 4WC3A 1X66A 4ECZA 5KG0A 5KFUA 3HT3A 1RPLA 3C21A 4M9NA 3ETLA 3SZ2A 9ICLA 4B9VA 5DB6A 1WWUA 3PMLA 4Q43A 2W43A 8ICHA 1A6SA 4Y2QA 1KBUA 2JEIA 2BGWA 3QUCA 3H8JA 4UAZA 7ICFA 2UVRA 5DGAA 3S6JA 3PR4A 4P2HA 4U6PA 3WU2U 1PK1A 4EEBA 1TE2A 5EE3A 1ZQEA 4DSJA 2L5YA 2FLPA 4XRHA 4FH5A 2JV3A 5ALKA 5HHIA 2ZIXB 1RZTA 4UAYA 1NI3A 4MFAA 1LVHA 2DR7A 1KDHA 1ED1A 1X9WA 8ICQA 5AI4A 2XY6A 4QZEA 1DOQA 2V4RA 3RAQA 4OAFA 4AP9A 3WK6A 7ICTA 3C1ZA 3IG8A 2W3SA 4X4QA 1TV9A 4KLUA 2P6UA 4ECRA 3E2EA 3QE9Y 1AQ6A 2IBKA 4F4WA 3EUB2 3WFOA 1UPHA 1QQ6A 1OUQA 1R89A 1L5UA 5D61A 1ZQJA 5KFXA 1D8BA 2KP7A 4F4XA
chains in the Genus database with same CATH topology
2ZH9A 4YXJA 3GIMA 3GV5B 4NLGA 3LK9A 3AQMA 1T3NA 5JUMA 2PXIA 7ICEA 5KFIA 4R64A 2FMQA 5J2IA 5IIMA 4JV2A 7ICJA 2ZH5A 3AU6A 5KFBA 1BPDA 2HHUA 4IR9A 3OUYA 3C1YA 2W9MA 1D9DA 2HHWA 2ZH2A 5J2BA 1U47A 4M6WB 2BQRA 3RBEA 2ISOA 1A77A 5J0PA 4IRDA 1S0VA 4NKTA 4WCWA 4ECQA 3H37A 3H8WA 2VA3A 3GIJA 5KFQA 3B0YA 1NK5A 1RYRA 4DL5A 2PFPA 4Z6EA 4F2RA 7ICQA 5KFZA 4UD5A 4DFJA 4NM1A 9ICIA 3ZD9A 1UEVA 1U49A 1DGSA 1OU5A 3HIYA 4DQSA 4RQ7A 4IQUA 1XS9D 4I2FA 3C2MA 4FO6A 3GFKB 4KLIA 1BVSA 4EBCA 4QZGA 4XA5A 5IINA 4LZGA 1MSWD 3GQCA 4DEZA 1ZQMA 4F3OA 9ICOA 4K4GA 2C22A 4RT3A 9ICQA 3K4GA 3C18A 4UB5A 2UVUA 1ZQWA 4KLMA 1XSPA 3ISDA 4ED6A 1T8EA 5J0RA 1D9FA 5KFHA 1DK2A 1U48A 1SL1A 4TQSA 3SV4A 1SL0A 4JV1A 4JV0A 1EXNA 3TANA 4RWNA 2BE3A 4X4VA 2RFFA 4F5QA 3GIKA 4AT8B 1YLQA 3TARA 2ZHBA 5CJ7A 3ZDEA 4M6WA 5HC9A 1ZJNA 4RPZA 5J0QA 4PGQA 4ED2A 2V4QA 3OHAA 4B9SA 3RRHA 2PBEA 2HHSA 1S0OA 4DL2A 4KLQA 4RPXA 2F1JA 1HUOA 5L1JA 2PFOA 3PW5A 4EZ9A 3AUOA 5KFKA 4G3IA 4WC7A 3RJEA 5F2VO 4M9HA 4X4PA 4DSEA 2LYHA 4X4SA 1UA1A 4PH5A 5KFTA 2FPKA 5CR0A 2XC9A 3MFIA 2DFLA 2HW3A 5HRLA 1UT5A 2XGPA 4ED0A 7ICIA 3OVSA 3T5LA 4I2IA 2Y1IA 2BPGA 4ELVA 1T7PA 2A1JA 8ICBA 3OVBA 2W8LA 3QZ7A 4LT6A 3GV7B 5J0SA 3G6VA 2KZZA 1V4AA 4DL6A 3N97B 5J2CA 4F8RA 1ZQLA 9ICVA 3TAPA 1JAJA 4QW9A 4KLSA 4AT8A 1IXRA 3UQ2A 4I2CA 4MFCA 8ICYA 8ICMA 7ICLA 4ECTA 2ZUDA 4KN4A 3PX6A 1QSSA 5J2HA 1U45A 3H4DA 1WCNA 1TAUA 4M5DA 1S10A 3SV3A 1QSLA 1WCLA 3LQCB 4DFKA 4ED7A 2W9BB 4DS4A 1JQRA 1BNOA 4NLZA 5KFLA 1ZQAA 5HHHA 4O5KA 2ZH1A 1JMSA 2Y1JA 4PPXA 5KFAA 3PNCA 4J9RA 1ZQSA 1C7YA 3M9OB 9ICMA 3M8RA 2ISPA 3PO4A 4F4ZA 1ZQQA 4GC6A 1H38A 4B9MA 8ICKA 4QZFA 4GXIA 9ICNA 2ID1A 3RJKA 9ICSA 2BHNA 2B21A 4UAWA 3TI0A 2I9GA 5KFCA 3RB6A 4KITB 1JXEA 8ICJA 2ZH4A 4RNNA 3KHLA 4RNMA 9ICHA 1ZQUA 4R66A 5HRGA 3UPSA 4WC6A 4TUPA 2W9CA 2NRKA 2BCUA 4RQ6A 4WC5A 4FBUA 5L9XA 1R8CA 1U9LA 1NO5A 3GDXA 4RWOA 1COOA 3RAXA 4ECXA 2HHPA 3OUYB 1DK3A 4K4HA 1ZQGA 2J6UA 3IM1A 4ED1A 4FHWA 3BQTA 3KHGA 4DL7A 2BCQA 4X4OA 2AQ4A 4QW8A 4I2JA 1MQ2A 3SYZA 2M2TA 1XWLA 3PR5B 5D46A 3PW0A 1NJYA 1SL2A 3H7IA 1UETA 2MUTB 3OV7A 4M9LA 3PW7A 5KG2A 5F9LA 3N4MB 4DQQA 1ZQPA 4P4OA 4MF8A 4I27A 3QZ8A 3JPSA 2W9BA 4ECUA 4GXKA 2KZ3A 4YQWA 4FS1A 4JWNA 4FHYA 4BWMA 1KFTA 4RWPA 4YMOA 2UVWA 4X0AA 4IG8A 4QWEA 1K1SA 5DB9A 3AU2A 4DOAA 4F93B 2ASDA 4NKUA 1HUZA 4QZ8A 4I28A 9ICPA 4Z6CA 3T5JA 2ATLA 4DFMA 8ICWA 4LZDA 3GILA 5HRIA 4RQ2A 1ZQYA 4EYHB 3GV8B 3MR5A 3T3FA 2KN7A 2AGQA 3ZD8A 3MR3A 4YVZA 4PHEA 5CHGA 4FHVA 3MDCA 1WOTA 1TVAA 1Y88A 5DKWA 4BDPA 3PY8A 4DSLA 3T5KA 4DF8A 1MIVA 2JZBB 1BPXA 4E0DA 7ICSA 5HRFA 3RJGA 5KFEA 8ICLA 1JX4A 7ICOA 1R8BA 2MUTA 5KFRA 3HPOA 2Q0ZX 4HYKA 5KG3A 3TAQA 4BGDA 4UD4A 4WC1A 3HP6A 4YR3A 5KT4A 1JIHA 2BPCA 1KRPA 4I2DA 4XQ8A 2R8HA 1HJPA 5F9NA 3OSPA 1X9SA 1CEZA 5KFWA 2DR9A 1KNYA 2AGOA 4M04A 4KLLA 1X9MA 1SKSA 5HR9A 4RQ3A 3HX0A 2KFNA 1NKEA 2ZTCA 2F1HA 4TQRA 1ZQBA 4F50A 4I2AA 3Q8PB 5HP4A 3LWMA 3PW4A 2IHNA 4JK1A 4I2HA 4Z6DA 4PHPA 4UQGA 1L3SA 5L1LA 2ZTDA 2NRZA 1BPYA 4YMNA 3RJFA 1ZQFA 5DQHA 3HW8A 4J9LA 7ICNA 4E8FA 4IRKA 2A1JB 4EZ6A 5J0UA 3WFRE 1KSPA 5IIJA 3QEBZ 3M9MB 4E7XA 4QZDA 3LWLA 4DOBA 3RB0A 4R8UB 3KHHA 8ICZA 2J6TA 4RQ5A 3ZDDA 5BOLA 4Q45A 4RU9A 4EBDA 4YMMA 8ICAA 3QEAZ 5KFDA 2R8KA 2ALZA 4I29A 7ICHA 9ICTA 3THVA 2JZBA 3JYYA 4Q8FA 4XQ7A 3MBYA 1XSLA 4O9MA 4J9SA 5CWRA 3C66A 3PX4A 4WBZA 2ZHAA 3WFSC 4F2SA 2ZH8A 2XO7A 3MDAA 3MABA 2DRAA 1SKWA 4J9MA 2J6SA 2ZJ5A 4GC7A 4TUQA 1LB2B 1KEJA 5DEDA 2AQ0A 5DGBA 4RNOA 3JPTA 5J2EA 4RQ1A 3RB3A 4YN4A 3H38A 1A76A 2FPMA 4TUSA 3TFRA 4P4PA 1ZQTA 2BPFA 4YD2A 7ICKA 4QZ9A 3OGUA 1TK5A 5DQGA 4F5RA 1ZQKA 9ICEA 4DQIA 2DPIA 3RJIA 4MFFA 4DQRA 5DLGA 5J29A 2W9CB 4B9TA 5KG5A 4PHDA 9ICJA 3NGDA 5BPCA 1Z3EB 1S77D 2BCVA 5DDMA 4J9PA 5HNKA 1TKDA 3M9NB 1S0MA 5KT6A 5KFFA 4R8UA 5DBBA 1U4BA 1NJWA 4ED8A 2JEJA 3BJYA 3K75D 2NRTA 3C5FA 4PHAA 2XGQA 1TFWA 3V6JA 1MC8A 2ASJA 1RYSA 4R65A 1ZQXA 5IIOA 3H39A 4QZBA 3MGHA 1UT8A 3JPQA 9ICRA 2M2WA 5KFYA 4UBCA 2BKEA 4ECYA 4PGXA 5KFNA 1LV5A 2HHTA 4QZHA 4WC0A 3PW2A 4WBYA 3H8SA 4F5PA 2BR0A 3NTUA 4C8LA 4DQPA 5J0WA 5J0YA 2C2DA 5KT2A 2FMPA 4RQ0A 1ZQNA 3OJUA 4DFPA 2C2RA 4DO9A 3Q8KA 2IMWP 1ZETA 3BDPA 1TFYA 1NKBA 1TK8A 1VFGA 5KTQA 4KLTA 3H40A 2NRWA 3RJHA 2P6RA 9ICXA 5HREA 8ICRA 2FLNA 2DVIA 4PGYA 3KHRA 3RH6A 4NXZA 3UQ0A 4KLEA 4ATBB 4E80A 1ZJMA 3NYBA 2NRXA 4BXOB 4NY8A 1NK6A 4O0IA 4B9LA 2PFQA 1Q78A 4O5EA 4ECWA 4NLNA 4EBJA 4I2GA 1NK4A 4QZCA 1UEUA 5DBAA 3PV8A 4LVSA 5DG8A 2ZJAA 5KG7A 1ZYQA 1XC9A 1Q79A 1JXLA 5DB8A 1BPEA 1N48A 2ZJ8A 4Z6FA 4GXJA 8ICSA 5DB7A 3EPIA 5J2DA 4TURA 3GIIA 3OHBA 1NK7A 3UXOA 4QZAA 4MEYA 2WTFA 3ZDCA 4ELTA 5CB1A 2ZH7A 1PX5A 3V7LA 4EYIB 3UXPA 1VJ7A 3ORYA 3AQLA 4DL3A 4QWDA 4O3RA 4Q8EA 1JN3A 4R63A 5DLFA 1MQ3A 1NK9A 2BDPA 4M0AA 4MF2A 1QSYA 2HVIA 4KTQA 4RWQA 2DRBA 3AQKA 4BWJA 5KFVA 1S9FA 1KLNA 4UB3A 3Q8LA 4F91B 3B0XA 1QLNA 9ICGA 5KT5A 8ICNA 4YR2A 2FPLA 2PFNA 5KT7A 2R8IA 4ED3A 4NLKA 1X2IA 2R8GA 3UPQA 4ELUA 2W9AA 3LDAA 4C8KA 8ICEA 4ATBA 1V9PA 5IILA 4X4TA 3C2KA 1R8AA 3RB4A 3L9DA 3JPOA 2XY5A 5C5JA 3EW9A 4F92B 4RQ4A 4GLXA 2AGPA 1ZQIA 4BXOA 3EYZA 2XCAA 3MGIA 3OSNA 2C28A 1ZQCA 2PI4A 2KTQA 8ICOA 1KTQA 3ISBA 5EWGA 4EEYA 3HJ4A 2RDJA 4AT9B 3C5GA 4C8OA 3ZDAA 4KLFA 4FHPA 1BGXT 4IR1A 4YD1A 5J0OA 4F5OA 5DG9A 4IQTA 4RPYA 4KN7A 5KG4A 4DS5A 5EOZA 5HMLA 4I2EA 5HRDA 5EWEA 1RXWA 8ICCA 9ICUA 3PMNA 3RR8A 2OWOA 3HJ1A 4DSIA 9ICAA 4M2YA 1BPBA 2V9WA 4EP7A 3JPPA 4UB2A 3RR7A 3JPRA 2I1QA 2JEGA 4QZIA 4KMUA 3RRGA 2FMSA 3Q8MA 8ICGA 8ICIA 5KFJA 4UB1A 5EWFA 3PVXA 4F4KA 1ZQVA 5KFPA 3V72A 4J9QA 1N56A 2JEFA 4Q44A 8ICFA 4WC2A 9ICBA 5J2FA 4RT2A 1UA0A 1TFRA 3EPGA 9ICKA 4I2BA 5L1KA 4JUZA 2BCRA 4J9OA 4DL4A 3PX0A 5J0XA 2R8JA 1RXVA 3ZDBA 3JZ0A 4AT7B 3RBDA 3RH4A 7ICUA 4RZRA 2IA6A 3TFSA 4M9GA 2F1IA 7ICPA 4QWCA 4KLOA 2VANA 5TZVA 4K4IA 2H5XA 1NJZA 1NK8A 4ECVA 2ZTEA 4YFKA 4AT9A 3MR6A 5L1IA 5DECA 8ICXA 5J2AA 5IIKA 3TQ1A 1NK0A 5KFSA 2NRVA 3M8SA 4MEXA 5KG1A 5IIIA 1XSNA 4YCXA 4B9NA 4DWIA 8ICVA 2M2UA 2M9NA 2O1PA 4EBKA 5KFGA 8ICPA 8ICUA 4S3NA 4DOCA 3PO5A 1NKCA 5KT3A 2GWSA 4KLJA 4J9NA 5HMMA 4M9JA 4X5VA 2O5AA 7ICRA 3OVAA 2ZUBA 4QWAA 1SZPA 4FBTA 4ECSA 1ZQDA 2BQ3A 5D4BA 4O3PA 2PI5A 1S76D 2HHVA 2BCSA 4O3QA 5KG6A 4WC3A 1ZQHA 4ECZA 2XY7A 2BQUA 3UXNA 1D8LA 5KG0A 4C8MA 4CCHA 3V7KA 5DG7A 1KFSA 5KFUA 3HT3A 4YP3A 1QTMA 1RPLA 7ICMA 2Q66A 4AT7A 4X4NA 2AU0A 3C21A 3EZ5A 4M9NA 5CP2A 5J2JA 5D49A 1XU4A 1FA0A 3ETLA 4X4UA 3SZ2A 4O3NA 4P4MA 4EBEA 3RH5A 4YR0A 4UBBA 3HWTA 9ICLA 4YG2A 3Q8SB 1ZQZA 1L3TA 4NM2A 4B9VA 5DB6A 3PMLA 3V7JA 7ICGA 4Q43A 5J0TA 2W8KA 1CUKA 3ISCA 4B9UA 4DSKA 4O5CA 1T4GA 2VA8A 8ICHA 3H3AA 2AJQA 3WFPA 3SI8A 3IHQB 2DPJA 8ICTA 4C8NA 5HRKA 2JEIA 4JWMA 1B43A 2ZUCA 4RUCA 1ZQRA 2BGWA 3H8JA 3V6HA 1SKRA 4XUSA 5BOMA 4FS2A 2VA2A 4FHXA 2C2EA 4F5NA 4UAZA 7ICFA 3MFHA 2UVRA 5DGAA 3G6YA 3MR2A 1NJXA 4IRCA 5KFOA 3G6XA 3C2LA 4KLGA 2HHQA 9ICFA 1Z00B 4YXMA 3PR4A 3C23A 2HVHA 3RJJA 4P2HA 3RTVA 4KLDA 4DLEA 1BPZA 3H4BA 1MIYA 2KFZA 2DR5A 9ICWA 2DR8A 2P66A 4M47A 5HRHA 4X4RA 3Q8QB 1NZPA 4RQ8A 1KFDA 1S0NA 1ZQEA 1S97A 4IQVA 3V6KA 5J2GA 4DSJA 1F5AA 1ZQOA 2FLPA 5DDYA 4XRHA 4FH5A 4FH3A 4X0BA 2ZH3A 1BNPA 3FYHA 5HHIA 1NOMA 1RZTA 4UAYA 4MFAA 1MIWA 5HRBA 1PZNA 2DR7A 1KDHA 1K1QA 4DSFA 2MAXA 1X9WA 2HHXA 3BQ1A 1XO1A 4UB4A 4F4YA 4DLGA 2XCPA 5CA7A 5DQIA 2KZMA 8ICQA 2RDIA 1D8YA 2XY6A 1TK0A 4QZEA 2FLLA 1DOQA 2V4RA 3RAQA 4IQWA 4KLHA 4ZH4A 4O3SA 1TAQA 3BQ0A 3JPNA 3FDSA 1AROP 3T5HA 7ICTA 3C1ZA 5DBCA 2IHMA 2ASLA 7ICVA 3EWAA 1B22A 4X4QA 1TV9A 4KLUA 3WFQE 1Z00A 2P6UA 4ECRA 3E2EA 4WC4A 3QE9Y 5J2KA 4O3OA 2IBKA 4F4WA 4DF4A 5KFMA 9ICCA 3WFOA 2ZH6A 3Q8RB 1R89A 1L5UA 3AQNA 4J9KA 1ZQJA 3KTQA 5KFXA 3OJSA 1L3UA 2UVVA 1IM4A 4F4XA 2KP7A 1L3VA 4RUAA 2M2VA 4QWBA 3BQ2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZH9 A;  4YXJ A;  3GIM A;  3GV5 B;  4NLG A;  3LK9 A;  3AQM A;  1T3N A;  5JUM A;  2PXI A;  7ICE A;  5KFI A;  4R64 A;  2FMQ A;  5J2I A;  5IIM A;  4JV2 A;  7ICJ A;  2ZH5 A;  3AU6 A;  5KFB A;  1BPD A;  2HHU A;  4IR9 A;  3OUY A;  3C1Y A;  2W9M A;  1D9D A;  2HHW A;  2ZH2 A;  5J2B A;  1U47 A;  4M6W B;  2BQR A;  3RBE A;  2ISO A;  1A77 A;  5J0P A;  4IRD A;  1S0V A;  4NKT A;  4WCW A;  4ECQ A;  3H37 A;  3H8W A;  2VA3 A;  3GIJ A;  5KFQ A;  3B0Y A;  1NK5 A;  1RYR A;  4DL5 A;  2PFP A;  4Z6E A;  4F2R A;  7ICQ A;  5KFZ A;  4UD5 A;  4DFJ A;  4NM1 A;  9ICI A;  3ZD9 A;  1UEV A;  1U49 A;  1DGS A;  1OU5 A;  3HIY A;  4DQS A;  4RQ7 A;  4IQU A;  1XS9 D;  4I2F A;  3C2M A;  4FO6 A;  3GFK B;  4KLI A;  1BVS A;  4EBC A;  4QZG A;  4XA5 A;  5IIN A;  4LZG A;  1MSW D;  3GQC A;  4DEZ A;  1ZQM A;  4F3O A;  9ICO A;  4K4G A;  2C22 A;  4RT3 A;  9ICQ A;  3K4G A;  3C18 A;  4UB5 A;  2UVU A;  1ZQW A;  4KLM A;  1XSP A;  3ISD A;  4ED6 A;  1T8E A;  5J0R A;  1D9F A;  5KFH A;  1DK2 A;  1U48 A;  1SL1 A;  4TQS A;  3SV4 A;  1SL0 A;  4JV1 A;  4JV0 A;  1EXN A;  3TAN A;  4RWN A;  2BE3 A;  4X4V A;  2RFF A;  4F5Q A;  3GIK A;  4AT8 B;  1YLQ A;  3TAR A;  2ZHB A;  5CJ7 A;  3ZDE A;  4M6W A;  5HC9 A;  1ZJN A;  4RPZ A;  5J0Q A;  4PGQ A;  4ED2 A;  2V4Q A;  3OHA A;  4B9S A;  3RRH A;  2PBE A;  2HHS A;  1S0O A;  4DL2 A;  4KLQ A;  4RPX A;  2F1J A;  1HUO A;  5L1J A;  2PFO A;  3PW5 A;  4EZ9 A;  3AUO A;  5KFK A;  4G3I A;  4WC7 A;  3RJE A;  5F2V O;  4M9H A;  4X4P A;  4DSE A;  2LYH A;  4X4S A;  1UA1 A;  4PH5 A;  5KFT A;  2FPK A;  5CR0 A;  2XC9 A;  3MFI A;  2DFL A;  2HW3 A;  5HRL A;  1UT5 A;  2XGP A;  4ED0 A;  7ICI A;  3OVS A;  3T5L A;  4I2I A;  2Y1I A;  2BPG A;  4ELV A;  1T7P A;  2A1J A;  8ICB A;  3OVB A;  2W8L A;  3QZ7 A;  4LT6 A;  3GV7 B;  5J0S A;  3G6V A;  2KZZ A;  1V4A A;  4DL6 A;  3N97 B;  5J2C A;  4F8R A;  1ZQL A;  9ICV A;  3TAP A;  1JAJ A;  4QW9 A;  4KLS A;  4AT8 A;  1IXR A;  3UQ2 A;  4I2C A;  4MFC A;  8ICY A;  8ICM A;  7ICL A;  4ECT A;  2ZUD A;  4KN4 A;  3PX6 A;  1QSS A;  5J2H A;  1U45 A;  3H4D A;  1WCN A;  1TAU A;  4M5D A;  1S10 A;  3SV3 A;  1QSL A;  1WCL A;  3LQC B;  4DFK A;  4ED7 A;  2W9B B;  4DS4 A;  1JQR A;  1BNO A;  4NLZ A;  5KFL A;  1ZQA A;  5HHH A;  4O5K A;  2ZH1 A;  1JMS A;  2Y1J A;  4PPX A;  5KFA A;  3PNC A;  4J9R A;  1ZQS A;  1C7Y A;  3M9O B;  9ICM A;  3M8R A;  2ISP A;  3PO4 A;  4F4Z A;  1ZQQ A;  4GC6 A;  1H38 A;  4B9M A;  8ICK A;  4QZF A;  4GXI A;  9ICN A;  2ID1 A;  3RJK A;  9ICS A;  2BHN A;  2B21 A;  4UAW A;  3TI0 A;  2I9G A;  5KFC A;  3RB6 A;  4KIT B;  1JXE A;  8ICJ A;  2ZH4 A;  4RNN A;  3KHL A;  4RNM A;  9ICH A;  1ZQU A;  4R66 A;  5HRG A;  3UPS A;  4WC6 A;  4TUP A;  2W9C A;  2NRK A;  2BCU A;  4RQ6 A;  4WC5 A;  4FBU A;  5L9X A;  1R8C A;  1U9L A;  1NO5 A;  3GDX A;  4RWO A;  1COO A;  3RAX A;  4ECX A;  2HHP A;  3OUY B;  1DK3 A;  4K4H A;  1ZQG A;  2J6U A;  3IM1 A;  4ED1 A;  4FHW A;  3BQT A;  3KHG A;  4DL7 A;  2BCQ A;  4X4O A;  2AQ4 A;  4QW8 A;  4I2J A;  1MQ2 A;  3SYZ A;  2M2T A;  1XWL A;  3PR5 B;  5D46 A;  3PW0 A;  1NJY A;  1SL2 A;  3H7I A;  1UET A;  2MUT B;  3OV7 A;  4M9L A;  3PW7 A;  5KG2 A;  5F9L A;  3N4M B;  4DQQ A;  1ZQP A;  4P4O A;  4MF8 A;  4I27 A;  3QZ8 A;  3JPS A;  2W9B A;  4ECU A;  4GXK A;  2KZ3 A;  4YQW A;  4FS1 A;  4JWN A;  4FHY A;  4BWM A;  1KFT A;  4RWP A;  4YMO A;  2UVW A;  4X0A A;  4IG8 A;  4QWE A;  1K1S A;  5DB9 A;  3AU2 A;  4DOA A;  4F93 B;  2ASD A;  4NKU A;  1HUZ A;  4QZ8 A;  4I28 A;  9ICP A;  4Z6C A;  3T5J A;  2ATL A;  4DFM A;  8ICW A;  4LZD A;  3GIL A;  5HRI A;  4RQ2 A;  1ZQY A;  4EYH B;  3GV8 B;  3MR5 A;  3T3F A;  2KN7 A;  2AGQ A;  3ZD8 A;  3MR3 A;  4YVZ A;  4PHE A;  5CHG A;  4FHV A;  3MDC A;  1WOT A;  1TVA A;  1Y88 A;  5DKW A;  4BDP A;  3PY8 A;  4DSL A;  3T5K A;  4DF8 A;  1MIV A;  2JZB B;  1BPX A;  4E0D A;  7ICS A;  5HRF A;  3RJG A;  5KFE A;  8ICL A;  1JX4 A;  7ICO A;  1R8B A;  2MUT A;  5KFR A;  3HPO A;  2Q0Z X;  4HYK A;  5KG3 A;  3TAQ A;  4BGD A;  4UD4 A;  4WC1 A;  3HP6 A;  4YR3 A;  5KT4 A;  1JIH A;  2BPC A;  1KRP A;  4I2D A;  4XQ8 A;  2R8H A;  1HJP A;  5F9N A;  3OSP A;  1X9S A;  1CEZ A;  5KFW A;  2DR9 A;  1KNY A;  2AGO A;  4M04 A;  4KLL A;  1X9M A;  1SKS A;  5HR9 A;  4RQ3 A;  3HX0 A;  2KFN A;  1NKE A;  2ZTC A;  2F1H A;  4TQR A;  1ZQB A;  4F50 A;  4I2A A;  3Q8P B;  5HP4 A;  3LWM A;  3PW4 A;  2IHN A;  4JK1 A;  4I2H A;  4Z6D A;  4PHP A;  4UQG A;  1L3S A;  5L1L A;  2ZTD A;  2NRZ A;  1BPY A;  4YMN A;  3RJF A;  1ZQF A;  5DQH A;  3HW8 A;  4J9L A;  7ICN A;  4E8F A;  4IRK A;  2A1J B;  4EZ6 A;  5J0U A;  3WFR E;  1KSP A;  5IIJ A;  3QEB Z;  3M9M B;  4E7X A;  4QZD A;  3LWL A;  4DOB A;  3RB0 A;  4R8U B;  3KHH A;  8ICZ A;  2J6T A;  4RQ5 A;  3ZDD A;  5BOL A;  4Q45 A;  4RU9 A;  4EBD A;  4YMM A;  8ICA A;  3QEA Z;  5KFD A;  2R8K A;  2ALZ A;  4I29 A;  7ICH A;  9ICT A;  3THV A;  2JZB A;  3JYY A;  4Q8F A;  4XQ7 A;  3MBY A;  1XSL A;  4O9M A;  4J9S A;  5CWR A;  3C66 A;  3PX4 A;  4WBZ A;  2ZHA A;  3WFS C;  4F2S A;  2ZH8 A;  2XO7 A;  3MDA A;  3MAB A;  2DRA A;  1SKW A;  4J9M A;  2J6S A;  2ZJ5 A;  4GC7 A;  4TUQ A;  1LB2 B;  1KEJ A;  5DED A;  2AQ0 A;  5DGB A;  4RNO A;  3JPT A;  5J2E A;  4RQ1 A;  3RB3 A;  4YN4 A;  3H38 A;  1A76 A;  2FPM A;  4TUS A;  3TFR A;  4P4P A;  1ZQT A;  2BPF A;  4YD2 A;  7ICK A;  4QZ9 A;  3OGU A;  1TK5 A;  5DQG A;  4F5R A;  1ZQK A;  9ICE A;  4DQI A;  2DPI A;  3RJI A;  4MFF A;  4DQR A;  5DLG A;  5J29 A;  2W9C B;  4B9T A;  5KG5 A;  4PHD A;  9ICJ A;  3NGD A;  5BPC A;  1Z3E B;  1S77 D;  2BCV A;  5DDM A;  4J9P A;  5HNK A;  1TKD A;  3M9N B;  1S0M A;  5KT6 A;  5KFF A;  4R8U A;  5DBB A;  1U4B A;  1NJW A;  4ED8 A;  2JEJ A;  3BJY A;  3K75 D;  2NRT A;  3C5F A;  4PHA A;  2XGQ A;  1TFW A;  3V6J A;  1MC8 A;  2ASJ A;  1RYS A;  4R65 A;  1ZQX A;  5IIO A;  3H39 A;  4QZB A;  3MGH A;  1UT8 A;  3JPQ A;  9ICR A;  2M2W A;  5KFY A;  4UBC A;  2BKE A;  4ECY A;  4PGX A;  5KFN A;  1LV5 A;  2HHT A;  4QZH A;  4WC0 A;  3PW2 A;  4WBY A;  3H8S A;  4F5P A;  2BR0 A;  3NTU A;  4C8L A;  4DQP A;  5J0W A;  5J0Y A;  2C2D A;  5KT2 A;  2FMP A;  4RQ0 A;  1ZQN A;  3OJU A;  4DFP A;  2C2R A;  4DO9 A;  3Q8K A;  2IMW P;  1ZET A;  3BDP A;  1TFY A;  1NKB A;  1TK8 A;  1VFG A;  5KTQ A;  4KLT A;  3H40 A;  2NRW A;  3RJH A;  2P6R A;  9ICX A;  5HRE A;  8ICR A;  2FLN A;  2DVI A;  4PGY A;  3KHR A;  3RH6 A;  4NXZ A;  3UQ0 A;  4KLE A;  4ATB B;  4E80 A;  1ZJM A;  3NYB A;  2NRX A;  4BXO B;  4NY8 A;  1NK6 A;  4O0I A;  4B9L A;  2PFQ A;  1Q78 A;  4O5E A;  4ECW A;  4NLN A;  4EBJ A;  4I2G A;  1NK4 A;  4QZC A;  1UEU A;  5DBA A;  3PV8 A;  4LVS A;  5DG8 A;  2ZJA A;  5KG7 A;  1ZYQ A;  1XC9 A;  1Q79 A;  1JXL A;  5DB8 A;  1BPE A;  1N48 A;  2ZJ8 A;  4Z6F A;  4GXJ A;  8ICS A;  5DB7 A;  3EPI A;  5J2D A;  4TUR A;  3GII A;  3OHB A;  1NK7 A;  3UXO A;  4QZA A;  4MEY A;  2WTF A;  3ZDC A;  4ELT A;  5CB1 A;  2ZH7 A;  1PX5 A;  3V7L A;  4EYI B;  3UXP A;  1VJ7 A;  3ORY A;  3AQL A;  4DL3 A;  4QWD A;  4O3R A;  4Q8E A;  1JN3 A;  4R63 A;  5DLF A;  1MQ3 A;  1NK9 A;  2BDP A;  4M0A A;  4MF2 A;  1QSY A;  2HVI A;  4KTQ A;  4RWQ A;  2DRB A;  3AQK A;  4BWJ A;  5KFV A;  1S9F A;  1KLN A;  4UB3 A;  3Q8L A;  4F91 B;  3B0X A;  1QLN A;  9ICG A;  5KT5 A;  8ICN A;  4YR2 A;  2FPL A;  2PFN A;  5KT7 A;  2R8I A;  4ED3 A;  4NLK A;  1X2I A;  2R8G A;  3UPQ A;  4ELU A;  2W9A A;  3LDA A;  4C8K A;  8ICE A;  4ATB A;  1V9P A;  5IIL A;  4X4T A;  3C2K A;  1R8A A;  3RB4 A;  3L9D A;  3JPO A;  2XY5 A;  5C5J A;  3EW9 A;  4F92 B;  4RQ4 A;  4GLX A;  2AGP A;  1ZQI A;  4BXO A;  3EYZ A;  2XCA A;  3MGI A;  3OSN A;  2C28 A;  1ZQC A;  2PI4 A;  2KTQ A;  8ICO A;  1KTQ A;  3ISB A;  5EWG A;  4EEY A;  3HJ4 A;  2RDJ A;  4AT9 B;  3C5G A;  4C8O A;  3ZDA A;  4KLF A;  4FHP A;  1BGX T;  4IR1 A;  4YD1 A;  5J0O A;  4F5O A;  5DG9 A;  4IQT A;  4RPY A;  4KN7 A;  5KG4 A;  4DS5 A;  5EOZ A;  5HML A;  4I2E A;  5HRD A;  5EWE A;  1RXW A;  8ICC A;  9ICU A;  3PMN A;  3RR8 A;  2OWO A;  3HJ1 A;  4DSI A;  9ICA A;  4M2Y A;  1BPB A;  2V9W A;  4EP7 A;  3JPP A;  4UB2 A;  3RR7 A;  3JPR A;  2I1Q A;  2JEG A;  4QZI A;  4KMU A;  3RRG A;  2FMS A;  3Q8M A;  8ICG A;  8ICI A;  5KFJ A;  4UB1 A;  5EWF A;  3PVX A;  4F4K A;  1ZQV A;  5KFP A;  3V72 A;  4J9Q A;  1N56 A;  2JEF A;  4Q44 A;  8ICF A;  4WC2 A;  9ICB A;  5J2F A;  4RT2 A;  1UA0 A;  1TFR A;  3EPG A;  9ICK A;  4I2B A;  5L1K A;  4JUZ A;  2BCR A;  4J9O A;  4DL4 A;  3PX0 A;  5J0X A;  2R8J A;  1RXV A;  3ZDB A;  3JZ0 A;  4AT7 B;  3RBD A;  3RH4 A;  7ICU A;  4RZR A;  2IA6 A;  3TFS A;  4M9G A;  2F1I A;  7ICP A;  4QWC A;  4KLO A;  2VAN A;  5TZV A;  4K4I A;  2H5X A;  1NJZ A;  1NK8 A;  4ECV A;  2ZTE A;  4YFK A;  4AT9 A;  3MR6 A;  5L1I A;  5DEC A;  8ICX A;  5J2A A;  5IIK A;  3TQ1 A;  1NK0 A;  5KFS A;  2NRV A;  3M8S A;  4MEX A;  5KG1 A;  5III A;  1XSN A;  4YCX A;  4B9N A;  4DWI A;  8ICV A;  2M2U A;  2M9N A;  2O1P A;  4EBK A;  5KFG A;  8ICP A;  8ICU A;  4S3N A;  4DOC A;  3PO5 A;  1NKC A;  5KT3 A;  2GWS A;  4KLJ A;  4J9N A;  5HMM A;  4M9J A;  4X5V A;  2O5A A;  7ICR A;  3OVA A;  2ZUB A;  4QWA A;  1SZP A;  4FBT A;  4ECS A;  1ZQD A;  2BQ3 A;  5D4B A;  4O3P A;  2PI5 A;  1S76 D;  2HHV A;  2BCS A;  4O3Q A;  5KG6 A;  4WC3 A;  1ZQH A;  4ECZ A;  2XY7 A;  2BQU A;  3UXN A;  1D8L A;  5KG0 A;  4C8M A;  4CCH A;  3V7K A;  5DG7 A;  1KFS A;  5KFU A;  3HT3 A;  4YP3 A;  1QTM A;  1RPL A;  7ICM A;  2Q66 A;  4AT7 A;  4X4N A;  2AU0 A;  3C21 A;  3EZ5 A;  4M9N A;  5CP2 A;  5J2J A;  5D49 A;  1XU4 A;  1FA0 A;  3ETL A;  4X4U A;  3SZ2 A;  4O3N A;  4P4M A;  4EBE A;  3RH5 A;  4YR0 A;  4UBB A;  3HWT A;  9ICL A;  4YG2 A;  3Q8S B;  1ZQZ A;  1L3T A;  4NM2 A;  4B9V A;  5DB6 A;  3PML A;  3V7J A;  7ICG A;  4Q43 A;  5J0T A;  2W8K A;  1CUK A;  3ISC A;  4B9U A;  4DSK A;  4O5C A;  1T4G A;  2VA8 A;  8ICH A;  3H3A A;  2AJQ A;  3WFP A;  3SI8 A;  3IHQ B;  2DPJ A;  8ICT A;  4C8N A;  5HRK A;  2JEI A;  4JWM A;  1B43 A;  2ZUC A;  4RUC A;  1ZQR A;  2BGW A;  3H8J A;  3V6H A;  1SKR A;  4XUS A;  5BOM A;  4FS2 A;  2VA2 A;  4FHX A;  2C2E A;  4F5N A;  4UAZ A;  7ICF A;  3MFH A;  2UVR A;  5DGA A;  3G6Y A;  3MR2 A;  1NJX A;  4IRC A;  5KFO A;  3G6X A;  3C2L A;  4KLG A;  2HHQ A;  9ICF A;  1Z00 B;  4YXM A;  3PR4 A;  3C23 A;  2HVH A;  3RJJ A;  4P2H A;  3RTV A;  4KLD A;  4DLE A;  1BPZ A;  3H4B A;  1MIY A;  2KFZ A;  2DR5 A;  9ICW A;  2DR8 A;  2P66 A;  4M47 A;  5HRH A;  4X4R A;  3Q8Q B;  1NZP A;  4RQ8 A;  1KFD A;  1S0N A;  1ZQE A;  1S97 A;  4IQV A;  3V6K A;  5J2G A;  4DSJ A;  1F5A A;  1ZQO A;  2FLP A;  5DDY A;  4XRH A;  4FH5 A;  4FH3 A;  4X0B A;  2ZH3 A;  1BNP A;  3FYH A;  5HHI A;  1NOM A;  1RZT A;  4UAY A;  4MFA A;  1MIW A;  5HRB A;  1PZN A;  2DR7 A;  1KDH A;  1K1Q A;  4DSF A;  2MAX A;  1X9W A;  2HHX A;  3BQ1 A;  1XO1 A;  4UB4 A;  4F4Y A;  4DLG A;  2XCP A;  5CA7 A;  5DQI A;  2KZM A;  8ICQ A;  2RDI A;  1D8Y A;  2XY6 A;  1TK0 A;  4QZE A;  2FLL A;  1DOQ A;  2V4R A;  3RAQ A;  4IQW A;  4KLH A;  4ZH4 A;  4O3S A;  1TAQ A;  3BQ0 A;  3JPN A;  3FDS A;  1ARO P;  3T5H A;  7ICT A;  3C1Z A;  5DBC A;  2IHM A;  2ASL A;  7ICV A;  3EWA A;  1B22 A;  4X4Q A;  1TV9 A;  4KLU A;  3WFQ E;  1Z00 A;  2P6U A;  4ECR A;  3E2E A;  4WC4 A;  3QE9 Y;  5J2K A;  4O3O A;  2IBK A;  4F4W A;  4DF4 A;  5KFM A;  9ICC A;  3WFO A;  2ZH6 A;  3Q8R B;  1R89 A;  1L5U A;  3AQN A;  4J9K A;  1ZQJ A;  3KTQ A;  5KFX A;  3OJS A;  1L3U A;  2UVV A;  1IM4 A;  4F4X A;  2KP7 A;  1L3V A;  4RUA A;  2M2V A;  4QWB A;  3BQ2 A; 
#chains in the Genus database with same CATH topology
 1SB3 C;  2ZH9 A;  2QAR B;  3AQM A;  3QXG A;  5JUM A;  7ICE A;  3AMZ A;  4I0U A;  4AYB F;  2FMQ A;  4PZN A;  7ICJ A;  1BPD A;  3K1R B;  3C1Y A;  2H3I A;  2KIC A;  3RBE A;  5J0P A;  1P7D A;  3GU3 A;  4ECQ A;  3H8W A;  2VA3 A;  2PFP A;  4Z6E A;  4F2R A;  4Y2R A;  2KKP A;  5ALJ A;  4LJX A;  4O3M A;  3H0L B;  4DQS A;  4RQ7 A;  4IQU A;  4I2F A;  1V4A A;  3C2M A;  4LZG A;  2H3Q A;  4XA5 A;  4QZG A;  2JH7 A;  3GQC A;  4DEZ A;  2C22 A;  9ICQ A;  3K4G A;  4KLM A;  3ISD A;  1D9F A;  2WF8 A;  1U48 A;  1SL0 A;  4Y2S A;  3J81 j;  4EGW A;  3TAN A;  2OH2 A;  2ZHB A;  2YB1 A;  3WKA A;  4ED2 A;  3OHA A;  4OJP A;  4CF4 A;  1PK3 A;  4RPX A;  4G3I A;  5KFK A;  4M9H A;  4DSE A;  2LYH A;  4CRX A;  2K60 A;  2HW3 A;  3PSF A;  2XGP A;  4ED0 A;  3N7P D;  2IHO A;  3T5L A;  2ESE A;  3QZ7 A;  5J0S A;  2KZZ A;  2JMG A;  3N97 B;  5J2C A;  9ICV A;  4AT8 A;  7ICL A;  5AKZ A;  1QSS A;  1WCN A;  1S10 A;  3NWI A;  2W9B B;  2BZF A;  2ZXI A;  4PPX A;  4J9R A;  4Y2J A;  2W7P A;  9ICM A;  5ALN A;  8ICK A;  1H38 A;  4B9M A;  2ID1 A;  2BHN A;  2I9G A;  4KIT B;  4WC6 A;  4K96 A;  1ZQU A;  5AKE A;  2W9C A;  1RQL A;  1R8C A;  1U9L A;  1COO A;  4LEY A;  4K4H A;  2J6U A;  3KHG A;  1L7O A;  3NVO A;  1XWL A;  3PW0 A;  1NJY A;  2MUT B;  5ALW A;  2W54 A;  4OO1 J;  3QZ8 A;  2KZ3 A;  4FS1 A;  4BWM A;  4RWP A;  4YMO A;  4IG8 A;  5DB9 A;  5AKL A;  1T94 A;  9ICP A;  4Z6C A;  3T5J A;  4A8E A;  2ATL A;  4LZD A;  3GIL A;  1ZQY A;  4LEV A;  2F2A B;  5CHG A;  2ZXH A;  1HIW A;  3MDC A;  3SAG A;  1SV4 A;  5DKW A;  5GTH U;  1MIV A;  2JZB B;  4C7Y A;  5HRF A;  7ICS A;  3RJG A;  8ICL A;  3PHZ A;  1JX4 A;  3I76 A;  3TAQ A;  1X9X A;  4HYK A;  4I2D A;  2DRA A;  1HJP A;  2EDU A;  3OSP A;  5KFW A;  1VLB A;  1X9M A;  3HX0 A;  4TQR A;  1ZQB A;  4I2A A;  4EEN A;  4B6J A;  3PW4 A;  4Z6D A;  4UQG A;  3RJF A;  3IP4 B;  4EZ6 A;  3WKE A;  4QZD A;  3KHH A;  4NXT A;  2HOQ A;  3QU4 A;  4US8 A;  1ZD2 P;  3VC8 A;  8ICA A;  7ICH A;  9ICT A;  2E8N A;  2EZX A;  3T79 A;  2FCL A;  4WBZ A;  3PX4 A;  3WFS C;  4F2S A;  2IUB A;  1KEJ A;  2AQ0 A;  3JPT A;  3RB3 A;  4YN4 A;  1A76 A;  4P4P A;  1TK5 A;  4DQI A;  4C4T A;  4MFF A;  4WOY A;  1N2X A;  4PHD A;  1S77 D;  4QIW C;  4EX7 A;  3M9N B;  5KFF A;  4ED8 A;  4C7Z A;  3V6J A;  1RYS A;  4QZB A;  1UT8 A;  3JPQ A;  9ICR A;  5ALD A;  1X6I A;  2BKE A;  1LV5 A;  3PW2 A;  4GIB A;  1ECW A;  3SEI A;  4F5P A;  5J0Y A;  2LM4 A;  3KBB A;  1GO3 F;  5KT2 A;  4MHV A;  1VFG A;  3H40 A;  2NRW A;  3RJH A;  2ZIV B;  4ATB B;  4E80 A;  4GFJ A;  2OXO A;  2NRX A;  2A1A A;  4BXO B;  1NK6 A;  5T14 A;  2HOI A;  1NK4 A;  2Z7J A;  1Z4N A;  1PUZ A;  4LVS A;  1JXL A;  4Z6F A;  3EPI A;  2ZIW A;  2EH9 A;  4RQN A;  4NXV A;  1PVQ A;  2R18 A;  4QZA A;  2WTF A;  5CRX A;  1KW4 A;  4Q8E A;  2BDP A;  1L8L A;  2DRB A;  4KTQ A;  5KFV A;  5AIB A;  1S9F A;  4UB3 A;  2R8G A;  4ELU A;  1F44 A;  5IIL A;  3RB4 A;  2XY5 A;  5C5J A;  3QU5 A;  3EYZ A;  2XCA A;  3WKD A;  4K99 A;  2KTQ A;  2W04 A;  2Y0S F;  3ISB A;  4EEY A;  4C8O A;  5J0O A;  3BS5 A;  5HML A;  1ZRM A;  2YQE A;  5HRD A;  1RXW A;  2OWO A;  3JPR A;  1MIW A;  1QQ5 A;  3V72 A;  4C80 A;  2HBM A;  2F76 X;  4WC2 A;  1UA0 A;  2LYA A;  2KD1 A;  5L1K A;  3ER9 B;  2R8J A;  1RXV A;  2E8O A;  5D62 A;  7ICU A;  2F1I A;  2WAQ C;  1NJZ A;  1NK8 A;  2KV2 A;  4YFK A;  3MR6 A;  4AT9 A;  8ICX A;  5J2A A;  5IIK A;  4F72 A;  2NRV A;  1SZH A;  5KG1 A;  1XSN A;  4B9N A;  2IOF A;  2RRD A;  2W3R A;  2M2U A;  2M9N A;  3HKZ F;  2O1P A;  4S3N A;  4KLJ A;  1OW5 A;  4X5V A;  2O5A A;  7ICR A;  2ZUB A;  5AI6 A;  4ECS A;  4ACO A;  5CFU A;  2BQ3 A;  4CCH A;  5DG7 A;  1KFS A;  3BZK A;  1T3Q A;  3MC1 A;  4BX9 C;  7ICM A;  2Q66 A;  4X4N A;  1Z1V A;  3EZ5 A;  2F8K A;  2K4H A;  2NO4 A;  5CP2 A;  2G06 A;  2A3V A;  4EBE A;  4UBB A;  4ICA A;  2K4P A;  3H0R B;  3ISC A;  3H3A A;  1ZD5 A;  2KE7 A;  2DPJ A;  8ICT A;  5KAI U;  3V6H A;  1SKR A;  4FHX A;  4IRC A;  1NJX A;  4KLG A;  3MR2 A;  2CPR A;  3U26 A;  5KFO A;  2HHQ A;  4YXM A;  3C23 A;  3RTV A;  1WG8 A;  3H4B A;  5ALE A;  2DKZ A;  9ICW A;  5J8Y C;  1NZP A;  4RQ8 A;  1KFD A;  3CRX A;  4IQV A;  3V6K A;  3SR6 A;  3TKA A;  4OJ5 A;  2WFA A;  1PZN A;  4NXX A;  1K1Q A;  1VDV A;  3WK7 A;  2MAX A;  2HHX A;  1XO1 A;  4F4Y A;  2RDI A;  1TK0 A;  4ZH4 A;  4O3S A;  1TAQ A;  1JRO A;  5EE1 A;  3SD7 A;  1B0X A;  4WC4 A;  2E8M A;  4DF4 A;  4C0Z A;  2ZH6 A;  3BZC A;  3AQN A;  3OJS A;  1L3U A;  5AI5 A;  1IM4 A;  1L3V A;  4RUA A;  4YXJ A;  3LK9 A;  3LVV A;  1T3N A;  2DF4 B;  5KFI A;  4US9 A;  5J2I A;  4JV2 A;  2W11 A;  4IR9 A;  1D9D A;  2ZH2 A;  3KZI U;  3QUT A;  2BQR A;  1A77 A;  1S0V A;  1MA7 A;  2YMQ A;  3M1Y A;  3H37 A;  3RFA A;  3GIJ A;  5KFQ A;  1RYR A;  1NK5 A;  4DL5 A;  5KFZ A;  4NM1 A;  1UEV A;  9ICI A;  3F5E A;  1U49 A;  1DGS A;  4J03 A;  1OU5 A;  3HIY A;  1CRX A;  1XS9 D;  4KLI A;  1MSW D;  4CE6 A;  2EAM A;  5AKK A;  2HSZ A;  4UB5 A;  2UVU A;  4ED6 A;  1URJ A;  5J0R A;  5KFH A;  4TQS A;  4MKP A;  2BE3 A;  1J2M A;  3N7R C;  4AT8 B;  2NYV A;  1YLQ A;  3VCB A;  5CJ7 A;  4M6W A;  3ETR A;  1ZJN A;  4RPZ A;  5J0Q A;  4B9S A;  4OAH A;  2HDO A;  2PFO A;  4WC7 A;  3O0F A;  3F2C A;  4X4P A;  1UA1 A;  4PH5 A;  2FPK A;  5CR0 A;  2XC9 A;  3MFI A;  2DFL A;  2XVT A;  3D6J A;  4ELV A;  8ICB A;  2WF9 A;  2W8L A;  1YZ7 A;  4EEK A;  2GLE A;  2OM6 A;  1ZQL A;  1V38 A;  3WK4 A;  1JAJ A;  4KLS A;  1L6N A;  1IXR A;  4KN4 A;  5J2H A;  1U45 A;  3LQC B;  4DFK A;  3F2D A;  1BNO A;  1ZQA A;  1ZQS A;  1WYG A;  3M8R A;  1J97 A;  4F4Z A;  4QZF A;  2B21 A;  5B5E U;  5KFC A;  2LKY A;  3R9K A;  2NRK A;  2BCU A;  4RQ6 A;  2ZIU A;  3DDH A;  4FBU A;  4WC5 A;  2NV3 A;  1NO5 A;  5ALI A;  3OUY B;  3N28 A;  1ZQG A;  4ED1 A;  4DL7 A;  2BCQ A;  1N62 A;  2K4E A;  3SYZ A;  1SL2 A;  5D46 A;  3OV7 A;  4OAG A;  4I27 A;  3M7D A;  2ODG A;  4FHY A;  3NVY A;  1KFT A;  4X0A A;  1K1S A;  4BUG A;  4DOA A;  2IOH A;  4UB8 U;  5ALF A;  3M6K A;  5AKG A;  1YZ6 A;  3GV8 B;  3MR5 A;  5D63 A;  3ZD8 A;  3MR3 A;  1SIJ A;  4FHV A;  3OPX A;  4Y2P A;  5AK6 A;  1Y88 A;  2KSO B;  5AKJ A;  3T5K A;  1O03 A;  5AI8 A;  5KFE A;  5AK3 A;  5KG3 A;  5G5G A;  4UD4 A;  4WC1 A;  1JIH A;  2BPC A;  2B51 A;  4XQ8 A;  1X9S A;  3WK5 A;  1KNY A;  4M04 A;  4KLL A;  1SKS A;  2KFN A;  2ZTC A;  2F1H A;  1QH9 A;  3Q8P B;  3LWM A;  3F2B A;  4KX5 A;  1BPY A;  5L1L A;  1QCK A;  1ZQF A;  3HW8 A;  2G08 A;  1PVR A;  2A1J B;  2HOF A;  5IIJ A;  4CF5 A;  8ICZ A;  4LEZ A;  1VJ5 A;  3KKA A;  4EBD A;  1J2N A;  1IG6 A;  3L3F X;  5KFD A;  2ALZ A;  3THV A;  4XQ7 A;  3MBY A;  5JU5 A;  5KL8 B;  2XO7 A;  2J6S A;  4GC7 A;  4EX6 A;  1JRP A;  4UB6 U;  4TUS A;  2FPM A;  1ZQT A;  2QB1 A;  3OGU A;  4F5R A;  9ICE A;  2DPI A;  2LMR A;  5DLG A;  5J29 A;  3NGD A;  4J9P A;  5HNK A;  2JXJ A;  1S0M A;  1NJW A;  1U4B A;  2VIX A;  1NZB A;  3QX7 A;  5AK5 A;  2OEH A;  2E1F A;  2DQN B;  2NRT A;  2WF5 A;  3K75 D;  4PHA A;  3SMV A;  3KFU F;  2ASJ A;  3H39 A;  1TFW A;  2BDU A;  3MGH A;  2HI0 A;  3OWG A;  3QUB A;  4UBC A;  2ZIW B;  3OTQ A;  2HHT A;  3F53 A;  1JUD A;  2B6G A;  2BR0 A;  5J0W A;  2C2D A;  4XJE A;  1RG6 A;  3OJU A;  2KJ8 A;  2C2R A;  3Q8K A;  4CDG A;  4JMU A;  1ZET A;  2IMW P;  1TFY A;  2KKV A;  1NKB A;  5ALR A;  2RP5 A;  2LYB A;  9ICX A;  8ICR A;  3KHR A;  1ZJM A;  3NYB A;  4NY8 A;  1Q78 A;  4O5E A;  4NLN A;  4EBJ A;  4I2G A;  1RQN A;  1ZD3 A;  3PV8 A;  2ZJA A;  4WH5 A;  5DB8 A;  1BPE A;  3ALR A;  2WF7 A;  1ZXI A;  5J2D A;  4TUR A;  1NK7 A;  3OHB A;  2YTU A;  5CB1 A;  4EYI B;  2JR5 A;  4O3R A;  1JN3 A;  4R63 A;  4M0A A;  4MF2 A;  4RWQ A;  3IV6 A;  4FZN A;  8ICN A;  4O6A A;  5A0L A;  2PFN A;  5KT7 A;  2R8I A;  4ED3 A;  1K5O A;  1XO0 A;  4NLK A;  2RLT A;  1Q8K A;  3LDA A;  1V9P A;  1OXJ A;  3C2K A;  4PJ0 U;  3JPO A;  4F92 B;  4GLX A;  2AGP A;  3ZI4 A;  2C28 A;  3NAS A;  2GH1 A;  2RDJ A;  4AT9 B;  4KLF A;  1BGX T;  4F5O A;  5DG9 A;  4IQT A;  4RPY A;  4KN7 A;  5KG4 A;  5EOZ A;  4I2E A;  4DCC A;  5EWE A;  8ICC A;  9ICU A;  3PMN A;  1BPB A;  2HMX A;  1MN8 A;  2JEG A;  2I1Q A;  2JRZ A;  4QZI A;  8ICG A;  8ICI A;  3PVX A;  5EWF A;  2KHQ A;  2GO7 A;  5J2F A;  3ER8 C;  3EPG A;  4I2B A;  4DL4 A;  4EED A;  3ZDB A;  4Y2U A;  4Y2V A;  3IRU A;  3RH4 A;  3RBD A;  3TFS A;  4M9G A;  1DRG A;  3PSI A;  5TZV A;  1N5X A;  2F8L A;  2AXT U;  5JRT A;  2F77 X;  3TAD A;  2HBK A;  5ALY A;  1NK0 A;  4K97 A;  5KFS A;  3CK6 A;  4FFD A;  2O6K A;  2Q4T A;  2KMD A;  5G5H A;  5KFG A;  8ICP A;  8ICU A;  1NKC A;  1ZRN A;  2GWS A;  5HMM A;  2WB1 C;  3PST A;  3OVA A;  4FBT A;  1ZQD A;  4P0P A;  5KG6 A;  2KJ5 A;  2XY7 A;  2BQU A;  4NL9 A;  4C8M A;  2QKQ A;  2QLT A;  3NS1 A;  4YP3 A;  5TIS U;  1QTM A;  2WF6 A;  2AU0 A;  5ALU A;  1N5W A;  4QIW F;  5J2J A;  5D49 A;  1XU4 A;  1FA0 A;  4RQM A;  4X4U A;  4O3N A;  4YR0 A;  3QU9 A;  3HWT A;  4YG2 A;  3Q8S B;  1ZQZ A;  7ICG A;  3V7J A;  5ALT A;  3LYS A;  2XID A;  5J0T A;  2W8K A;  1CUK A;  4B9U A;  4DSK A;  4PL1 A;  3PZP A;  3SI8 A;  3IHQ B;  4O68 A;  1DXS A;  4JWM A;  3AL0 B;  2CXY A;  1ZQR A;  2VA2 A;  2MRL A;  4FS2 A;  2C2E A;  3MFH A;  7ICK A;  2JHD A;  3G6Y A;  9ICB A;  4UAS A;  3G6X A;  2KIW A;  2HVH A;  3RJJ A;  1MIY A;  4DLE A;  1BPZ A;  2DR5 A;  2KFZ A;  2H3V A;  4Y2X A;  2P66 A;  1XNS A;  5HRH A;  4JB3 A;  1F5A A;  5AM5 A;  1X42 A;  5DDY A;  4X0B A;  5ALV A;  1A0P A;  2ZH3 A;  1BNP A;  3L5K A;  2LBO A;  1JI7 A;  2LI6 A;  4DLG A;  5CA7 A;  5DQI A;  4K8V A;  1Q3U A;  4IQW A;  3CP8 A;  3JPN A;  3FDS A;  2EAP A;  3T5H A;  5DBC A;  2IHM A;  1B22 A;  1Z00 A;  5J2K A;  5EE0 A;  9ICC A;  3Q8R B;  2N1R A;  5AM1 A;  3KTQ A;  3E0F A;  4K9B A;  2EZY A;  4WQK A;  5EE9 A;  2DBY A;  3BQ2 A;  2E1E A;  3NVV A;  3GIM A;  4O67 A;  2ZH5 A;  3AU6 A;  2HHU A;  2HHW A;  2W9M A;  2JGA A;  5J2B A;  1N63 A;  2Y9T A;  4M6W B;  1U47 A;  2ISO A;  3RF9 A;  4NKT A;  4WCW A;  2K8B B;  2XI9 A;  1CI4 A;  4NL9 C;  2RHF A;  7ICQ A;  3ZD9 A;  1SGG A;  2OYY A;  1BVS A;  1UQV A;  4F3O A;  4UAU A;  4K4G A;  4RT3 A;  3C18 A;  3BS7 A;  1XSP A;  1DK2 A;  2DGZ A;  4JV1 A;  4JV0 A;  1EXN A;  4RWN A;  4X4V A;  2W03 A;  2RFF A;  3A0H U;  2F44 A;  4PGQ A;  3C28 A;  2HHS A;  1F5S A;  1S0O A;  4DL2 A;  4KLQ A;  2F1J A;  3PW5 A;  4EZ9 A;  3AUO A;  1PK1 B;  1RDF A;  4X4S A;  5HRL A;  3AQF A;  3NKU A;  4I2I A;  1RYU A;  2Y1I A;  2BPG A;  2YX8 A;  4CF3 A;  3PSP A;  5B3Q A;  4LT6 A;  3G6V A;  3GZF A;  4F8R A;  5ALX A;  2RQ5 A;  1FFU A;  4QW9 A;  3UQ2 A;  4I2C A;  5H2F U;  8ICM A;  3PX6 A;  2EAN A;  1V85 A;  5GTI U;  3SV3 A;  1WCL A;  3CW2 C;  4ED7 A;  3IN5 A;  4DS4 A;  1JQR A;  5KFL A;  4G9B A;  2KG5 A;  2ZH1 A;  2PMZ C;  4NLB A;  3PNC A;  1C7Y A;  5AKH A;  2FDR A;  4CGZ A;  4O69 A;  3ICX A;  4GXI A;  4UAW A;  9ICJ A;  3TI0 A;  3I1Y A;  1L7N A;  4RNN A;  3KHL A;  5HRG A;  4NXU A;  3A0B U;  4TUP A;  5L9X A;  4NJ8 A;  4RWO A;  2HHP A;  4ECX A;  4FHW A;  3F5A A;  3BQT A;  3NRZ A;  4X4O A;  4WJ3 B;  4QW8 A;  3WKB A;  2M2T A;  2MSN A;  1UET A;  3H7I A;  3PW7 A;  1ZQP A;  4P0Q A;  4MF8 A;  3JPS A;  4JLZ A;  3K7D A;  4YQW A;  2UVW A;  1UHU A;  4F93 B;  1SXE A;  4QZ8 A;  4I28 A;  1O08 A;  5CFT A;  4DFM A;  8ICW A;  3WKC A;  5HRI A;  4EYH B;  1ZOL A;  2DKX A;  2KN7 A;  2AGQ A;  4YVZ A;  1WOT A;  2W55 A;  5KFR A;  2Q0Z X;  3ED5 A;  3I28 A;  4BGD A;  3HP6 A;  4YR3 A;  5KT4 A;  1KRP A;  9ICG A;  2R8H A;  4K98 A;  4PZO A;  2DR9 A;  2AGO A;  4IL6 U;  1L7M A;  5ALM A;  4RQ3 A;  5HR9 A;  1NKE A;  2BBJ A;  5C0Y A;  5AKX A;  2IHN A;  4JK1 A;  4I2H A;  1L3S A;  2ZTD A;  7ICN A;  3WK9 A;  4J9L A;  4E8F A;  2FE9 A;  5ALH A;  3WFR E;  1IIP A;  4E7X A;  3LWL A;  3RB0 A;  2J6T A;  4RQ5 A;  1Z4O A;  4Q45 A;  4YMM A;  3QEA Z;  4IC9 A;  3JYY A;  4Q8F A;  5B3P A;  3C66 A;  2G5I B;  2ZHA A;  2QB0 A;  2ZH8 A;  1JAL A;  3MDA A;  3MAB A;  1SKW A;  1IV8 A;  2ZJ5 A;  3IDW A;  1KQQ A;  3LVW A;  5DED A;  1Q3V A;  4RQ1 A;  3FM9 A;  2BPF A;  4YD2 A;  2H3F A;  1ZQK A;  3RJI A;  3SEN A;  2W9C B;  5BPC A;  2BCV A;  5JTI A;  1TKD A;  5KT6 A;  4R8U A;  1Q46 A;  1M6Y A;  3QNM A;  1MC8 A;  5IIO A;  3D2Q A;  2P35 A;  2K4I A;  4ECY A;  4WC0 A;  2DUY A;  3H0M B;  4HX0 A;  5HR7 A;  4WBY A;  3H8S A;  4C8L A;  2KJ9 A;  4U7C A;  1ZQN A;  4DFP A;  2HCF A;  3UMC A;  4IS7 A;  1PVP A;  1X6J A;  2GA9 D;  5KTQ A;  4UAV A;  4KLT A;  2KVC A;  2P6R A;  2FLN A;  2JH1 A;  4KLE A;  1N61 A;  4BJQ A;  2GAF D;  4B9L A;  4O0I A;  2PFQ A;  4ECW A;  2E8P A;  2ZG6 A;  3DV9 A;  5DBA A;  2EAO A;  5DG8 A;  1ZYQ A;  5KG7 A;  1N48 A;  2ZJ8 A;  4GXJ A;  4NV0 A;  2G0A A;  3SQI A;  8ICS A;  2B0C A;  2D6F C;  5KAF U;  3UXO A;  5AKY A;  5ALL A;  3ORY A;  4QWD A;  4NLC A;  5DLF A;  1MQ3 A;  1NK9 A;  2ES6 A;  2HVI A;  4BWJ A;  4F91 B;  3B0X A;  5KT5 A;  1NNL A;  5K4L A;  2FPL A;  2VJ5 A;  3UPQ A;  2W9A A;  1S8O A;  4N7R A;  8ICE A;  4KMO B;  2IOF K;  3EW9 A;  4RQ4 A;  3AQE A;  1L7P A;  2OCE A;  8ICO A;  2F3N A;  5AK4 A;  4AYB C;  1LKY A;  3C5G A;  4QNL A;  4CNQ A;  3RR8 A;  3HJ1 A;  4DSI A;  9ICA A;  4M2Y A;  2V9W A;  3AEV A;  2M0N A;  7ICO A;  3RR7 A;  3E58 A;  4KMU A;  2FMS A;  3NUQ A;  5KFJ A;  1ZQV A;  4P0P B;  1N56 A;  2JEF A;  8ICF A;  4RT2 A;  9ICK A;  5AKI A;  4UAR A;  4JUZ A;  4J9O A;  3KOO A;  5J0X A;  3PX0 A;  1L8O A;  4F71 A;  1B4F A;  2AHO B;  7ICP A;  4QWC A;  4K4I A;  2H5X A;  5ALG A;  5L1I A;  2G09 A;  3M8S A;  4DWI A;  5III A;  1ZD4 A;  3AM9 A;  2AH5 A;  3PO5 A;  3SAF A;  1SWV A;  2DL0 A;  2B56 A;  1SV0 A;  4QWA A;  1SZP A;  2FJ6 A;  4OJ6 A;  4O3Q A;  1ZQH A;  3UXN A;  1D8L A;  3V7K A;  2CN1 A;  2EWR A;  3CNH A;  3D2N A;  5E79 U;  4AT7 A;  3QU7 A;  2FI1 A;  2YN4 A;  4HAI A;  4P4M A;  3L4P A;  5L1M A;  3RH5 A;  2KVS A;  1L3T A;  4NM2 A;  4QJF B;  4O5C A;  1T4G A;  2VA8 A;  3WFP A;  2AJQ A;  3UMB A;  5AI9 A;  4C8N A;  5HRK A;  1B43 A;  2ZUC A;  4RUC A;  1KN5 A;  3KD3 A;  4XUS A;  5BOM A;  4F5N A;  1TAM A;  3C2L A;  9ICF A;  1Z00 B;  3JCF A;  4OJL A;  2KOB A;  4KLD A;  2DR8 A;  4M47 A;  4X4R A;  3Q8Q B;  3FAH A;  1S0N A;  1S97 A;  5J2G A;  1ZQO A;  1V97 A;  4FH3 A;  3BS5 B;  3FYH A;  1NOM A;  2I6X A;  5HRB A;  1Z19 A;  2YML A;  2KK0 A;  3K1Z A;  4DSF A;  3BQ1 A;  2I5H A;  4UB4 A;  2KZM A;  2XCP A;  1D8Y A;  4PL2 A;  2FLL A;  4KLH A;  4OCZ A;  3BQ0 A;  1ARO P;  3ONN A;  2ASL A;  7ICV A;  3EWA A;  4DFD A;  5AIA A;  3WFQ E;  3KKA C;  4O3O A;  5KFM A;  3UMG A;  4J9K A;  2UVV A;  4Y2Y A;  3DEE A;  5DGB A;  2OHF A;  4QWB A;  2M2V A;  3GV5 B;  4NLG A;  2PXI A;  2ZIX A;  2W7O A;  4R64 A;  5IIM A;  2B4V A;  5KFB A;  3OUY A;  4FE3 A;  1SV0 C;  4IRD A;  3ERC C;  3B0Y A;  2K8A A;  2D8C A;  4DFJ A;  4UD5 A;  2LM1 A;  4FO6 A;  3GFK B;  4EBC A;  5IIN A;  1ZQM A;  9ICO A;  3D2S A;  1SXD A;  5CFS A;  1ZQW A;  1T8E A;  2QAR A;  1SL1 A;  3SV4 A;  4K9A A;  3B9J A;  4F5Q A;  5JTG A;  3GIK A;  3TAR A;  2KSO A;  3ZDE A;  5HC9 A;  2DWQ A;  5AM2 A;  2V4Q A;  3NVZ A;  3RRH A;  2PBE A;  2CRX A;  1HUO A;  2WB1 F;  5L1J A;  3M6Z A;  3RJE A;  5F2V O;  3WK8 A;  2E3T A;  2KEY A;  5KFT A;  5ALO A;  1UT5 A;  7ICI A;  3OVS A;  2YMM A;  5FP0 A;  1T7P A;  2A1J A;  3OVB A;  3HJE A;  5AI0 A;  5AIC A;  3GV7 B;  2E5S A;  4DL6 A;  3TAP A;  3C29 A;  4MFC A;  8ICY A;  4ECT A;  2VKQ A;  2ZUD A;  3NRW A;  3H4D A;  4M5D A;  1TAU A;  1QSL A;  1ZQ1 C;  4P0Q B;  4NLZ A;  2EQY A;  3QYP A;  3SAH A;  5HHH A;  4O5K A;  1JMS A;  2Y1J A;  5KFA A;  5AM4 A;  3M9O B;  2HBL A;  2ISP A;  1RM6 C;  3PO4 A;  1ZQQ A;  4GC6 A;  9ICN A;  3H8M A;  3RJK A;  2YY6 A;  9ICS A;  2ZH4 A;  3RB6 A;  8ICJ A;  1JXE A;  3UPS A;  4RNM A;  9ICH A;  4R66 A;  4C4R A;  3GDX A;  3RAX A;  1DK3 A;  3IM1 A;  2Y9U A;  2MA1 A;  2AQ4 A;  4I2J A;  1MQ2 A;  3PR5 B;  5KNI A;  4M9L A;  3N4M B;  5KG2 A;  5F9L A;  4FZL A;  3KZX A;  4OD0 A;  4P4O A;  5AM3 A;  4DQQ A;  2W9B A;  4ECU A;  4GXK A;  4JWN A;  2BBH A;  1GPJ A;  4EV6 A;  4QWE A;  2HBJ A;  2YB4 A;  3AU2 A;  4NKU A;  2ASD A;  1HUZ A;  1UCV A;  3HIL A;  3TAD C;  4RQ2 A;  2D3D A;  1N60 A;  3T3F A;  4JLX A;  2Y0S C;  4Y2T A;  4PHE A;  1TVA A;  4BDP A;  3PY8 A;  4DSL A;  4DF8 A;  2A19 A;  1BPX A;  5ALZ A;  2LPE A;  4E0D A;  1R8B A;  2MUT A;  5J8Y A;  3HPO A;  2KHV A;  2QB0 B;  2K89 A;  1CEZ A;  5F9N A;  4C4S A;  4NWI A;  2EZZ A;  4F50 A;  5HP4 A;  1FFV A;  4PHP A;  5B66 U;  4DQP A;  2NRZ A;  4YMN A;  5DQH A;  4IRK A;  5J0U A;  1KSP A;  3QEB Z;  1X40 A;  3M9M B;  2K8C B;  2KNJ A;  4DOB A;  4R8U B;  2WAQ F;  1C20 A;  2WHE A;  3ZDD A;  1KL9 A;  5BOL A;  3MCR A;  4RU9 A;  4I29 A;  2R8K A;  2JZB A;  2XIC A;  5AM0 A;  3HKZ C;  1XSL A;  4O9M A;  4J9S A;  5CWR A;  1FIQ A;  4KB6 A;  4J9M A;  4TUQ A;  1LB2 B;  3H38 A;  4RNO A;  5J2E A;  3MGV A;  4ZOH C;  3TFR A;  4QZ9 A;  5DQG A;  4NXW A;  3CYM A;  2VJ4 A;  4DQR A;  4USA A;  4B9T A;  5KG5 A;  2ZIU B;  1SWW A;  1Z3E B;  2MU2 A;  5DDM A;  5CEH A;  1HEK A;  5DBB A;  2JEJ A;  3BJY A;  3C5F A;  2XGQ A;  4R65 A;  1ZQX A;  1Z1B A;  2KIV A;  2M2W A;  5KFY A;  2PKE A;  2YMP A;  4PGX A;  3TAC B;  5KFN A;  4QZH A;  5F3X B;  3NTU A;  2G07 A;  3NVW A;  2FMP A;  4RQ0 A;  1DGJ A;  4DO9 A;  3BDP A;  2PMZ F;  1TK8 A;  5HRE A;  2DVI A;  5KL1 B;  4PGY A;  3RH6 A;  4NXZ A;  3UQ0 A;  3EF2 A;  5ALP A;  4FZM A;  4QZC A;  1UEU A;  4OAI Z;  1Q79 A;  4WQL A;  1XC9 A;  3AN1 A;  1LKY B;  5HR6 A;  5CHE A;  5DB7 A;  2NO5 A;  3GII A;  3ZDC A;  4MEY A;  4ELT A;  2ZH7 A;  1PX5 A;  3V7L A;  3UXP A;  1VJ7 A;  3AQL A;  4KM5 A;  4DL3 A;  1QSY A;  1WWV A;  3AQK A;  1KLN A;  3Q8L A;  1QLN A;  4YR2 A;  4KX3 A;  1X2I A;  2ZIV A;  4C8K A;  4X4T A;  4ATB A;  3L9D A;  1R8A A;  4BXO A;  1ZQI A;  4UW9 A;  1FO4 A;  3MGI A;  3OSN A;  1ZQC A;  2PI4 A;  1COK A;  3QU2 A;  1WUD A;  1KTQ A;  5EWG A;  3HJ4 A;  2HN1 A;  3ZDA A;  4FHP A;  4IR1 A;  4FO1 A;  4YD1 A;  2HN2 A;  1YT3 A;  4DS5 A;  5AHX A;  2GOL A;  2H3Z A;  4EP7 A;  3JPP A;  1QQ7 A;  1F0M A;  4UB2 A;  3RRG A;  4EEL A;  3IG5 A;  3Q8M A;  4UB1 A;  4F4K A;  5KFP A;  4J9Q A;  3HRD D;  4Q44 A;  1TFR A;  2G5H B;  2BCR A;  5ALQ A;  3FC4 A;  3JZ0 A;  4AT7 B;  1FEZ A;  4UAT A;  4RZR A;  2IA6 A;  4KLO A;  2VAN A;  4ECV A;  2ZTE A;  5DEC A;  5ALS A;  3TQ1 A;  1KKX A;  3N7S C;  4MEX A;  2LHT A;  3BQ7 A;  4YCX A;  8ICV A;  4EBK A;  3QUQ A;  4DOC A;  3UM9 A;  5KT3 A;  4J9N A;  1S5L U;  4OJO A;  4M9J A;  4LEW A;  2PI5 A;  5D4B A;  4O3P A;  1S76 D;  2HHV A;  2BCS A;  4WC3 A;  1X66 A;  4ECZ A;  5KG0 A;  5KFU A;  3HT3 A;  1RPL A;  3C21 A;  4M9N A;  3ETL A;  3SZ2 A;  9ICL A;  4B9V A;  5DB6 A;  1WWU A;  3PML A;  4Q43 A;  2W43 A;  8ICH A;  1A6S A;  4Y2Q A;  1KBU A;  2JEI A;  2BGW A;  3QUC A;  3H8J A;  4UAZ A;  7ICF A;  2UVR A;  5DGA A;  3S6J A;  3PR4 A;  4P2H A;  4U6P A;  3WU2 U;  1PK1 A;  4EEB A;  1TE2 A;  5EE3 A;  1ZQE A;  4DSJ A;  2L5Y A;  2FLP A;  4XRH A;  4FH5 A;  2JV3 A;  5ALK A;  5HHI A;  2ZIX B;  1RZT A;  4UAY A;  1NI3 A;  4MFA A;  1LVH A;  2DR7 A;  1KDH A;  1ED1 A;  1X9W A;  8ICQ A;  5AI4 A;  2XY6 A;  4QZE A;  1DOQ A;  2V4R A;  3RAQ A;  4OAF A;  4AP9 A;  3WK6 A;  7ICT A;  3C1Z A;  3IG8 A;  2W3S A;  4X4Q A;  1TV9 A;  4KLU A;  2P6U A;  4ECR A;  3E2E A;  3QE9 Y;  1AQ6 A;  2IBK A;  4F4W A;  3EUB 2;  3WFO A;  1UPH A;  1QQ6 A;  1OUQ A;  1R89 A;  1L5U A;  5D61 A;  1ZQJ A;  5KFX A;  1D8B A;  2KP7 A;  4F4X A; 
#chains in the Genus database with same CATH homology
 2ZH9 A;  4YXJ A;  3GIM A;  3GV5 B;  4NLG A;  3LK9 A;  3AQM A;  1T3N A;  5JUM A;  2PXI A;  7ICE A;  5KFI A;  4R64 A;  2FMQ A;  5J2I A;  5IIM A;  4JV2 A;  7ICJ A;  2ZH5 A;  3AU6 A;  5KFB A;  1BPD A;  2HHU A;  4IR9 A;  3OUY A;  3C1Y A;  2W9M A;  1D9D A;  2HHW A;  2ZH2 A;  5J2B A;  1U47 A;  4M6W B;  2BQR A;  3RBE A;  2ISO A;  1A77 A;  5J0P A;  4IRD A;  1S0V A;  4NKT A;  4WCW A;  4ECQ A;  3H37 A;  3H8W A;  2VA3 A;  3GIJ A;  5KFQ A;  3B0Y A;  1NK5 A;  1RYR A;  4DL5 A;  2PFP A;  4Z6E A;  4F2R A;  7ICQ A;  5KFZ A;  4UD5 A;  4DFJ A;  4NM1 A;  9ICI A;  3ZD9 A;  1UEV A;  1U49 A;  1DGS A;  1OU5 A;  3HIY A;  4DQS A;  4RQ7 A;  4IQU A;  1XS9 D;  4I2F A;  3C2M A;  4FO6 A;  3GFK B;  4KLI A;  1BVS A;  4EBC A;  4QZG A;  4XA5 A;  5IIN A;  4LZG A;  1MSW D;  3GQC A;  4DEZ A;  1ZQM A;  4F3O A;  9ICO A;  4K4G A;  2C22 A;  4RT3 A;  9ICQ A;  3K4G A;  3C18 A;  4UB5 A;  2UVU A;  1ZQW A;  4KLM A;  1XSP A;  3ISD A;  4ED6 A;  1T8E A;  5J0R A;  1D9F A;  5KFH A;  1DK2 A;  1U48 A;  1SL1 A;  4TQS A;  3SV4 A;  1SL0 A;  4JV1 A;  4JV0 A;  1EXN A;  3TAN A;  4RWN A;  2BE3 A;  4X4V A;  2RFF A;  4F5Q A;  3GIK A;  4AT8 B;  1YLQ A;  3TAR A;  2ZHB A;  5CJ7 A;  3ZDE A;  4M6W A;  5HC9 A;  1ZJN A;  4RPZ A;  5J0Q A;  4PGQ A;  4ED2 A;  2V4Q A;  3OHA A;  4B9S A;  3RRH A;  2PBE A;  2HHS A;  1S0O A;  4DL2 A;  4KLQ A;  4RPX A;  2F1J A;  1HUO A;  5L1J A;  2PFO A;  3PW5 A;  4EZ9 A;  3AUO A;  5KFK A;  4G3I A;  4WC7 A;  3RJE A;  5F2V O;  4M9H A;  4X4P A;  4DSE A;  2LYH A;  4X4S A;  1UA1 A;  4PH5 A;  5KFT A;  2FPK A;  5CR0 A;  2XC9 A;  3MFI A;  2DFL A;  2HW3 A;  5HRL A;  1UT5 A;  2XGP A;  4ED0 A;  7ICI A;  3OVS A;  3T5L A;  4I2I A;  2Y1I A;  2BPG A;  4ELV A;  1T7P A;  2A1J A;  8ICB A;  3OVB A;  2W8L A;  3QZ7 A;  4LT6 A;  3GV7 B;  5J0S A;  3G6V A;  2KZZ A;  1V4A A;  4DL6 A;  3N97 B;  5J2C A;  4F8R A;  1ZQL A;  9ICV A;  3TAP A;  1JAJ A;  4QW9 A;  4KLS A;  4AT8 A;  1IXR A;  3UQ2 A;  4I2C A;  4MFC A;  8ICY A;  8ICM A;  7ICL A;  4ECT A;  2ZUD A;  4KN4 A;  3PX6 A;  1QSS A;  5J2H A;  1U45 A;  3H4D A;  1WCN A;  1TAU A;  4M5D A;  1S10 A;  3SV3 A;  1QSL A;  1WCL A;  3LQC B;  4DFK A;  4ED7 A;  2W9B B;  4DS4 A;  1JQR A;  1BNO A;  4NLZ A;  5KFL A;  1ZQA A;  5HHH A;  4O5K A;  2ZH1 A;  1JMS A;  2Y1J A;  4PPX A;  5KFA A;  3PNC A;  4J9R A;  1ZQS A;  1C7Y A;  3M9O B;  9ICM A;  3M8R A;  2ISP A;  3PO4 A;  4F4Z A;  1ZQQ A;  4GC6 A;  1H38 A;  4B9M A;  8ICK A;  4QZF A;  4GXI A;  9ICN A;  2ID1 A;  3RJK A;  9ICS A;  2BHN A;  2B21 A;  4UAW A;  3TI0 A;  2I9G A;  5KFC A;  3RB6 A;  4KIT B;  1JXE A;  8ICJ A;  2ZH4 A;  4RNN A;  3KHL A;  4RNM A;  9ICH A;  1ZQU A;  4R66 A;  5HRG A;  3UPS A;  4WC6 A;  4TUP A;  2W9C A;  2NRK A;  2BCU A;  4RQ6 A;  4WC5 A;  4FBU A;  5L9X A;  1R8C A;  1U9L A;  1NO5 A;  3GDX A;  4RWO A;  1COO A;  3RAX A;  4ECX A;  2HHP A;  3OUY B;  1DK3 A;  4K4H A;  1ZQG A;  2J6U A;  3IM1 A;  4ED1 A;  4FHW A;  3BQT A;  3KHG A;  4DL7 A;  2BCQ A;  4X4O A;  2AQ4 A;  4QW8 A;  4I2J A;  1MQ2 A;  3SYZ A;  2M2T A;  1XWL A;  3PR5 B;  5D46 A;  3PW0 A;  1NJY A;  1SL2 A;  3H7I A;  1UET A;  2MUT B;  3OV7 A;  4M9L A;  3PW7 A;  5KG2 A;  5F9L A;  3N4M B;  4DQQ A;  1ZQP A;  4P4O A;  4MF8 A;  4I27 A;  3QZ8 A;  3JPS A;  2W9B A;  4ECU A;  4GXK A;  2KZ3 A;  4YQW A;  4FS1 A;  4JWN A;  4FHY A;  4BWM A;  1KFT A;  4RWP A;  4YMO A;  2UVW A;  4X0A A;  4IG8 A;  4QWE A;  1K1S A;  5DB9 A;  3AU2 A;  4DOA A;  4F93 B;  2ASD A;  4NKU A;  1HUZ A;  4QZ8 A;  4I28 A;  9ICP A;  4Z6C A;  3T5J A;  2ATL A;  4DFM A;  8ICW A;  4LZD A;  3GIL A;  5HRI A;  4RQ2 A;  1ZQY A;  4EYH B;  3GV8 B;  3MR5 A;  3T3F A;  2KN7 A;  2AGQ A;  3ZD8 A;  3MR3 A;  4YVZ A;  4PHE A;  5CHG A;  4FHV A;  3MDC A;  1WOT A;  1TVA A;  1Y88 A;  5DKW A;  4BDP A;  3PY8 A;  4DSL A;  3T5K A;  4DF8 A;  1MIV A;  2JZB B;  1BPX A;  4E0D A;  7ICS A;  5HRF A;  3RJG A;  5KFE A;  8ICL A;  1JX4 A;  7ICO A;  1R8B A;  2MUT A;  5KFR A;  3HPO A;  2Q0Z X;  4HYK A;  5KG3 A;  3TAQ A;  4BGD A;  4UD4 A;  4WC1 A;  3HP6 A;  4YR3 A;  5KT4 A;  1JIH A;  2BPC A;  1KRP A;  4I2D A;  4XQ8 A;  2R8H A;  1HJP A;  5F9N A;  3OSP A;  1X9S A;  1CEZ A;  5KFW A;  2DR9 A;  1KNY A;  2AGO A;  4M04 A;  4KLL A;  1X9M A;  1SKS A;  5HR9 A;  4RQ3 A;  3HX0 A;  2KFN A;  1NKE A;  2ZTC A;  2F1H A;  4TQR A;  1ZQB A;  4F50 A;  4I2A A;  3Q8P B;  5HP4 A;  3LWM A;  3PW4 A;  2IHN A;  4JK1 A;  4I2H A;  4Z6D A;  4PHP A;  4UQG A;  1L3S A;  5L1L A;  2ZTD A;  2NRZ A;  1BPY A;  4YMN A;  3RJF A;  1ZQF A;  5DQH A;  3HW8 A;  4J9L A;  7ICN A;  4E8F A;  4IRK A;  2A1J B;  4EZ6 A;  5J0U A;  3WFR E;  1KSP A;  5IIJ A;  3QEB Z;  3M9M B;  4E7X A;  4QZD A;  3LWL A;  4DOB A;  3RB0 A;  4R8U B;  3KHH A;  8ICZ A;  2J6T A;  4RQ5 A;  3ZDD A;  5BOL A;  4Q45 A;  4RU9 A;  4EBD A;  4YMM A;  8ICA A;  3QEA Z;  5KFD A;  2R8K A;  2ALZ A;  4I29 A;  7ICH A;  9ICT A;  3THV A;  2JZB A;  3JYY A;  4Q8F A;  4XQ7 A;  3MBY A;  1XSL A;  4O9M A;  4J9S A;  5CWR A;  3C66 A;  3PX4 A;  4WBZ A;  2ZHA A;  3WFS C;  4F2S A;  2ZH8 A;  2XO7 A;  3MDA A;  3MAB A;  2DRA A;  1SKW A;  4J9M A;  2J6S A;  2ZJ5 A;  4GC7 A;  4TUQ A;  1LB2 B;  1KEJ A;  5DED A;  2AQ0 A;  5DGB A;  4RNO A;  3JPT A;  5J2E A;  4RQ1 A;  3RB3 A;  4YN4 A;  3H38 A;  1A76 A;  2FPM A;  4TUS A;  3TFR A;  4P4P A;  1ZQT A;  2BPF A;  4YD2 A;  7ICK A;  4QZ9 A;  3OGU A;  1TK5 A;  5DQG A;  4F5R A;  1ZQK A;  9ICE A;  4DQI A;  2DPI A;  3RJI A;  4MFF A;  4DQR A;  5DLG A;  5J29 A;  2W9C B;  4B9T A;  5KG5 A;  4PHD A;  9ICJ A;  3NGD A;  5BPC A;  1Z3E B;  1S77 D;  2BCV A;  5DDM A;  4J9P A;  5HNK A;  1TKD A;  3M9N B;  1S0M A;  5KT6 A;  5KFF A;  4R8U A;  5DBB A;  1U4B A;  1NJW A;  4ED8 A;  2JEJ A;  3BJY A;  3K75 D;  2NRT A;  3C5F A;  4PHA A;  2XGQ A;  1TFW A;  3V6J A;  1MC8 A;  2ASJ A;  1RYS A;  4R65 A;  1ZQX A;  5IIO A;  3H39 A;  4QZB A;  3MGH A;  1UT8 A;  3JPQ A;  9ICR A;  2M2W A;  5KFY A;  4UBC A;  2BKE A;  4ECY A;  4PGX A;  5KFN A;  1LV5 A;  2HHT A;  4QZH A;  4WC0 A;  3PW2 A;  4WBY A;  3H8S A;  4F5P A;  2BR0 A;  3NTU A;  4C8L A;  4DQP A;  5J0W A;  5J0Y A;  2C2D A;  5KT2 A;  2FMP A;  4RQ0 A;  1ZQN A;  3OJU A;  4DFP A;  2C2R A;  4DO9 A;  3Q8K A;  2IMW P;  1ZET A;  3BDP A;  1TFY A;  1NKB A;  1TK8 A;  1VFG A;  5KTQ A;  4KLT A;  3H40 A;  2NRW A;  3RJH A;  2P6R A;  9ICX A;  5HRE A;  8ICR A;  2FLN A;  2DVI A;  4PGY A;  3KHR A;  3RH6 A;  4NXZ A;  3UQ0 A;  4KLE A;  4ATB B;  4E80 A;  1ZJM A;  3NYB A;  2NRX A;  4BXO B;  4NY8 A;  1NK6 A;  4O0I A;  4B9L A;  2PFQ A;  1Q78 A;  4O5E A;  4ECW A;  4NLN A;  4EBJ A;  4I2G A;  1NK4 A;  4QZC A;  1UEU A;  5DBA A;  3PV8 A;  4LVS A;  5DG8 A;  2ZJA A;  5KG7 A;  1ZYQ A;  1XC9 A;  1Q79 A;  1JXL A;  5DB8 A;  1BPE A;  1N48 A;  2ZJ8 A;  4Z6F A;  4GXJ A;  8ICS A;  5DB7 A;  3EPI A;  5J2D A;  4TUR A;  3GII A;  3OHB A;  1NK7 A;  3UXO A;  4QZA A;  4MEY A;  2WTF A;  3ZDC A;  4ELT A;  5CB1 A;  2ZH7 A;  1PX5 A;  3V7L A;  4EYI B;  3UXP A;  1VJ7 A;  3ORY A;  3AQL A;  4DL3 A;  4QWD A;  4O3R A;  4Q8E A;  1JN3 A;  4R63 A;  5DLF A;  1MQ3 A;  1NK9 A;  2BDP A;  4M0A A;  4MF2 A;  1QSY A;  2HVI A;  4KTQ A;  4RWQ A;  2DRB A;  3AQK A;  4BWJ A;  5KFV A;  1S9F A;  1KLN A;  4UB3 A;  3Q8L A;  4F91 B;  3B0X A;  1QLN A;  9ICG A;  5KT5 A;  8ICN A;  4YR2 A;  2FPL A;  2PFN A;  5KT7 A;  2R8I A;  4ED3 A;  4NLK A;  1X2I A;  2R8G A;  3UPQ A;  4ELU A;  2W9A A;  3LDA A;  4C8K A;  8ICE A;  4ATB A;  1V9P A;  5IIL A;  4X4T A;  3C2K A;  1R8A A;  3RB4 A;  3L9D A;  3JPO A;  2XY5 A;  5C5J A;  3EW9 A;  4F92 B;  4RQ4 A;  4GLX A;  2AGP A;  1ZQI A;  4BXO A;  3EYZ A;  2XCA A;  3MGI A;  3OSN A;  2C28 A;  1ZQC A;  2PI4 A;  2KTQ A;  8ICO A;  1KTQ A;  3ISB A;  5EWG A;  4EEY A;  3HJ4 A;  2RDJ A;  4AT9 B;  3C5G A;  4C8O A;  3ZDA A;  4KLF A;  4FHP A;  1BGX T;  4IR1 A;  4YD1 A;  5J0O A;  4F5O A;  5DG9 A;  4IQT A;  4RPY A;  4KN7 A;  5KG4 A;  4DS5 A;  5EOZ A;  5HML A;  4I2E A;  5HRD A;  5EWE A;  1RXW A;  8ICC A;  9ICU A;  3PMN A;  3RR8 A;  2OWO A;  3HJ1 A;  4DSI A;  9ICA A;  4M2Y A;  1BPB A;  2V9W A;  4EP7 A;  3JPP A;  4UB2 A;  3RR7 A;  3JPR A;  2I1Q A;  2JEG A;  4QZI A;  4KMU A;  3RRG A;  2FMS A;  3Q8M A;  8ICG A;  8ICI A;  5KFJ A;  4UB1 A;  5EWF A;  3PVX A;  4F4K A;  1ZQV A;  5KFP A;  3V72 A;  4J9Q A;  1N56 A;  2JEF A;  4Q44 A;  8ICF A;  4WC2 A;  9ICB A;  5J2F A;  4RT2 A;  1UA0 A;  1TFR A;  3EPG A;  9ICK A;  4I2B A;  5L1K A;  4JUZ A;  2BCR A;  4J9O A;  4DL4 A;  3PX0 A;  5J0X A;  2R8J A;  1RXV A;  3ZDB A;  3JZ0 A;  4AT7 B;  3RBD A;  3RH4 A;  7ICU A;  4RZR A;  2IA6 A;  3TFS A;  4M9G A;  2F1I A;  7ICP A;  4QWC A;  4KLO A;  2VAN A;  5TZV A;  4K4I A;  2H5X A;  1NJZ A;  1NK8 A;  4ECV A;  2ZTE A;  4YFK A;  4AT9 A;  3MR6 A;  5L1I A;  5DEC A;  8ICX A;  5J2A A;  5IIK A;  3TQ1 A;  1NK0 A;  5KFS A;  2NRV A;  3M8S A;  4MEX A;  5KG1 A;  5III A;  1XSN A;  4YCX A;  4B9N A;  4DWI A;  8ICV A;  2M2U A;  2M9N A;  2O1P A;  4EBK A;  5KFG A;  8ICP A;  8ICU A;  4S3N A;  4DOC A;  3PO5 A;  1NKC A;  5KT3 A;  2GWS A;  4KLJ A;  4J9N A;  5HMM A;  4M9J A;  4X5V A;  2O5A A;  7ICR A;  3OVA A;  2ZUB A;  4QWA A;  1SZP A;  4FBT A;  4ECS A;  1ZQD A;  2BQ3 A;  5D4B A;  4O3P A;  2PI5 A;  1S76 D;  2HHV A;  2BCS A;  4O3Q A;  5KG6 A;  4WC3 A;  1ZQH A;  4ECZ A;  2XY7 A;  2BQU A;  3UXN A;  1D8L A;  5KG0 A;  4C8M A;  4CCH A;  3V7K A;  5DG7 A;  1KFS A;  5KFU A;  3HT3 A;  4YP3 A;  1QTM A;  1RPL A;  7ICM A;  2Q66 A;  4AT7 A;  4X4N A;  2AU0 A;  3C21 A;  3EZ5 A;  4M9N A;  5CP2 A;  5J2J A;  5D49 A;  1XU4 A;  1FA0 A;  3ETL A;  4X4U A;  3SZ2 A;  4O3N A;  4P4M A;  4EBE A;  3RH5 A;  4YR0 A;  4UBB A;  3HWT A;  9ICL A;  4YG2 A;  3Q8S B;  1ZQZ A;  1L3T A;  4NM2 A;  4B9V A;  5DB6 A;  3PML A;  3V7J A;  7ICG A;  4Q43 A;  5J0T A;  2W8K A;  1CUK A;  3ISC A;  4B9U A;  4DSK A;  4O5C A;  1T4G A;  2VA8 A;  8ICH A;  3H3A A;  2AJQ A;  3WFP A;  3SI8 A;  3IHQ B;  2DPJ A;  8ICT A;  4C8N A;  5HRK A;  2JEI A;  4JWM A;  1B43 A;  2ZUC A;  4RUC A;  1ZQR A;  2BGW A;  3H8J A;  3V6H A;  1SKR A;  4XUS A;  5BOM A;  4FS2 A;  2VA2 A;  4FHX A;  2C2E A;  4F5N A;  4UAZ A;  7ICF A;  3MFH A;  2UVR A;  5DGA A;  3G6Y A;  3MR2 A;  1NJX A;  4IRC A;  5KFO A;  3G6X A;  3C2L A;  4KLG A;  2HHQ A;  9ICF A;  1Z00 B;  4YXM A;  3PR4 A;  3C23 A;  2HVH A;  3RJJ A;  4P2H A;  3RTV A;  4KLD A;  4DLE A;  1BPZ A;  3H4B A;  1MIY A;  2KFZ A;  2DR5 A;  9ICW A;  2DR8 A;  2P66 A;  4M47 A;  5HRH A;  4X4R A;  3Q8Q B;  1NZP A;  4RQ8 A;  1KFD A;  1S0N A;  1ZQE A;  1S97 A;  4IQV A;  3V6K A;  5J2G A;  4DSJ A;  1F5A A;  1ZQO A;  2FLP A;  5DDY A;  4XRH A;  4FH5 A;  4FH3 A;  4X0B A;  2ZH3 A;  1BNP A;  3FYH A;  5HHI A;  1NOM A;  1RZT A;  4UAY A;  4MFA A;  1MIW A;  5HRB A;  1PZN A;  2DR7 A;  1KDH A;  1K1Q A;  4DSF A;  2MAX A;  1X9W A;  2HHX A;  3BQ1 A;  1XO1 A;  4UB4 A;  4F4Y A;  4DLG A;  2XCP A;  5CA7 A;  5DQI A;  2KZM A;  8ICQ A;  2RDI A;  1D8Y A;  2XY6 A;  1TK0 A;  4QZE A;  2FLL A;  1DOQ A;  2V4R A;  3RAQ A;  4IQW A;  4KLH A;  4ZH4 A;  4O3S A;  1TAQ A;  3BQ0 A;  3JPN A;  3FDS A;  1ARO P;  3T5H A;  7ICT A;  3C1Z A;  5DBC A;  2IHM A;  2ASL A;  7ICV A;  3EWA A;  1B22 A;  4X4Q A;  1TV9 A;  4KLU A;  3WFQ E;  1Z00 A;  2P6U A;  4ECR A;  3E2E A;  4WC4 A;  3QE9 Y;  5J2K A;  4O3O A;  2IBK A;  4F4W A;  4DF4 A;  5KFM A;  9ICC A;  3WFO A;  2ZH6 A;  3Q8R B;  1R89 A;  1L5U A;  3AQN A;  4J9K A;  1ZQJ A;  3KTQ A;  5KFX A;  3OJS A;  1L3U A;  2UVV A;  1IM4 A;  4F4X A;  2KP7 A;  1L3V A;  4RUA A;  2M2V A;  4QWB A;  3BQ2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...