4P2NA

Structure of the p domain from a gi.7 norovirus variant in complex with lex hbga
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
295
structure length
285
Chain Sequence
b'QLTVPNIPLNNLANSRVPAMINKMTVSTDQNQVVQFQNGRCTLEGQLLGTTPVSASQVARIRGKVFSTASGKGLNLTELDGTPYHASPAPLGFPDIGACDWHVSTFKVDQNLSGDPMSRLDVKQNAPFAPHLGSIEFTSDQDPTGDQLGTLAWVSPSTSGARVDPWKIPSYHLAPPIFPPGFGEAIVYFMSDFPIVSGNTAQVPCTLPQEFVSHFVEQQAPVRGEAALLHYVDPDTHRNLGEFKLYPDGFITCVPNTGGGPQNLPTNGVFVFSSWVSRYYQLKPV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Major capsid protein
publication title Structural analysis of determinants of histo-blood group antigen binding specificity in genogroup I noroviruses.
pubmed doi rcsb
source organism Norovirus hu/gi.7/tch-060/usa/2003
molecule tags Viral protein
total genus 63
structure length 285
sequence length 295
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-03-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.120 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Positive stranded ssRNA viruses 4p2nA02
2.40.510.10 Mainly Beta Beta Barrel Nucleoplasmin-like/VP (viral coat and capsid proteins) Positive stranded ssRNA viruses 4p2nA01
2ZL6A 3Q3AA 4Z4RA 3ASTA 4ROXA 2OBTA 4RPBA 4P1VA 3D26A 3PUMA 3SLDA 5F4JA 4WZLA 3Q6RA 4QUZA 3PA1A 4X06A 4P12A 4P25A 5IYPA 4QV2A 4OPOA 3ONYA 4RDLA 5IYRA 4WZKA 4X7DA 4OOSA 5IYNA 4RLZA 5IYWA 5J35A 2ZL5A 4RDKA 4QVAA 3R6JA 3BY2A 4Z4ZA 5HZAA 4Z4TA 3ONUA 3SKBA 3SLNA 3BY1A 3ASPA 4X0CA 4RPDA 3V7AA 3ASSA 5J3OA 2ZL7A 3LQEA 4OOXA 4OOVA 4Z4SA 4Z4WA 4OPSA 4QVJA 4X05A 5BSXA 5BSYA 5HZBA 4P26A 4Z4UA 4X7FA 4OPVA 3Q6QA 4RDJA 5IYQA 3ASQA 4P3IA 3SEJA 3PA2A 4RM0A 4WZTA 3ASRA 4P2NA 3Q38A 3PVDA 2OBSA 2OBRA 4X07A 3Q39A 4OP7A 3PUNA 4WZEA 4Z4VA 5E6TA 5KW9A 3BQJA 4X7EA 4X7CA 3R6KA 3SJPA 1IHMA 5F4OA 3RY8A 3LQ6A 5F4MA 4Z4YA
chains in the Genus database with same CATH superfamily
4II3A 4Z4RA 3ASTA 4ROXA 1PKVA 4TKOB 4N3NA 4X8IA 1XB2A 1EXMA 1P4MA 3VR6A 1W2BB 4AC9A 2RC5A 3GVJA 4R71A 3SLDA 4TMXA 1OB5A 4PC7A 3HAGA 1QUFA 2JJ1A 3ZIAA 3OKXA 2VJIA 1WOPA 4X06A 2ZZQA 4P12A 4RCZA 1D1NA 2BVNA 4OPOA 1CNEA 1JA0A 2V7VA 3ONYA 3MHPA 1IJFA 1U2RA 3JQQA 3WYAA 1S0UA 1DDIA 3G6EB 4DNTB 1QFYA 4XR6A 2DCUA 4RLZA 3V76A 3CC2B 3CCJB 1Q81D 3CCLB 1GO2A 1K73D 3GSIA 4HE5A 1N07A 2Q6IA 3T53B 1I8DA 1E79A 1M90D 4L8JA 4Z4TA 4LBVA 4QFMA 2C2WA 2DOGA 3ONUA 3AGQA 1OHHA 3SLNA 2D74A 3BY1A 1I18A 3W2IA 1FX0A 2C4UA 3CMMA 4PC2A 3AVXA 1XQBA 3FPKA 4XN0A 4YELA 5KNLA 1YJWB 2ZXIA 4M2LA 4B47A 3LQEA 5GV7A 1EP3B 1KRHA 3VNUA 1VLYA 4OOVA 1JNYA 4G7WA 3G05A 4Z4SA 2ZXHA 3T51B 4OPSA 2QTZA 3WXMA 4B4DA 3E1YE 2VJJA 4X05A 1RQPA 2ZZGA 3B8HA 2EFGA 1SKYB 1UD8A 5GV8A 4OPVA 3MCAA 3Q6QA 4HE6A 3A3GA 4U9UA 4Y9UA 1UD2A 3ASQA 4FN5A 1W34A 2W6IA 3QFCA 1CNFA 3PA2A 5FO1A 1WOSA 2YWGA 1V0EA 4UAJA 2PMDA 5KSWB 4XONA 4XNFA 2J7KA 1Y0YA 1ELOA 2M5SA 1FDRA 5HXBA 2VBVA 4WZTA 3OP1A 2F4NA 2X0KA 2HDNB 4TN1A 3ASRA 1FNCA 1WU8A 4AF7A 1ZM9A 2BGIA 4DNRB 1VQ7B 2C5HA 2B7CA 4TT3A 4N3GA 1OB0A 1GAWA 1Q9SA 3CCEB 1VQPB 1OB2A 2YWFA 5A89A 1OGJA 4Z4VA 2CC2A 5E6TA 5TRDA 1F20A 4G6IA 1KK2A 3W2GA 2OTLB 3OFNA 1T6XA 4YALA 3SJZA 1RQRA 4XOTA 1BJKA 4G5GA 4RJLA 3AVUA 1K9MD 1FNDA 1QH0A 2BPOA 2W6JA 4YAOA 3VO2A 3GVLA 2FX3A 2GPJA 4UZUA 2GK6A 3SJPA 1IHMA 1N08A 1WDTA 4IW3B 1UD3A 3WY9A 2CF4A 2GJRA 3J81k 3OEEA 1W35A 3JQPA 4Z4YA 1A8PA 2ZL6A 3ZZTA 4M4SA 5DSZA 4PAAA 2XZOA 1YHQB 3ZZUA 3CB4A 1W9XA 5FNZA 2OBTA 3W5VA 2PLFA 1E43A 3CC7B 4TMWA 1YJ9B 1HVXA 4PC6A 3JU4A 2X3UA 3PUMA 4WWVA 1EFUA 1WSRA 2OK8A 4RD0A 3U2QA 4C43A 3PENA 4P25A 5IYPA 4H9GA 4Q7JB 2VBTA 4ZCLA 2E1BA 4RDLA 4ZGNB 2XZLA 3QFTA 5B6IA 1DDGA 1VQ6B 1CQXA 4YHBA 1Y0RA 5A8AA 4XN3A 1G7SA 1NB0A 1E3XA 1QX4A 5A88A 2QEXB 3W5UA 4XLEA 1Q7YD 1N06A 1VJSA 2DEUA 3A3BA 3WBJA 5HZAA 2CK3A 2KVOA 3CP2A 2B5OA 4MYUA 2D9RA 4ACAA 3A8KA 4RPDA 3ASSA 1JJ2B 4ZCMA 3VNVA 2X6YA 4B3XA 4YAUA 5J3OA 3OW2B 4M1KA 4P22A 1QUEA 1BLIA 1EP1B 5L46A 1N0UA 1EFTA 4B3FX 3ZUGA 4Z4WA 2FVGA 2CNDA 2X85A 4QVJA 2VNKA 4ASUA 1VQOB 2E1RA 1UD4A 1QG0A 4CQJA 5HZBA 4FXUA 2CW5A 4C0SA 1E3ZA 1VF7A 3QFRA 1BX0A 1R5BA 2GK7A 3OPOA 3ZBTA 2VYQA 4RD1A 1YITB 1KK1A 5IYQA 2WPDA 1N0VC 2QDXA 4M0LA 3AVYA 1W0KA 3BCDA 4NCNA 4P6VF 4KKTA 1VLOA 2RC6A 4G7XA 4RM0A 2QTLA 4YXWA 3G4SB 3CD6B 3BNWA 2NV4A 3OJXA 2R6HA 3Q38A 1COWA 2PE3A 2BM0A 4Y7CA 1MRZA 2GJPA 2OBRA 1YX2A 1E1QA 1M1KD 3OW7A 1SKQA 4NBSA 4X07A 2VNHA 2BF4A 4XLAA 1G7RA 1GJRA 1H8EA 4OP7A 3BH4A 4P3YA 5TV2A 4P9SA 4ZGQB 4WQMA 4M53A 1KK3A 4YAFA 3CC4B 4LBWA 5H59A 1T5EA 1FNMA 3A35A 1MABA 3E20A 2DETA 2VBUA 2ZTGA 4X7EA 4XM3A 3OZVA 4RD2A 1NBMA 2DY1A 3R6KA 2XNDA 3GIRA 1YIJB 1KQSB 1H42A 4G1BA 4LBZA 2V7XA 5F4OA 3QE2A 1VQ9B 4XKWA 3RY8A 4G1VA 2XNCA 3ZBUA 2F1MA 5F4MA 3G71B 1SM4A 2QE7A 1KD1D 4AF6A 4LC0A 1J9ZA 3OZUA 3FJOA 4DK1A 3U6BA 1T6ZA 4WZLA 3Q6RA 3B78A 1QGYA 4XKVA 4XQFA 3PA1A 4Y9RA 3WNCA 2ZITA 3GQBA 4PC1A 4QV2A 3B82A 3CP8A 5IYRA 1Q82D 4WZKA 1KTVA 5JBQA 4X7DA 2C77A 1FNBA 4DQLA 3W2EA 1QVGB 1KC8D 4OOSA 5IYNA 2JN9A 4B48A 1TTTA 4PC3A 2XGJA 2Q6LA 1VQ4B 1VQ5B 1S72B 4AVZA 1E63A 2ZL5A 5EMNA 3OAAA 3OOCA 2BM1A 1R5OA 3CPXA 4KKSA 2ZBVA 4QVAA 3CCRB 4XLCA 3BY2A 1E62A 4Z4ZA 3QSYA 3CCUB 2GQFA 2C78A 2WR8A 2OK7A 2EIXA 3KEWA 2F43A 4RD3A 4UZFA 1K28D 3ASPA 4X0CA 4EH1A 1KZLA 3I1FA 3NE5B 4E0FA 2BMWA 1WPCA 1D8TA 1ZUNB 3ES9A 4GQNA 4XOPA 3VO1A 1UD5A 2OTJB 4OOXA 2D3LA 5FO0A 2GREA 5BSXA 2DERA 1TLLA 5BSYA 1AIPA 2HCJB 1VQMB 5FL7A 4P26A 3AVVA 3BC9A 2XNJA 1NDHA 4Z4UA 4X7FA 3AVTA 4J0QA 4K1XA 3WBKA 1JB9A 2Q6KA 2ZBUA 5TY0A 4P3IA 3AGPA 4RCYA 1KK0A 1D2EA 3A8JA 1YJNB 1WORA 2YWEA 3ZZ0A 1YLOA 3CTAA 4RD4A 4XLFA 5CDFA 5FA6A 5H5JA 2XZPA 5IK2A 2X6WA 1EWYA 3OJWA 4FWTA 3I55B 3OEHA 2PIAA 2P3MA 3U6KA 1FRQA 4TSFA 2R9VA 2WJVA 1BMFA 2V4DA 1ZM3A 4Z1MA 4P6YA 1TUIA 2WSSA 1YI2B 1QVFB 2V7WA 2V7TA 1BX1A 2CRVA 4F7DA 5KW9A 3QFSA 2VNJA 3H94A 3BQJA 4PABA 2B7BA 3W5HA 5AN9A 4II2A 3W2HA 1WSVA 1S4MA 4X7CA 1EFCA 3AVWA 4B3GA 3CRZA 2V7QA 3JQRA 1NRKA 4B44A 1VHEA 3LNNA 3LQ6A 1BPLA 2VZLA 2BSAA 3LVBA 1XFOA 3Q3AA 1N8RD 4ZV4A 1HA3A 4RPBA 4P1VA 3I56B 4XMYA 1K8AD 3D26A 1ZM2A 2DYIA 2WYRA 3VMFA 1QGAA 1QGZA 2Z6BD 1V0FA 5F4JA 3WNDA 1G7CA 4QUZA 1I7PA 1WP6A 3CPWB 3ZPNA 2WZNA 1QFJA 3T56B 4LBYA 1W87A 4PGOA 4NNJA 3CMAB 3A1PA 5IYWA 4TMZA 1F60A 2QGGA 4YEJA 5J35A 1T6YA 4RDKA 1W0JA 2BN4A 2XEXA 1PJ7A 3R6JA 4JMQA 1V5VA 2ZZEA 2C4TA 3DDYA 1ZM4A 2YWHA 1R5NA 3SKBA 3CXCB 1EFRA 5TR9A 4XLHA 1E1RA 3V7AA 1XE1A 2QMUA 3WNBA 2LZJA 2HMAA 4DQKA 3CCQB 2ZL7A 1UD6A 2VNIA 1WOOA 3A8IA 2F1LA 1AMOA 1VHOA 3CCSB 1DARA 2BV3A 1QFZA 1EP2B 1B23P 1VQ8B 2X53S 3OZWA 3W2FA 2ZTNA 5HKKA 2D3NA 4DK0A 2AHOA 2Q6OA 1PJ5A 2WJYA 4QHYA 5DN6A 2JIZA 2X8KA 2HLDA 3CCMB 3ISXA 4RD6A 4B43A 3H9NA 3ZC3A 3CCVB 3CESA 1E64A 4RDJA 2X6XA 1KMHA 5LMZA 1HZEA 4ZCIA 1Q86D 3SEJA 3BCFA 3FKSA 3WQZA 3CW2A 1VQLB 1VQNB 1IJEA 2V7UA 4XL9A 2JJ2A 4TMTA 1DG1G 2VBSA 3KL9A 5FIUA 2GJKA 1VQKB 2I1LA 4P2NA 1FRNA 3MMPA 1BQEA 4TMVA 5THXA 3PVDA 1GAQA 2C5BA 4XORA 2OBSA 1NB9A 2DIEA 1GVHA 1KJZA 2ZZFA 1WTHD 3Q39A 1OGIA 3LO8A 3PUNA 4WZEA 1JA1A 4UZEA 2V31A 1H8HA 2QN6A 3P27A 3CMEB 4XD7A 4YAWA 1G7TA 4ACBA 1GR1A 3P26A 2WZPP 2QA4B 1UMKA 4KKUA 4FK8A 4HIZA 2BGJA 3GVKA 1TVCA 2CBXA 4MYTA 4BPRA 2NPFA 1H85A 1PJ6A 2OYNA 3FPPA 1IB0A 1B2RA 2XOKA 1NJID 3OE7A 1N05A 5DS0A 2JDIA
chains in the Genus database with same CATH topology
2ZL6A 3Q3AA 4Z4RA 3ASTA 4ROXA 2OBTA 4RPBA 4P1VA 3D26A 3PUMA 3SLDA 5F4JA 4WZLA 3Q6RA 4QUZA 3PA1A 4X06A 4P12A 4P25A 5IYPA 4QV2A 4OPOA 3ONYA 4RDLA 5IYRA 4WZKA 4X7DA 4OOSA 5IYNA 4RLZA 5IYWA 5J35A 2ZL5A 4RDKA 4QVAA 3R6JA 3BY2A 4Z4ZA 5HZAA 4Z4TA 3ONUA 3SKBA 3SLNA 3BY1A 3ASPA 4X0CA 4RPDA 3V7AA 3ASSA 5J3OA 2ZL7A 3LQEA 4OOXA 4OOVA 4Z4SA 4Z4WA 4OPSA 4QVJA 4X05A 5BSXA 5BSYA 5HZBA 4P26A 4Z4UA 4X7FA 4OPVA 3Q6QA 4RDJA 5IYQA 3ASQA 4P3IA 3SEJA 3PA2A 4RM0A 4WZTA 3ASRA 4P2NA 3Q38A 3PVDA 2OBSA 2OBRA 4X07A 3Q39A 4OP7A 3PUNA 4WZEA 4Z4VA 5E6TA 5KW9A 3BQJA 4X7EA 4X7CA 3R6KA 3SJPA 1IHMA 5F4OA 3RY8A 3LQ6A 5F4MA 4Z4YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZL6 A;  3Q3A A;  4Z4R A;  3AST A;  4ROX A;  2OBT A;  4RPB A;  4P1V A;  3D26 A;  3PUM A;  3SLD A;  5F4J A;  4WZL A;  3Q6R A;  4QUZ A;  3PA1 A;  4X06 A;  4P12 A;  4P25 A;  5IYP A;  4QV2 A;  4OPO A;  3ONY A;  4RDL A;  5IYR A;  4WZK A;  4X7D A;  4OOS A;  5IYN A;  4RLZ A;  5IYW A;  5J35 A;  2ZL5 A;  4RDK A;  4QVA A;  3R6J A;  3BY2 A;  4Z4Z A;  5HZA A;  4Z4T A;  3ONU A;  3SKB A;  3SLN A;  3BY1 A;  3ASP A;  4X0C A;  4RPD A;  3V7A A;  3ASS A;  5J3O A;  2ZL7 A;  3LQE A;  4OOX A;  4OOV A;  4Z4S A;  4Z4W A;  4OPS A;  4QVJ A;  4X05 A;  5BSX A;  5BSY A;  5HZB A;  4P26 A;  4Z4U A;  4X7F A;  4OPV A;  3Q6Q A;  4RDJ A;  5IYQ A;  3ASQ A;  4P3I A;  3SEJ A;  3PA2 A;  4RM0 A;  4WZT A;  3ASR A;  4P2N A;  3Q38 A;  3PVD A;  2OBS A;  2OBR A;  4X07 A;  3Q39 A;  4OP7 A;  3PUN A;  4WZE A;  4Z4V A;  5E6T A;  5KW9 A;  3BQJ A;  4X7E A;  4X7C A;  3R6K A;  3SJP A;  1IHM A;  5F4O A;  3RY8 A;  3LQ6 A;  5F4M A;  4Z4Y A; 
#chains in the Genus database with same CATH topology
 4II3 A;  4Z4R A;  3AST A;  4ROX A;  1PKV A;  4TKO B;  4N3N A;  4X8I A;  1XB2 A;  1EXM A;  1P4M A;  3VR6 A;  1W2B B;  4AC9 A;  2RC5 A;  3GVJ A;  4R71 A;  3SLD A;  4TMX A;  1OB5 A;  4PC7 A;  3HAG A;  1QUF A;  2JJ1 A;  3ZIA A;  3OKX A;  2VJI A;  1WOP A;  4X06 A;  2ZZQ A;  4P12 A;  4RCZ A;  1D1N A;  2BVN A;  4OPO A;  1CNE A;  1JA0 A;  2V7V A;  3ONY A;  3MHP A;  1IJF A;  1U2R A;  3JQQ A;  3WYA A;  1S0U A;  1DDI A;  3G6E B;  4DNT B;  1QFY A;  4XR6 A;  2DCU A;  4RLZ A;  3V76 A;  3CC2 B;  3CCJ B;  1Q81 D;  3CCL B;  1GO2 A;  1K73 D;  3GSI A;  4HE5 A;  1N07 A;  2Q6I A;  3T53 B;  1I8D A;  1E79 A;  1M90 D;  4L8J A;  4Z4T A;  4LBV A;  4QFM A;  2C2W A;  2DOG A;  3ONU A;  3AGQ A;  1OHH A;  3SLN A;  2D74 A;  3BY1 A;  1I18 A;  3W2I A;  1FX0 A;  2C4U A;  3CMM A;  4PC2 A;  3AVX A;  1XQB A;  3FPK A;  4XN0 A;  4YEL A;  5KNL A;  1YJW B;  2ZXI A;  4M2L A;  4B47 A;  3LQE A;  5GV7 A;  1EP3 B;  1KRH A;  3VNU A;  1VLY A;  4OOV A;  1JNY A;  4G7W A;  3G05 A;  4Z4S A;  2ZXH A;  3T51 B;  4OPS A;  2QTZ A;  3WXM A;  4B4D A;  3E1Y E;  2VJJ A;  4X05 A;  1RQP A;  2ZZG A;  3B8H A;  2EFG A;  1SKY B;  1UD8 A;  5GV8 A;  4OPV A;  3MCA A;  3Q6Q A;  4HE6 A;  3A3G A;  4U9U A;  4Y9U A;  1UD2 A;  3ASQ A;  4FN5 A;  1W34 A;  2W6I A;  3QFC A;  1CNF A;  3PA2 A;  5FO1 A;  1WOS A;  2YWG A;  1V0E A;  4UAJ A;  2PMD A;  5KSW B;  4XON A;  4XNF A;  2J7K A;  1Y0Y A;  1ELO A;  2M5S A;  1FDR A;  5HXB A;  2VBV A;  4WZT A;  3OP1 A;  2F4N A;  2X0K A;  2HDN B;  4TN1 A;  3ASR A;  1FNC A;  1WU8 A;  4AF7 A;  1ZM9 A;  2BGI A;  4DNR B;  1VQ7 B;  2C5H A;  2B7C A;  4TT3 A;  4N3G A;  1OB0 A;  1GAW A;  1Q9S A;  3CCE B;  1VQP B;  1OB2 A;  2YWF A;  5A89 A;  1OGJ A;  4Z4V A;  2CC2 A;  5E6T A;  5TRD A;  1F20 A;  4G6I A;  1KK2 A;  3W2G A;  2OTL B;  3OFN A;  1T6X A;  4YAL A;  3SJZ A;  1RQR A;  4XOT A;  1BJK A;  4G5G A;  4RJL A;  3AVU A;  1K9M D;  1FND A;  1QH0 A;  2BPO A;  2W6J A;  4YAO A;  3VO2 A;  3GVL A;  2FX3 A;  2GPJ A;  4UZU A;  2GK6 A;  3SJP A;  1IHM A;  1N08 A;  1WDT A;  4IW3 B;  1UD3 A;  3WY9 A;  2CF4 A;  2GJR A;  3J81 k;  3OEE A;  1W35 A;  3JQP A;  4Z4Y A;  1A8P A;  2ZL6 A;  3ZZT A;  4M4S A;  5DSZ A;  4PAA A;  2XZO A;  1YHQ B;  3ZZU A;  3CB4 A;  1W9X A;  5FNZ A;  2OBT A;  3W5V A;  2PLF A;  1E43 A;  3CC7 B;  4TMW A;  1YJ9 B;  1HVX A;  4PC6 A;  3JU4 A;  2X3U A;  3PUM A;  4WWV A;  1EFU A;  1WSR A;  2OK8 A;  4RD0 A;  3U2Q A;  4C43 A;  3PEN A;  4P25 A;  5IYP A;  4H9G A;  4Q7J B;  2VBT A;  4ZCL A;  2E1B A;  4RDL A;  4ZGN B;  2XZL A;  3QFT A;  5B6I A;  1DDG A;  1VQ6 B;  1CQX A;  4YHB A;  1Y0R A;  5A8A A;  4XN3 A;  1G7S A;  1NB0 A;  1E3X A;  1QX4 A;  5A88 A;  2QEX B;  3W5U A;  4XLE A;  1Q7Y D;  1N06 A;  1VJS A;  2DEU A;  3A3B A;  3WBJ A;  5HZA A;  2CK3 A;  2KVO A;  3CP2 A;  2B5O A;  4MYU A;  2D9R A;  4ACA A;  3A8K A;  4RPD A;  3ASS A;  1JJ2 B;  4ZCM A;  3VNV A;  2X6Y A;  4B3X A;  4YAU A;  5J3O A;  3OW2 B;  4M1K A;  4P22 A;  1QUE A;  1BLI A;  1EP1 B;  5L46 A;  1N0U A;  1EFT A;  4B3F X;  3ZUG A;  4Z4W A;  2FVG A;  2CND A;  2X85 A;  4QVJ A;  2VNK A;  4ASU A;  1VQO B;  2E1R A;  1UD4 A;  1QG0 A;  4CQJ A;  5HZB A;  4FXU A;  2CW5 A;  4C0S A;  1E3Z A;  1VF7 A;  3QFR A;  1BX0 A;  1R5B A;  2GK7 A;  3OPO A;  3ZBT A;  2VYQ A;  4RD1 A;  1YIT B;  1KK1 A;  5IYQ A;  2WPD A;  1N0V C;  2QDX A;  4M0L A;  3AVY A;  1W0K A;  3BCD A;  4NCN A;  4P6V F;  4KKT A;  1VLO A;  2RC6 A;  4G7X A;  4RM0 A;  2QTL A;  4YXW A;  3G4S B;  3CD6 B;  3BNW A;  2NV4 A;  3OJX A;  2R6H A;  3Q38 A;  1COW A;  2PE3 A;  2BM0 A;  4Y7C A;  1MRZ A;  2GJP A;  2OBR A;  1YX2 A;  1E1Q A;  1M1K D;  3OW7 A;  1SKQ A;  4NBS A;  4X07 A;  2VNH A;  2BF4 A;  4XLA A;  1G7R A;  1GJR A;  1H8E A;  4OP7 A;  3BH4 A;  4P3Y A;  5TV2 A;  4P9S A;  4ZGQ B;  4WQM A;  4M53 A;  1KK3 A;  4YAF A;  3CC4 B;  4LBW A;  5H59 A;  1T5E A;  1FNM A;  3A35 A;  1MAB A;  3E20 A;  2DET A;  2VBU A;  2ZTG A;  4X7E A;  4XM3 A;  3OZV A;  4RD2 A;  1NBM A;  2DY1 A;  3R6K A;  2XND A;  3GIR A;  1YIJ B;  1KQS B;  1H42 A;  4G1B A;  4LBZ A;  2V7X A;  5F4O A;  3QE2 A;  1VQ9 B;  4XKW A;  3RY8 A;  4G1V A;  2XNC A;  3ZBU A;  2F1M A;  5F4M A;  3G71 B;  1SM4 A;  2QE7 A;  1KD1 D;  4AF6 A;  4LC0 A;  1J9Z A;  3OZU A;  3FJO A;  4DK1 A;  3U6B A;  1T6Z A;  4WZL A;  3Q6R A;  3B78 A;  1QGY A;  4XKV A;  4XQF A;  3PA1 A;  4Y9R A;  3WNC A;  2ZIT A;  3GQB A;  4PC1 A;  4QV2 A;  3B82 A;  3CP8 A;  5IYR A;  1Q82 D;  4WZK A;  1KTV A;  5JBQ A;  4X7D A;  2C77 A;  1FNB A;  4DQL A;  3W2E A;  1QVG B;  1KC8 D;  4OOS A;  5IYN A;  2JN9 A;  4B48 A;  1TTT A;  4PC3 A;  2XGJ A;  2Q6L A;  1VQ4 B;  1VQ5 B;  1S72 B;  4AVZ A;  1E63 A;  2ZL5 A;  5EMN A;  3OAA A;  3OOC A;  2BM1 A;  1R5O A;  3CPX A;  4KKS A;  2ZBV A;  4QVA A;  3CCR B;  4XLC A;  3BY2 A;  1E62 A;  4Z4Z A;  3QSY A;  3CCU B;  2GQF A;  2C78 A;  2WR8 A;  2OK7 A;  2EIX A;  3KEW A;  2F43 A;  4RD3 A;  4UZF A;  1K28 D;  3ASP A;  4X0C A;  4EH1 A;  1KZL A;  3I1F A;  3NE5 B;  4E0F A;  2BMW A;  1WPC A;  1D8T A;  1ZUN B;  3ES9 A;  4GQN A;  4XOP A;  3VO1 A;  1UD5 A;  2OTJ B;  4OOX A;  2D3L A;  5FO0 A;  2GRE A;  5BSX A;  2DER A;  1TLL A;  5BSY A;  1AIP A;  2HCJ B;  1VQM B;  5FL7 A;  4P26 A;  3AVV A;  3BC9 A;  2XNJ A;  1NDH A;  4Z4U A;  4X7F A;  3AVT A;  4J0Q A;  4K1X A;  3WBK A;  1JB9 A;  2Q6K A;  2ZBU A;  5TY0 A;  4P3I A;  3AGP A;  4RCY A;  1KK0 A;  1D2E A;  3A8J A;  1YJN B;  1WOR A;  2YWE A;  3ZZ0 A;  1YLO A;  3CTA A;  4RD4 A;  4XLF A;  5CDF A;  5FA6 A;  5H5J A;  2XZP A;  5IK2 A;  2X6W A;  1EWY A;  3OJW A;  4FWT A;  3I55 B;  3OEH A;  2PIA A;  2P3M A;  3U6K A;  1FRQ A;  4TSF A;  2R9V A;  2WJV A;  1BMF A;  2V4D A;  1ZM3 A;  4Z1M A;  4P6Y A;  1TUI A;  2WSS A;  1YI2 B;  1QVF B;  2V7W A;  2V7T A;  1BX1 A;  2CRV A;  4F7D A;  5KW9 A;  3QFS A;  2VNJ A;  3H94 A;  3BQJ A;  4PAB A;  2B7B A;  3W5H A;  5AN9 A;  4II2 A;  3W2H A;  1WSV A;  1S4M A;  4X7C A;  1EFC A;  3AVW A;  4B3G A;  3CRZ A;  2V7Q A;  3JQR A;  1NRK A;  4B44 A;  1VHE A;  3LNN A;  3LQ6 A;  1BPL A;  2VZL A;  2BSA A;  3LVB A;  1XFO A;  3Q3A A;  1N8R D;  4ZV4 A;  1HA3 A;  4RPB A;  4P1V A;  3I56 B;  4XMY A;  1K8A D;  3D26 A;  1ZM2 A;  2DYI A;  2WYR A;  3VMF A;  1QGA A;  1QGZ A;  2Z6B D;  1V0F A;  5F4J A;  3WND A;  1G7C A;  4QUZ A;  1I7P A;  1WP6 A;  3CPW B;  3ZPN A;  2WZN A;  1QFJ A;  3T56 B;  4LBY A;  1W87 A;  4PGO A;  4NNJ A;  3CMA B;  3A1P A;  5IYW A;  4TMZ A;  1F60 A;  2QGG A;  4YEJ A;  5J35 A;  1T6Y A;  4RDK A;  1W0J A;  2BN4 A;  2XEX A;  1PJ7 A;  3R6J A;  4JMQ A;  1V5V A;  2ZZE A;  2C4T A;  3DDY A;  1ZM4 A;  2YWH A;  1R5N A;  3SKB A;  3CXC B;  1EFR A;  5TR9 A;  4XLH A;  1E1R A;  3V7A A;  1XE1 A;  2QMU A;  3WNB A;  2LZJ A;  2HMA A;  4DQK A;  3CCQ B;  2ZL7 A;  1UD6 A;  2VNI A;  1WOO A;  3A8I A;  2F1L A;  1AMO A;  1VHO A;  3CCS B;  1DAR A;  2BV3 A;  1QFZ A;  1EP2 B;  1B23 P;  1VQ8 B;  2X53 S;  3OZW A;  3W2F A;  2ZTN A;  5HKK A;  2D3N A;  4DK0 A;  2AHO A;  2Q6O A;  1PJ5 A;  2WJY A;  4QHY A;  5DN6 A;  2JIZ A;  2X8K A;  2HLD A;  3CCM B;  3ISX A;  4RD6 A;  4B43 A;  3H9N A;  3ZC3 A;  3CCV B;  3CES A;  1E64 A;  4RDJ A;  2X6X A;  1KMH A;  5LMZ A;  1HZE A;  4ZCI A;  1Q86 D;  3SEJ A;  3BCF A;  3FKS A;  3WQZ A;  3CW2 A;  1VQL B;  1VQN B;  1IJE A;  2V7U A;  4XL9 A;  2JJ2 A;  4TMT A;  1DG1 G;  2VBS A;  3KL9 A;  5FIU A;  2GJK A;  1VQK B;  2I1L A;  4P2N A;  1FRN A;  3MMP A;  1BQE A;  4TMV A;  5THX A;  3PVD A;  1GAQ A;  2C5B A;  4XOR A;  2OBS A;  1NB9 A;  2DIE A;  1GVH A;  1KJZ A;  2ZZF A;  1WTH D;  3Q39 A;  1OGI A;  3LO8 A;  3PUN A;  4WZE A;  1JA1 A;  4UZE A;  2V31 A;  1H8H A;  2QN6 A;  3P27 A;  3CME B;  4XD7 A;  4YAW A;  1G7T A;  4ACB A;  1GR1 A;  3P26 A;  2WZP P;  2QA4 B;  1UMK A;  4KKU A;  4FK8 A;  4HIZ A;  2BGJ A;  3GVK A;  1TVC A;  2CBX A;  4MYT A;  4BPR A;  2NPF A;  1H85 A;  1PJ6 A;  2OYN A;  3FPP A;  1IB0 A;  1B2R A;  2XOK A;  1NJI D;  3OE7 A;  1N05 A;  5DS0 A;  2JDI A; 
#chains in the Genus database with same CATH homology
 2ZL6 A;  3Q3A A;  4Z4R A;  3AST A;  4ROX A;  2OBT A;  4RPB A;  4P1V A;  3D26 A;  3PUM A;  3SLD A;  5F4J A;  4WZL A;  3Q6R A;  4QUZ A;  3PA1 A;  4X06 A;  4P12 A;  4P25 A;  5IYP A;  4QV2 A;  4OPO A;  3ONY A;  4RDL A;  5IYR A;  4WZK A;  4X7D A;  4OOS A;  5IYN A;  4RLZ A;  5IYW A;  5J35 A;  2ZL5 A;  4RDK A;  4QVA A;  3R6J A;  3BY2 A;  4Z4Z A;  5HZA A;  4Z4T A;  3ONU A;  3SKB A;  3SLN A;  3BY1 A;  3ASP A;  4X0C A;  4RPD A;  3V7A A;  3ASS A;  5J3O A;  2ZL7 A;  3LQE A;  4OOX A;  4OOV A;  4Z4S A;  4Z4W A;  4OPS A;  4QVJ A;  4X05 A;  5BSX A;  5BSY A;  5HZB A;  4P26 A;  4Z4U A;  4X7F A;  4OPV A;  3Q6Q A;  4RDJ A;  5IYQ A;  3ASQ A;  4P3I A;  3SEJ A;  3PA2 A;  4RM0 A;  4WZT A;  3ASR A;  4P2N A;  3Q38 A;  3PVD A;  2OBS A;  2OBR A;  4X07 A;  3Q39 A;  4OP7 A;  3PUN A;  4WZE A;  4Z4V A;  5E6T A;  5KW9 A;  3BQJ A;  4X7E A;  4X7C A;  3R6K A;  3SJP A;  1IHM A;  5F4O A;  3RY8 A;  3LQ6 A;  5F4M A;  4Z4Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...