4P2NA

Structure of the p domain from a gi.7 norovirus variant in complex with lex hbga
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
295
structure length
285
Chain Sequence
QLTVPNIPLNNLANSRVPAMINKMTVSTDQNQVVQFQNGRCTLEGQLLGTTPVSASQVARIRGKVFSTASGKGLNLTELDGTPYHASPAPLGFPDIGACDWHVSTFKVDQNLSGDPMSRLDVKQNAPFAPHLGSIEFTSDQDPTGDQLGTLAWVSPSTSGARVDPWKIPSYHLAPPIFPPGFGEAIVYFMSDFPIVSGNTAQVPCTLPQEFVSHFVEQQAPVRGEAALLHYVDPDTHRNLGEFKLYPDGFITCVPNTGGGPQNLPTNGVFVFSSWVSRYYQLKPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Major capsid protein
publication title Structural analysis of determinants of histo-blood group antigen binding specificity in genogroup I noroviruses.
pubmed doi rcsb
source organism Norovirus hu/gi.7/tch-060/usa/2003
molecule tags Viral protein
total genus 63
structure length 285
sequence length 295
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-03-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.120 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Positive stranded ssRNA viruses 4p2nA02
2.40.510.10 Mainly Beta Beta Barrel Nucleoplasmin-like/VP (viral coat and capsid proteins) Positive stranded ssRNA viruses 4p2nA01
4RPBA 4RLZA 4OPVA 3ONYA 4Z4WA 3R6JA 5IYRA 5BSYA 4Z4RA 3ONUA 3LQEA 4RDJA 5BSXA 5J35A 5HZAA 4OPOA 3ASPA 4P1VA 3SJPA 4OOSA 3SLDA 4RDLA 4X7DA 4Z4SA 4Z4YA 4RM0A 3Q38A 3BY1A 3PUNA 3BY2A 3Q3AA 4X05A 2OBRA 5IYQA 3Q6QA 5E6TA 3SEJA 4RPDA 5KW9A 5F4OA 4Z4UA 1IHMA 4OP7A 5HZBA 4OPSA 5IYWA 4Z4ZA 3V7AA 4QVAA 4X07A 4WZEA 4OOXA 2ZL6A 3PA1A 4P3IA 4X7CA 4OOVA 2OBSA 3PVDA 3RY8A 2ZL5A 3ASTA 3Q6RA 3BQJA 3Q39A 2OBTA 3ASRA 5IYPA 4X06A 3LQ6A 5F4MA 4WZLA 5F4JA 4WZTA 3PA2A 4P2NA 3SLNA 4RDKA 4P25A 5IYNA 3D26A 4ROXA 5J3OA 4P26A 3ASQA 4X7FA 3SKBA 4P12A 4QV2A 4X0CA 3PUMA 4QUZA 3ASSA 4X7EA 4Z4VA 2ZL7A 4WZKA 4QVJA 4Z4TA 3R6KA
chains in the Genus database with same CATH superfamily
2VNIA 4PC6A 4RLZA 4FK8A 3OJXA 2OTLB 5FO0A 4XKWA 5A89A 1FDRA 3AVYA 4M1KA 3LO8A 3ONYA 1YI2B 1KK1A 2GK7A 3QSYA 2WR8A 3ZBTA 4Z4WA 1H8HA 1QH0A 3CC7B 4Y9RA 3ONUA 2GREA 1S0UA 2HMAA 4RDJA 1FX0A 3CCSB 4PABA 3ASPA 1KTVA 1EP2B 4P1VA 3V76A 1IJEA 1V0FA 2VYQA 2B7CA 3SLDA 4MYUA 1NBMA 3AVWA 4RDLA 2DETA 1IJFA 2XNCA 3G05A 4YEJA 1QGYA 2ZZGA 2GJPA 5A8AA 3A1PA 2J7KA 1DDGA 4YELA 2P3MA 1WSVA 2W6IA 3B8HA 1RQPA 3OZWA 1PJ5A 4DNRB 1BPLA 1U2RA 2ZTNA 1YIJB 1Q81D 1M90D 4R71A 4X05A 3A3GA 3VR6A 2GK6A 3GVJA 3CC4B 2PLFA 5IYQA 2CBXA 1BJKA 3AGQA 4K1XA 1NJID 4YALA 3QE2A 1KRHA 1T5EA 4XD7A 4G7XA 1YX2A 3W5UA 1IHMA 1QG0A 2Q6LA 1KQSB 2BN4A 4HIZA 4Z4ZA 1BMFA 2BM0A 4TMVA 2CK3A 3WNDA 3P27A 1W34A 3ES9A 3H94A 3CTAA 3WY9A 4BPRA 2RC5A 1JA0A 2VBTA 4XM3A 2QDXA 5KSWB 1VQ7B 3VNUA 3OE7A 2BF4A 1JNYA 3JU4A 1HZEA 2X0KA 2C77A 4GQNA 4N3GA 5LMZA 4XNFA 1G7RA 1YITB 1FNCA 4XQFA 2OBTA 4DK1A 2B7BA 4P9SA 4B3FX 1H85A 4M0LA 4X06A 2CRVA 4WZLA 1ZM2A 5F4JA 3FPPA 3ZIAA 3ISXA 4XOTA 4M53A 3HAGA 4ZCLA 1J9ZA 2NV4A 3GIRA 2XGJA 2HDNB 3BH4A 4ROXA 1OHHA 3ZZTA 1EFCA 2AHOA 4X7FA 4C43A 3SKBA 1E3XA 2DCUA 4RCZA 2GPJA 2DEUA 4RD0A 5KNLA 1W0JA 3BCFA 5DSZA 1YJ9B 1D2EA 4RD3A 2QTZA 1VF7A 2FVGA 4QUZA 2F1LA 1VHOA 4ZGQB 1EP1B 1MRZA 2KVOA 3BC9A 1E1QA 3OFNA 4II2A 2V4DA 3QFRA 1WORA 4H9GA 3VO2A 3WBJA 1KC8D 3R6KA 1R5NA 2ZBVA 4YAWA 3FKSA 2C78A 1I18A 5IK2A 1IB0A 2X8KA 1K73D 5GV7A 3A8IA 1EWYA 5BSYA 4Z4RA 1VQ5B 3WNCA 1QGAA 3LQEA 5BSXA 2QTLA 4Q7JB 3MHPA 2GJRA 5HZAA 1QUEA 2ZITA 1T6YA 2HLDA 2XZOA 3CMAB 2EIXA 1Q86D 1WOOA 1N0VC 1QFYA 1VLOA 2ZZEA 1N07A 2VNJA 2OTJB 2V7UA 4F7DA 2X85A 1D1NA 1UD2A 1QVFB 2Z6BD 3OW7A 4FXUA 1KJZA 1T6XA 3DDYA 2V7QA 1WOSA 3CB4A 5L46A 3ZZUA 4Z4SA 3FPKA 4RM0A 3CPXA 2VNHA 2BM1A 3VNVA 3CCEB 2C4UA 5JBQA 1K8AD 2JIZA 1WOPA 1VQOB 1EFTA 4KKTA 2C2WA 3A8KA 4Y7CA 4TSFA 4M2LA 2BSAA 4QHYA 1TVCA 1VQLB 1BX0A 1H8EA 5E6TA 4TKOB 1FNMA 5F4OA 4Z4UA 1UD6A 1UD4A 5IYWA 5AN9A 3BCDA 3WNBA 1GAWA 3NE5B 1P4MA 3OP1A 4OOXA 3CC2B 4XMYA 3OKXA 4L8JA 2BGIA 1N05A 1WTHD 5B6IA 1FRQA 1ELOA 4X7CA 4LBVA 1KK2A 3CCMB 4RJLA 3OEEA 3CCUB 2YWFA 2PE3A 2ZXIA 2YWHA 1OB2A 1UD5A 4PC7A 4OOVA 3ZPNA 1F60A 2ZL5A 2CNDA 4YHBA 2BVNA 5DN6A 3J81k 5A88A 3KEWA 3OJWA 4UZFA 4AVZA 5TV2A 3ZC3A 2X6XA 1UD3A 3LQ6A 1Q9SA 5F4MA 1HA3A 2EFGA 1RQRA 3PA2A 1N8RD 4XLAA 1UMKA 4B47A 3GVKA 4MYTA 4RDKA 4XLHA 1SKYB 3OW2B 1YJWB 1S4MA 3D26A 4G7WA 4DK0A 4P26A 1Q82D 5GV8A 2WZPP 3I56B 1ZUNB 1GJRA 3WXMA 4RD6A 5THXA 1VQ4B 4TMTA 1V5VA 4X0CA 3PUMA 3QFTA 2BGJA 3OEHA 3LNNA 3G4SB 4NCNA 3CP8A 1EFRA 2QN6A 4X7EA 2X53S 2F1MA 3VMFA 2ZL7A 4WZKA 4UZEA 1CNEA 4QFMA 3CPWB 1WU8A 1PJ6A 3LVBA 2XOKA 2R9VA 3OPOA 4UZUA 1PJ7A 3CCVB 1UD8A 3T51B 1TTTA 1WSRA 1XB2A 3H9NA 3OZUA 4LBZA 3W5VA 3A8JA 2DYIA 4B3XA 4YAUA 1HVXA 1FNBA 2XNDA 3QFSA 2NPFA 1GVHA 2V31A 3R6JA 2QA4B 1KK0A 2OYNA 2Q6IA 2WPDA 2X6WA 2V7XA 4ZGNB 3U6BA 1B2RA 1ZM4A 2I1LA 4N3NA 1VHEA 2Q6OA 2R6HA 5J35A 4XLFA 1WP6A 2F4NA 4OPOA 1E79A 1ZM9A 4Z1MA 3WBKA 1G7CA 2XEXA 3MCAA 1OB0A 4OOSA 2WYRA 4XL9A 3CCRB 3CD6B 1BLIA 3P26A 1FNDA 1W35A 1YLOA 2OK8A 4XKVA 4PC3A 4TN1A 4PGOA 1QX4A 3CCLB 4X7DA 4Z4YA 3WYAA 3Q38A 1I8DA 3BY1A 3PUNA 3E1YE 3AVVA 3W2IA 1Y0YA 4X8IA 1JB9A 1W2BB 2OBRA 4FWTA 1E64A 1VQ6B 2VJJA 4XORA 3CCJB 2VZLA 2W6JA 3CRZA 4B44A 4RPDA 1DARA 4RD1A 2DOGA 2YWGA 1B23P 1Q7YD 4XLCA 2XZPA 2GQFA 2D9RA 3T53B 2V7WA 1OGIA 4X07A 4WZEA 4ACAA 3CESA 1DG1G 4EH1A 4LBYA 3W2GA 5FA6A 1N08A 2VBUA 1T6ZA 3PA1A 4LC0A 4ZCIA 4P3IA 5TY0A 5H5JA 4ZCMA 1W87A 3OAAA 2ZXHA 4XONA 4B48A 5EMNA 1XE1A 1BX1A 1A8PA 1E3ZA 1R5OA 3GVLA 1QUFA 2X6YA 2VNKA 2OBSA 3T56B 1D8TA 2JJ1A 2VBVA 1KZLA 2LZJA 3ASTA 1F20A 3PVDA 4G6IA 3Q6RA 5FNZA 3BQJA 1COWA 4TT3A 1MABA 3Q39A 1NDHA 4RCYA 4U9UA 3ASRA 2DIEA 2OK7A 3CW2A 4WWVA 1JA1A 5FL7A 4HE6A 3AVTA 2QMUA 2RC6A 2D3NA 2C5BA 3W5HA 3G6EB 4XLEA 4WZTA 2BMWA 4TMXA 4DNTB 3FJOA 4AF6A 3JQRA 2ZZFA 3B82A 1KMHA 1W0KA 5IYNA 1DDIA 2WJVA 2WSSA 1PKVA 1S72B 3W2FA 1H42A 1VQKB 4E0FA 4KKUA 1TLLA 2QEXB 2FX3A 4QV2A 3BNWA 1EFUA 1EXMA 2BPOA 1XFOA 1ZM3A 3ZUGA 2PMDA 3VO1A 2JN9A 2B5OA 3CP2A 4NBSA 2WJYA 4G5GA 4QVJA 2PIAA 3G71B 1NB0A 2D3LA 3WQZA 1I7PA 5HKKA 2JJ2A 4Z4TA 4RPBA 1TUIA 1N06A 4J0QA 1V0EA 3CCQB 5TR9A 2F43A 1VQMB 4AF7A 4OPVA 4RD4A 1VQPB 1VQ9B 1BQEA 1SM4A 1VJSA 4PAAA 1GAQA 1GO2A 3A35A 4KKSA 2JDIA 5IYRA 1OGJA 2D74A 3I55B 4PC1A 5HXBA 1CNFA 3A3BA 4NNJA 2VJIA 1SKQA 4HE5A 4XN0A 4TMZA 3OZVA 4G1VA 3SJPA 1YHQB 1FRNA 4M4SA 1JJ2B 1XQBA 1YJNB 4YXWA 4WQMA 1VQ8B 3ZBUA 4FN5A 4P22A 4LBWA 1QFJA 4XOPA 1QVGB 4ACBA 1K28D 3MMPA 2QE7A 5FO1A 2GJKA 3BY2A 1E43A 4B43A 4RD2A 4YAOA 3CXCB 1E62A 3Q3AA 4II3A 1E63A 1AMOA 1QFZA 4IW3B 4ZV4A 1KD1D 3Q6QA 1NB9A 5DS0A 3SEJA 5KW9A 2XNJA 4B4DA 2BV3A 4OP7A 5HZBA 5CDFA 4OPSA 3ZZ0A 3V7AA 2YWEA 4QVAA 4G1BA 3GSIA 4C0SA 1W9XA 4TMWA 2Q6KA 5H59A 3B78A 3AGPA 2ZL6A 3QFCA 4DQLA 4ASUA 2DY1A 2E1RA 3JQQA 1WPCA 2VBSA 1CQXA 1OB5A 2QGGA 4DQKA 2CF4A 4P3YA 3RY8A 3U2QA 2C5HA 2CW5A 3GQBA 4AC9A 3AVUA 4P6VF 5IYPA 2HCJB 4XN3A 2C4TA 2ZTGA 3E20A 4CQJA 5TRDA 3AVXA 1KK3A 1QGZA 2V7TA 2WZNA 1VQNB 4P2NA 3SLNA 1VLYA 1R5BA 4Y9UA 3W2HA 3CMEB 1K9MD 1G7SA 1Y0RA 1GR1A 1NRKA 4P25A 1EP3B 5J3OA 2ZBUA 3U6KA 2V7VA 3ASQA 1AIPA 1G7TA 3CMMA 4JMQA 2X3UA 3PENA 4XR6A 5FIUA 4P12A 2M5SA 3KL9A 1M1KD 4UAJA 3I1FA 4YAFA 3SJZA 4PC2A 4B3GA 1E1RA 3JQPA 3ASSA 3W2EA 2DERA 2XZLA 2ZZQA 4P6YA 1N0UA 1WDTA 4Z4VA 2E1BA 3OOCA 2CC2A
chains in the Genus database with same CATH topology
4RPBA 4RLZA 4OPVA 3ONYA 4Z4WA 3R6JA 5IYRA 5BSYA 4Z4RA 3ONUA 3LQEA 4RDJA 5BSXA 5J35A 5HZAA 4OPOA 3ASPA 4P1VA 3SJPA 4OOSA 3SLDA 4RDLA 4X7DA 4Z4SA 4Z4YA 4RM0A 3Q38A 3BY1A 3PUNA 3BY2A 3Q3AA 4X05A 2OBRA 5IYQA 3Q6QA 5E6TA 3SEJA 4RPDA 5KW9A 5F4OA 4Z4UA 1IHMA 4OP7A 5HZBA 4OPSA 5IYWA 4Z4ZA 3V7AA 4QVAA 4X07A 4WZEA 4OOXA 2ZL6A 3PA1A 4P3IA 4X7CA 4OOVA 2OBSA 3PVDA 3RY8A 2ZL5A 3ASTA 3Q6RA 3BQJA 3Q39A 2OBTA 3ASRA 5IYPA 4X06A 3LQ6A 5F4MA 4WZLA 5F4JA 4WZTA 3PA2A 4P2NA 3SLNA 4RDKA 4P25A 5IYNA 3D26A 4ROXA 5J3OA 4P26A 3ASQA 4X7FA 3SKBA 4P12A 4QV2A 4X0CA 3PUMA 4QUZA 3ASSA 4X7EA 4Z4VA 2ZL7A 4WZKA 4QVJA 4Z4TA 3R6KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RPB A;  4RLZ A;  4OPV A;  3ONY A;  4Z4W A;  3R6J A;  5IYR A;  5BSY A;  4Z4R A;  3ONU A;  3LQE A;  4RDJ A;  5BSX A;  5J35 A;  5HZA A;  4OPO A;  3ASP A;  4P1V A;  3SJP A;  4OOS A;  3SLD A;  4RDL A;  4X7D A;  4Z4S A;  4Z4Y A;  4RM0 A;  3Q38 A;  3BY1 A;  3PUN A;  3BY2 A;  3Q3A A;  4X05 A;  2OBR A;  5IYQ A;  3Q6Q A;  5E6T A;  3SEJ A;  4RPD A;  5KW9 A;  5F4O A;  4Z4U A;  1IHM A;  4OP7 A;  5HZB A;  4OPS A;  5IYW A;  4Z4Z A;  3V7A A;  4QVA A;  4X07 A;  4WZE A;  4OOX A;  2ZL6 A;  3PA1 A;  4P3I A;  4X7C A;  4OOV A;  2OBS A;  3PVD A;  3RY8 A;  2ZL5 A;  3AST A;  3Q6R A;  3BQJ A;  3Q39 A;  2OBT A;  3ASR A;  5IYP A;  4X06 A;  3LQ6 A;  5F4M A;  4WZL A;  5F4J A;  4WZT A;  3PA2 A;  4P2N A;  3SLN A;  4RDK A;  4P25 A;  5IYN A;  3D26 A;  4ROX A;  5J3O A;  4P26 A;  3ASQ A;  4X7F A;  3SKB A;  4P12 A;  4QV2 A;  4X0C A;  3PUM A;  4QUZ A;  3ASS A;  4X7E A;  4Z4V A;  2ZL7 A;  4WZK A;  4QVJ A;  4Z4T A;  3R6K A; 
#chains in the Genus database with same CATH topology
 2VNI A;  4PC6 A;  4RLZ A;  4FK8 A;  3OJX A;  2OTL B;  5FO0 A;  4XKW A;  5A89 A;  1FDR A;  3AVY A;  4M1K A;  3LO8 A;  3ONY A;  1YI2 B;  1KK1 A;  2GK7 A;  3QSY A;  2WR8 A;  3ZBT A;  4Z4W A;  1H8H A;  1QH0 A;  3CC7 B;  4Y9R A;  3ONU A;  2GRE A;  1S0U A;  2HMA A;  4RDJ A;  1FX0 A;  3CCS B;  4PAB A;  3ASP A;  1KTV A;  1EP2 B;  4P1V A;  3V76 A;  1IJE A;  1V0F A;  2VYQ A;  2B7C A;  3SLD A;  4MYU A;  1NBM A;  3AVW A;  4RDL A;  2DET A;  1IJF A;  2XNC A;  3G05 A;  4YEJ A;  1QGY A;  2ZZG A;  2GJP A;  5A8A A;  3A1P A;  2J7K A;  1DDG A;  4YEL A;  2P3M A;  1WSV A;  2W6I A;  3B8H A;  1RQP A;  3OZW A;  1PJ5 A;  4DNR B;  1BPL A;  1U2R A;  2ZTN A;  1YIJ B;  1Q81 D;  1M90 D;  4R71 A;  4X05 A;  3A3G A;  3VR6 A;  2GK6 A;  3GVJ A;  3CC4 B;  2PLF A;  5IYQ A;  2CBX A;  1BJK A;  3AGQ A;  4K1X A;  1NJI D;  4YAL A;  3QE2 A;  1KRH A;  1T5E A;  4XD7 A;  4G7X A;  1YX2 A;  3W5U A;  1IHM A;  1QG0 A;  2Q6L A;  1KQS B;  2BN4 A;  4HIZ A;  4Z4Z A;  1BMF A;  2BM0 A;  4TMV A;  2CK3 A;  3WND A;  3P27 A;  1W34 A;  3ES9 A;  3H94 A;  3CTA A;  3WY9 A;  4BPR A;  2RC5 A;  1JA0 A;  2VBT A;  4XM3 A;  2QDX A;  5KSW B;  1VQ7 B;  3VNU A;  3OE7 A;  2BF4 A;  1JNY A;  3JU4 A;  1HZE A;  2X0K A;  2C77 A;  4GQN A;  4N3G A;  5LMZ A;  4XNF A;  1G7R A;  1YIT B;  1FNC A;  4XQF A;  2OBT A;  4DK1 A;  2B7B A;  4P9S A;  4B3F X;  1H85 A;  4M0L A;  4X06 A;  2CRV A;  4WZL A;  1ZM2 A;  5F4J A;  3FPP A;  3ZIA A;  3ISX A;  4XOT A;  4M53 A;  3HAG A;  4ZCL A;  1J9Z A;  2NV4 A;  3GIR A;  2XGJ A;  2HDN B;  3BH4 A;  4ROX A;  1OHH A;  3ZZT A;  1EFC A;  2AHO A;  4X7F A;  4C43 A;  3SKB A;  1E3X A;  2DCU A;  4RCZ A;  2GPJ A;  2DEU A;  4RD0 A;  5KNL A;  1W0J A;  3BCF A;  5DSZ A;  1YJ9 B;  1D2E A;  4RD3 A;  2QTZ A;  1VF7 A;  2FVG A;  4QUZ A;  2F1L A;  1VHO A;  4ZGQ B;  1EP1 B;  1MRZ A;  2KVO A;  3BC9 A;  1E1Q A;  3OFN A;  4II2 A;  2V4D A;  3QFR A;  1WOR A;  4H9G A;  3VO2 A;  3WBJ A;  1KC8 D;  3R6K A;  1R5N A;  2ZBV A;  4YAW A;  3FKS A;  2C78 A;  1I18 A;  5IK2 A;  1IB0 A;  2X8K A;  1K73 D;  5GV7 A;  3A8I A;  1EWY A;  5BSY A;  4Z4R A;  1VQ5 B;  3WNC A;  1QGA A;  3LQE A;  5BSX A;  2QTL A;  4Q7J B;  3MHP A;  2GJR A;  5HZA A;  1QUE A;  2ZIT A;  1T6Y A;  2HLD A;  2XZO A;  3CMA B;  2EIX A;  1Q86 D;  1WOO A;  1N0V C;  1QFY A;  1VLO A;  2ZZE A;  1N07 A;  2VNJ A;  2OTJ B;  2V7U A;  4F7D A;  2X85 A;  1D1N A;  1UD2 A;  1QVF B;  2Z6B D;  3OW7 A;  4FXU A;  1KJZ A;  1T6X A;  3DDY A;  2V7Q A;  1WOS A;  3CB4 A;  5L46 A;  3ZZU A;  4Z4S A;  3FPK A;  4RM0 A;  3CPX A;  2VNH A;  2BM1 A;  3VNV A;  3CCE B;  2C4U A;  5JBQ A;  1K8A D;  2JIZ A;  1WOP A;  1VQO B;  1EFT A;  4KKT A;  2C2W A;  3A8K A;  4Y7C A;  4TSF A;  4M2L A;  2BSA A;  4QHY A;  1TVC A;  1VQL B;  1BX0 A;  1H8E A;  5E6T A;  4TKO B;  1FNM A;  5F4O A;  4Z4U A;  1UD6 A;  1UD4 A;  5IYW A;  5AN9 A;  3BCD A;  3WNB A;  1GAW A;  3NE5 B;  1P4M A;  3OP1 A;  4OOX A;  3CC2 B;  4XMY A;  3OKX A;  4L8J A;  2BGI A;  1N05 A;  1WTH D;  5B6I A;  1FRQ A;  1ELO A;  4X7C A;  4LBV A;  1KK2 A;  3CCM B;  4RJL A;  3OEE A;  3CCU B;  2YWF A;  2PE3 A;  2ZXI A;  2YWH A;  1OB2 A;  1UD5 A;  4PC7 A;  4OOV A;  3ZPN A;  1F60 A;  2ZL5 A;  2CND A;  4YHB A;  2BVN A;  5DN6 A;  3J81 k;  5A88 A;  3KEW A;  3OJW A;  4UZF A;  4AVZ A;  5TV2 A;  3ZC3 A;  2X6X A;  1UD3 A;  3LQ6 A;  1Q9S A;  5F4M A;  1HA3 A;  2EFG A;  1RQR A;  3PA2 A;  1N8R D;  4XLA A;  1UMK A;  4B47 A;  3GVK A;  4MYT A;  4RDK A;  4XLH A;  1SKY B;  3OW2 B;  1YJW B;  1S4M A;  3D26 A;  4G7W A;  4DK0 A;  4P26 A;  1Q82 D;  5GV8 A;  2WZP P;  3I56 B;  1ZUN B;  1GJR A;  3WXM A;  4RD6 A;  5THX A;  1VQ4 B;  4TMT A;  1V5V A;  4X0C A;  3PUM A;  3QFT A;  2BGJ A;  3OEH A;  3LNN A;  3G4S B;  4NCN A;  3CP8 A;  1EFR A;  2QN6 A;  4X7E A;  2X53 S;  2F1M A;  3VMF A;  2ZL7 A;  4WZK A;  4UZE A;  1CNE A;  4QFM A;  3CPW B;  1WU8 A;  1PJ6 A;  3LVB A;  2XOK A;  2R9V A;  3OPO A;  4UZU A;  1PJ7 A;  3CCV B;  1UD8 A;  3T51 B;  1TTT A;  1WSR A;  1XB2 A;  3H9N A;  3OZU A;  4LBZ A;  3W5V A;  3A8J A;  2DYI A;  4B3X A;  4YAU A;  1HVX A;  1FNB A;  2XND A;  3QFS A;  2NPF A;  1GVH A;  2V31 A;  3R6J A;  2QA4 B;  1KK0 A;  2OYN A;  2Q6I A;  2WPD A;  2X6W A;  2V7X A;  4ZGN B;  3U6B A;  1B2R A;  1ZM4 A;  2I1L A;  4N3N A;  1VHE A;  2Q6O A;  2R6H A;  5J35 A;  4XLF A;  1WP6 A;  2F4N A;  4OPO A;  1E79 A;  1ZM9 A;  4Z1M A;  3WBK A;  1G7C A;  2XEX A;  3MCA A;  1OB0 A;  4OOS A;  2WYR A;  4XL9 A;  3CCR B;  3CD6 B;  1BLI A;  3P26 A;  1FND A;  1W35 A;  1YLO A;  2OK8 A;  4XKV A;  4PC3 A;  4TN1 A;  4PGO A;  1QX4 A;  3CCL B;  4X7D A;  4Z4Y A;  3WYA A;  3Q38 A;  1I8D A;  3BY1 A;  3PUN A;  3E1Y E;  3AVV A;  3W2I A;  1Y0Y A;  4X8I A;  1JB9 A;  1W2B B;  2OBR A;  4FWT A;  1E64 A;  1VQ6 B;  2VJJ A;  4XOR A;  3CCJ B;  2VZL A;  2W6J A;  3CRZ A;  4B44 A;  4RPD A;  1DAR A;  4RD1 A;  2DOG A;  2YWG A;  1B23 P;  1Q7Y D;  4XLC A;  2XZP A;  2GQF A;  2D9R A;  3T53 B;  2V7W A;  1OGI A;  4X07 A;  4WZE A;  4ACA A;  3CES A;  1DG1 G;  4EH1 A;  4LBY A;  3W2G A;  5FA6 A;  1N08 A;  2VBU A;  1T6Z A;  3PA1 A;  4LC0 A;  4ZCI A;  4P3I A;  5TY0 A;  5H5J A;  4ZCM A;  1W87 A;  3OAA A;  2ZXH A;  4XON A;  4B48 A;  5EMN A;  1XE1 A;  1BX1 A;  1A8P A;  1E3Z A;  1R5O A;  3GVL A;  1QUF A;  2X6Y A;  2VNK A;  2OBS A;  3T56 B;  1D8T A;  2JJ1 A;  2VBV A;  1KZL A;  2LZJ A;  3AST A;  1F20 A;  3PVD A;  4G6I A;  3Q6R A;  5FNZ A;  3BQJ A;  1COW A;  4TT3 A;  1MAB A;  3Q39 A;  1NDH A;  4RCY A;  4U9U A;  3ASR A;  2DIE A;  2OK7 A;  3CW2 A;  4WWV A;  1JA1 A;  5FL7 A;  4HE6 A;  3AVT A;  2QMU A;  2RC6 A;  2D3N A;  2C5B A;  3W5H A;  3G6E B;  4XLE A;  4WZT A;  2BMW A;  4TMX A;  4DNT B;  3FJO A;  4AF6 A;  3JQR A;  2ZZF A;  3B82 A;  1KMH A;  1W0K A;  5IYN A;  1DDI A;  2WJV A;  2WSS A;  1PKV A;  1S72 B;  3W2F A;  1H42 A;  1VQK B;  4E0F A;  4KKU A;  1TLL A;  2QEX B;  2FX3 A;  4QV2 A;  3BNW A;  1EFU A;  1EXM A;  2BPO A;  1XFO A;  1ZM3 A;  3ZUG A;  2PMD A;  3VO1 A;  2JN9 A;  2B5O A;  3CP2 A;  4NBS A;  2WJY A;  4G5G A;  4QVJ A;  2PIA A;  3G71 B;  1NB0 A;  2D3L A;  3WQZ A;  1I7P A;  5HKK A;  2JJ2 A;  4Z4T A;  4RPB A;  1TUI A;  1N06 A;  4J0Q A;  1V0E A;  3CCQ B;  5TR9 A;  2F43 A;  1VQM B;  4AF7 A;  4OPV A;  4RD4 A;  1VQP B;  1VQ9 B;  1BQE A;  1SM4 A;  1VJS A;  4PAA A;  1GAQ A;  1GO2 A;  3A35 A;  4KKS A;  2JDI A;  5IYR A;  1OGJ A;  2D74 A;  3I55 B;  4PC1 A;  5HXB A;  1CNF A;  3A3B A;  4NNJ A;  2VJI A;  1SKQ A;  4HE5 A;  4XN0 A;  4TMZ A;  3OZV A;  4G1V A;  3SJP A;  1YHQ B;  1FRN A;  4M4S A;  1JJ2 B;  1XQB A;  1YJN B;  4YXW A;  4WQM A;  1VQ8 B;  3ZBU A;  4FN5 A;  4P22 A;  4LBW A;  1QFJ A;  4XOP A;  1QVG B;  4ACB A;  1K28 D;  3MMP A;  2QE7 A;  5FO1 A;  2GJK A;  3BY2 A;  1E43 A;  4B43 A;  4RD2 A;  4YAO A;  3CXC B;  1E62 A;  3Q3A A;  4II3 A;  1E63 A;  1AMO A;  1QFZ A;  4IW3 B;  4ZV4 A;  1KD1 D;  3Q6Q A;  1NB9 A;  5DS0 A;  3SEJ A;  5KW9 A;  2XNJ A;  4B4D A;  2BV3 A;  4OP7 A;  5HZB A;  5CDF A;  4OPS A;  3ZZ0 A;  3V7A A;  2YWE A;  4QVA A;  4G1B A;  3GSI A;  4C0S A;  1W9X A;  4TMW A;  2Q6K A;  5H59 A;  3B78 A;  3AGP A;  2ZL6 A;  3QFC A;  4DQL A;  4ASU A;  2DY1 A;  2E1R A;  3JQQ A;  1WPC A;  2VBS A;  1CQX A;  1OB5 A;  2QGG A;  4DQK A;  2CF4 A;  4P3Y A;  3RY8 A;  3U2Q A;  2C5H A;  2CW5 A;  3GQB A;  4AC9 A;  3AVU A;  4P6V F;  5IYP A;  2HCJ B;  4XN3 A;  2C4T A;  2ZTG A;  3E20 A;  4CQJ A;  5TRD A;  3AVX A;  1KK3 A;  1QGZ A;  2V7T A;  2WZN A;  1VQN B;  4P2N A;  3SLN A;  1VLY A;  1R5B A;  4Y9U A;  3W2H A;  3CME B;  1K9M D;  1G7S A;  1Y0R A;  1GR1 A;  1NRK A;  4P25 A;  1EP3 B;  5J3O A;  2ZBU A;  3U6K A;  2V7V A;  3ASQ A;  1AIP A;  1G7T A;  3CMM A;  4JMQ A;  2X3U A;  3PEN A;  4XR6 A;  5FIU A;  4P12 A;  2M5S A;  3KL9 A;  1M1K D;  4UAJ A;  3I1F A;  4YAF A;  3SJZ A;  4PC2 A;  4B3G A;  1E1R A;  3JQP A;  3ASS A;  3W2E A;  2DER A;  2XZL A;  2ZZQ A;  4P6Y A;  1N0U A;  1WDT A;  4Z4V A;  2E1B A;  3OOC A;  2CC2 A; 
#chains in the Genus database with same CATH homology
 4RPB A;  4RLZ A;  4OPV A;  3ONY A;  4Z4W A;  3R6J A;  5IYR A;  5BSY A;  4Z4R A;  3ONU A;  3LQE A;  4RDJ A;  5BSX A;  5J35 A;  5HZA A;  4OPO A;  3ASP A;  4P1V A;  3SJP A;  4OOS A;  3SLD A;  4RDL A;  4X7D A;  4Z4S A;  4Z4Y A;  4RM0 A;  3Q38 A;  3BY1 A;  3PUN A;  3BY2 A;  3Q3A A;  4X05 A;  2OBR A;  5IYQ A;  3Q6Q A;  5E6T A;  3SEJ A;  4RPD A;  5KW9 A;  5F4O A;  4Z4U A;  1IHM A;  4OP7 A;  5HZB A;  4OPS A;  5IYW A;  4Z4Z A;  3V7A A;  4QVA A;  4X07 A;  4WZE A;  4OOX A;  2ZL6 A;  3PA1 A;  4P3I A;  4X7C A;  4OOV A;  2OBS A;  3PVD A;  3RY8 A;  2ZL5 A;  3AST A;  3Q6R A;  3BQJ A;  3Q39 A;  2OBT A;  3ASR A;  5IYP A;  4X06 A;  3LQ6 A;  5F4M A;  4WZL A;  5F4J A;  4WZT A;  3PA2 A;  4P2N A;  3SLN A;  4RDK A;  4P25 A;  5IYN A;  3D26 A;  4ROX A;  5J3O A;  4P26 A;  3ASQ A;  4X7F A;  3SKB A;  4P12 A;  4QV2 A;  4X0C A;  3PUM A;  4QUZ A;  3ASS A;  4X7E A;  4Z4V A;  2ZL7 A;  4WZK A;  4QVJ A;  4Z4T A;  3R6K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...