4P2NA

Structure of the p domain from a gi.7 norovirus variant in complex with lex hbga
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
295
structure length
285
Chain Sequence
QLTVPNIPLNNLANSRVPAMINKMTVSTDQNQVVQFQNGRCTLEGQLLGTTPVSASQVARIRGKVFSTASGKGLNLTELDGTPYHASPAPLGFPDIGACDWHVSTFKVDQNLSGDPMSRLDVKQNAPFAPHLGSIEFTSDQDPTGDQLGTLAWVSPSTSGARVDPWKIPSYHLAPPIFPPGFGEAIVYFMSDFPIVSGNTAQVPCTLPQEFVSHFVEQQAPVRGEAALLHYVDPDTHRNLGEFKLYPDGFITCVPNTGGGPQNLPTNGVFVFSSWVSRYYQLKPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of determinants of histo-blood group antigen binding specificity in genogroup I noroviruses.
pubmed doi rcsb
source organism Norovirus hu/gi.7/tch-060/usa/2003
molecule tags Viral protein
molecule keywords Major capsid protein
total genus 63
structure length 285
sequence length 295
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-03-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.120 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Positive stranded ssRNA viruses 4p2nA02
2.40.510.10 Mainly Beta Beta Barrel Nucleoplasmin-like/VP (viral coat and capsid proteins) Positive stranded ssRNA viruses 4p2nA01
4QV2A 2ZL7A 4RPDA 3ASPA 3BY1A 3SLNA 4RDJA 3BY2A 4OP7A 5HZAA 4Z4SA 4OPVA 3Q38A 4P2NA 3D26A 4WZEA 2OBSA 3PA2A 3Q6QA 4X7CA 5HZBA 3LQ6A 4ROXA 4QVAA 4Z4UA 4WZKA 3PUMA 4OOSA 4OPSA 4RM0A 3ASSA 2ZL6A 5BSYA 3Q3AA 4X07A 4Z4ZA 5IYPA 3Q39A 3LQEA 3PUNA 3Q6RA 4WZLA 4WZTA 3ASQA 4P3IA 4P1VA 4RLZA 4OOVA 2OBTA 4X05A 5IYQA 3R6KA 3PVDA 3ASRA 4OOXA 5F4MA 5J35A 4Z4WA 4QVJA 3SJPA 5KW9A 5BSXA 5J3OA 3SLDA 3SKBA 4P26A 4X7FA 4X7EA 2ZL5A 4Z4RA 4X7DA 4Z4TA 4OPOA 4P12A 5IYRA 3ONUA 4P25A 4QUZA 4RPBA 3SEJA 3ASTA 3ONYA 2OBRA 3BQJA 3PA1A 5IYNA 5IYWA 4RDKA 3V7AA 3R6JA 1IHMA 5E6TA 4Z4VA 3RY8A 4X06A 4RDLA 5F4JA 4Z4YA 4X0CA 5F4OA
chains in the Genus database with same CATH superfamily
1CNEA 2GJPA 3A1PA 4QV2A 4EH1A 2YWEA 3J81k 1VLOA 3G6EB 2R9VA 4P6VF 3SLNA 5FIUA 1WTHD 3OZWA 4XN3A 3BY2A 1U2RA 2X53S 4DNRB 1KRHA 4II3A 1FNCA 1WOSA 1Q81D 1JB9A 2ZXHA 1QFYA 3I56B 4P2NA 1YX2A 5HKKA 3D26A 1YITB 3T53B 3A8IA 1WPCA 2XNCA 4WQMA 2ZTNA 3OW2B 1GVHA 3PA2A 2V7TA 2WZNA 3Q6QA 4N3NA 4ROXA 3LVBA 4QVAA 2C78A 1WORA 4M1KA 3LNNA 2GREA 4PC2A 1H8EA 3PUMA 4OPSA 2XZOA 4B48A 1EFCA 1KK1A 2BGJA 2ZL6A 3MMPA 3W2GA 4QFMA 5TY0A 1N06A 2ZTGA 3AVXA 3Q3AA 4RJLA 4K1XA 4GQNA 2XEXA 1Q7YD 1OHHA 2PIAA 5IYPA 1MABA 2XNJA 3Q39A 3LQEA 3PUNA 4C0SA 5GV7A 1IJEA 1FRQA 4NCNA 1GO2A 3CTAA 2QDXA 3FPKA 1YJWB 1S72B 4RLZA 1IJFA 2QE7A 1GAQA 1V0FA 2VYQA 5TR9A 4TMZA 2JJ1A 4HE5A 3VO2A 5IYQA 2ZBVA 2V4DA 2DEUA 1N0VC 3ES9A 4UAJA 1KQSB 2DYIA 2R6HA 1BQEA 1QFZA 1YI2B 3OJXA 1FX0A 4ACAA 5F4MA 2VBVA 1B23P 4XLAA 4UZEA 1VQPB 4PAAA 2CNDA 3OP1A 4TN1A 4AF6A 3CRZA 3I55B 1QGYA 4HE6A 1KMHA 4R71A 5J3OA 4L8JA 1H85A 3QE2A 1AIPA 3SLDA 1VQ9B 1QG0A 5EMNA 4P26A 2ZBUA 4X7FA 2QGGA 4ZGNB 4G5GA 4XLFA 1BJKA 4ZCLA 2D74A 1UD6A 1K28D 4KKTA 3E20A 1V0EA 4G7WA 4X7DA 4Z4TA 5TV2A 2GJRA 1K73D 1YJ9B 1W35A 1DDGA 3OAAA 1JJ2B 1BLIA 1FRNA 1VQ4B 1QVFB 4QUZA 1T6ZA 3CB4A 1HZEA 5HXBA 4M2LA 2HMAA 4N3GA 1BPLA 1VQLB 3CPXA 1E1RA 4NBSA 1G7SA 4BPRA 3BCDA 3BQJA 5A89A 3A3GA 2OTLB 1E43A 2HDNB 3GQBA 2X6YA 1W34A 4PC1A 2NV4A 2X8KA 3P27A 3R6JA 1JNYA 2WR8A 4FXUA 3CPWB 2VNJA 2DOGA 4RDLA 1WDTA 5F4JA 2V31A 1EFRA 1NB9A 4RD1A 4TKOB 1XB2A 4Z4YA 1FDRA 2KVOA 2QN6A 5A88A 2QMUA 3CCUB 1M90D 2JDIA 5L46A 2ZITA 3CCSB 2BN4A 2ZL7A 1R5OA 1JA0A 1ZM4A 4TSFA 3BY1A 1GAWA 3OKXA 3VO1A 1GJRA 1R5BA 4RD6A 1COWA 1K9MD 2BM0A 2XZPA 3OFNA 4YHBA 1FNMA 4DK0A 1RQPA 3U6BA 4RD4A 1KK2A 3CD6B 2FVGA 4Z4SA 1VLYA 2D9RA 3QFTA 1UMKA 1MRZA 1SKYB 3BNWA 4WZEA 1OB5A 4M53A 1QGAA 5DSZA 1N8RD 4Q7JB 2GQFA 1D8TA 1UD2A 4LBZA 4X7CA 1A8PA 4G1BA 2BM1A 2AHOA 2WJVA 4G6IA 2D3LA 5DS0A 3WBKA 4TT3A 1OGIA 1QGZA 5FL7A 4LBYA 4E0FA 4OOSA 1VQ6B 3PENA 1EP3B 4KKSA 4G7XA 4RCYA 3DDYA 4RM0A 5FO1A 2B7BA 3WNDA 1NRKA 4X07A 1G7CA 2NPFA 2ZZFA 3W5HA 1IB0A 3AGPA 3AVVA 4B3XA 4Z1MA 1M1KD 4WZLA 4Y9UA 3ASQA 2ZZQA 3WY9A 2HCJB 1W87A 2HLDA 1NDHA 2OBTA 2V7VA 3CW2A 4IW3B 1F60A 4XNFA 4B3GA 3NE5B 4X8IA 1YLOA 4P6YA 3E1YE 1BX0A 3I1FA 5DN6A 2EIXA 2QEXB 2GK7A 1VF7A 1CQXA 4XOTA 2QTLA 5J35A 4PABA 2RC5A 2ZXIA 2WYRA 3W2IA 3CMEB 3CMMA 3OEEA 2OK7A 4B3FX 3QFCA 4B47A 1OB2A 3JQPA 3VMFA 2QA4B 3AVYA 3ZC3A 1WSVA 2P3MA 4XONA 1NJID 1HVXA 3QSYA 3P26A 3CXCB 4XKVA 3A8KA 2PLFA 2ZL5A 3CCMB 3ZZ0A 3A8JA 1W2BB 2BSAA 2BPOA 1E79A 2CBXA 4M4SA 3WNBA 3T51B 5B6IA 4P12A 1H8HA 4YAWA 5FNZA 1H42A 3ZIAA 4RPBA 4FWTA 4MYUA 2XOKA 3AVWA 3CCVB 2I1LA 1BMFA 3FKSA 5IYWA 1VQOB 1ZM2A 4M0LA 1VQKB 4PC6A 3G05A 3B78A 3QFRA 3VNVA 1IHMA 1QUEA 2W6JA 4ZV4A 1SKQA 2F4NA 2RC6A 2YWFA 1SM4A 2CK3A 2DCUA 4FK8A 4G1VA 4HIZA 5A8AA 3WYAA 2C4UA 4XR6A 5F4OA 4B44A 1TTTA 1XFOA 3OZVA 1P4MA 1Q82D 2C5HA 2DIEA 5AN9A 1G7RA 4MYTA 2BGIA 1E1QA 1E63A 3WNCA 4TMVA 4RDJA 3CC2B 2V7WA 2WPDA 3OPOA 1W0JA 3W2FA 3BCFA 5HZAA 1TVCA 4DNTB 4UZUA 4OPVA 1UD5A 5FO0A 2XZLA 4RCZA 2Z6BD 2B5OA 3CESA 1VQ5B 4B43A 2OYNA 3LO8A 3ZZUA 2OBSA 3QFSA 5HZBA 2M5SA 1PJ5A 4QHYA 4XORA 1BX1A 5GV8A 4Z4UA 2EFGA 1W0KA 1EWYA 4PGOA 2VNKA 4YEJA 4AC9A 2DY1A 1FNBA 2X6WA 3CCEB 3ASSA 2W6IA 3BH4A 3CC7B 3HAGA 2VZLA 1E3ZA 2BVNA 1I18A 4C43A 4Z4ZA 3CCRB 1GR1A 3W2HA 2VBUA 2X85A 1W9XA 1EFTA 1DARA 1J9ZA 2CRVA 3Q6RA 3W5VA 4UZFA 2F1LA 4P3IA 4KKUA 2GJKA 4P1VA 3H94A 1YIJB 1VQ7B 3MCAA 2J7KA 1V5VA 3A35A 4U9UA 1TLLA 1WSRA 2YWGA 5IK2A 3VR6A 4ZCIA 1VHOA 1ZM9A 2XGJA 1R5NA 4WWVA 1N08A 1I7PA 1T6XA 2ZZEA 3GVKA 4OOXA 3WXMA 4RD3A 3U2QA 3OW7A 1VJSA 2QTZA 5THXA 2V7QA 3AVUA 2JN9A 2VBSA 4RD2A 4YAOA 3ZPNA 1YHQB 4RD0A 4B4DA 4ZCMA 3ISXA 4ACBA 1WOPA 1E3XA 4XLHA 5TRDA 4XOPA 3CCLB 2JIZA 3CCJB 2B7CA 2F43A 2E1BA 3G71B 4OPOA 3GVLA 1T6YA 1KD1D 5IYRA 1N07A 3W2EA 4P25A 4TMXA 3ZBTA 1VQMB 1QX4A 5H59A 1EP1B 2GK6A 3ASTA 1D1NA 2DETA 3ONYA 2OBRA 3OE7A 4TMTA 5IYNA 4RDKA 3CMAB 1VQ8B 2WZPP 2FX3A 3V7AA 3W5UA 2VNHA 1F20A 4NNJA 3CP8A 4XD7A 2XNDA 4Z4VA 4X06A 4XL9A 5JBQA 4DQLA 2OTJB 2VJIA 4YALA 2VJJA 2BV3A 2CC2A 2Q6OA 1AMOA 1N0UA 4RPDA 3ASPA 2BMWA 1KZLA 1NBMA 4Y7CA 4XM3A 2LZJA 2VBTA 5KNLA 2X3UA 3ZBUA 3CC4B 4LBWA 2Q6IA 3GIRA 1HA3A 2F1MA 4OP7A 4LC0A 1KTVA 2C2WA 3Q38A 3SJZA 1CNFA 4XLEA 1PKVA 1WOOA 2C5BA 1EP2B 1PJ7A 4II2A 3T56B 3V76A 1QFJA 4DQKA 2X6XA 3LQ6A 1E62A 1EXMA 1ELOA 2GPJA 2CF4A 2WSSA 4WZKA 1Q86D 1ZM3A 1Y0YA 3JU4A 1OGJA 1XQBA 4PC7A 1UD8A 1FNDA 2X0KA 2VNIA 1G7TA 5BSYA 3OOCA 4Y9RA 4H9GA 4XKWA 3AVTA 1KK3A 2E1RA 4LBVA 4F7DA 3KL9A 2JJ2A 4WZTA 1QVGB 2C77A 3FJOA 4OOVA 4X05A 3R6KA 1YJNB 1I8DA 4YAUA 3GSIA 4YELA 1WU8A 4P22A 4DK1A 1OB0A 3B82A 3PVDA 3ASRA 4AF7A 4CQJA 1JA1A 2C4TA 5FA6A 3ZZTA 1RQRA 4YXWA 3FPPA 4Z4WA 4QVJA 1Y0RA 2BF4A 2PE3A 3B8HA 3SJPA 2YWHA 1S0UA 3H9NA 1N05A 5CDFA 5BSXA 2D3NA 5KW9A 1DDIA 2V7UA 3SKBA 4JMQA 3GVJA 3ZUGA 1QH0A 3A3BA 4P9SA 2Q6LA 5H5JA 1ZUNB 4XN0A 1KK0A 4AVZA 1S4MA 4X7EA 3KEWA 3MHPA 4Z4RA 3VNUA 4PC3A 1KC8D 3U6KA 4P3YA 1K8AD 4XQFA 3BC9A 4FN5A 1D2EA 1WP6A 1EFUA 2DERA 1UD3A 1PJ6A 3WQZA 3WBJA 1B2RA 4ASUA 2OK8A 3CCQB 3ONUA 2WJYA 1Q9SA 4YAFA 1DG1G 1T5EA 3SEJA 3JQRA 1KJZA 2CW5A 3JQQA 4J0QA 5KSWB 4TMWA 3OZUA 4XLCA 3PA1A 1TUIA 3G4SB 3AGQA 1XE1A 4ZGQB 1QUFA 2ZZGA 1VQNB 4XMYA 2V7XA 5LMZA 1UD4A 3OEHA 5E6TA 2PMDA 3RY8A 1E64A 3CP2A 1NB0A 1VHEA 3OJWA 4X0CA 2Q6KA
chains in the Genus database with same CATH topology
4QV2A 2ZL7A 4RPDA 3ASPA 3BY1A 3SLNA 4RDJA 3BY2A 4OP7A 5HZAA 4Z4SA 4OPVA 3Q38A 4P2NA 3D26A 4WZEA 2OBSA 3PA2A 3Q6QA 4X7CA 5HZBA 3LQ6A 4ROXA 4QVAA 4Z4UA 4WZKA 3PUMA 4OOSA 4OPSA 4RM0A 3ASSA 2ZL6A 5BSYA 3Q3AA 4X07A 4Z4ZA 5IYPA 3Q39A 3LQEA 3PUNA 3Q6RA 4WZLA 4WZTA 3ASQA 4P3IA 4P1VA 4RLZA 4OOVA 2OBTA 4X05A 5IYQA 3R6KA 3PVDA 3ASRA 4OOXA 5F4MA 5J35A 4Z4WA 4QVJA 3SJPA 5KW9A 5BSXA 5J3OA 3SLDA 3SKBA 4P26A 4X7FA 4X7EA 2ZL5A 4Z4RA 4X7DA 4Z4TA 4OPOA 4P12A 5IYRA 3ONUA 4P25A 4QUZA 4RPBA 3SEJA 3ASTA 3ONYA 2OBRA 3BQJA 3PA1A 5IYNA 5IYWA 4RDKA 3V7AA 3R6JA 1IHMA 5E6TA 4Z4VA 3RY8A 4X06A 4RDLA 5F4JA 4Z4YA 4X0CA 5F4OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QV2 A;  2ZL7 A;  4RPD A;  3ASP A;  3BY1 A;  3SLN A;  4RDJ A;  3BY2 A;  4OP7 A;  5HZA A;  4Z4S A;  4OPV A;  3Q38 A;  4P2N A;  3D26 A;  4WZE A;  2OBS A;  3PA2 A;  3Q6Q A;  4X7C A;  5HZB A;  3LQ6 A;  4ROX A;  4QVA A;  4Z4U A;  4WZK A;  3PUM A;  4OOS A;  4OPS A;  4RM0 A;  3ASS A;  2ZL6 A;  5BSY A;  3Q3A A;  4X07 A;  4Z4Z A;  5IYP A;  3Q39 A;  3LQE A;  3PUN A;  3Q6R A;  4WZL A;  4WZT A;  3ASQ A;  4P3I A;  4P1V A;  4RLZ A;  4OOV A;  2OBT A;  4X05 A;  5IYQ A;  3R6K A;  3PVD A;  3ASR A;  4OOX A;  5F4M A;  5J35 A;  4Z4W A;  4QVJ A;  3SJP A;  5KW9 A;  5BSX A;  5J3O A;  3SLD A;  3SKB A;  4P26 A;  4X7F A;  4X7E A;  2ZL5 A;  4Z4R A;  4X7D A;  4Z4T A;  4OPO A;  4P12 A;  5IYR A;  3ONU A;  4P25 A;  4QUZ A;  4RPB A;  3SEJ A;  3AST A;  3ONY A;  2OBR A;  3BQJ A;  3PA1 A;  5IYN A;  5IYW A;  4RDK A;  3V7A A;  3R6J A;  1IHM A;  5E6T A;  4Z4V A;  3RY8 A;  4X06 A;  4RDL A;  5F4J A;  4Z4Y A;  4X0C A;  5F4O A; 
#chains in the Genus database with same CATH topology
 1CNE A;  2GJP A;  3A1P A;  4QV2 A;  4EH1 A;  2YWE A;  3J81 k;  1VLO A;  3G6E B;  2R9V A;  4P6V F;  3SLN A;  5FIU A;  1WTH D;  3OZW A;  4XN3 A;  3BY2 A;  1U2R A;  2X53 S;  4DNR B;  1KRH A;  4II3 A;  1FNC A;  1WOS A;  1Q81 D;  1JB9 A;  2ZXH A;  1QFY A;  3I56 B;  4P2N A;  1YX2 A;  5HKK A;  3D26 A;  1YIT B;  3T53 B;  3A8I A;  1WPC A;  2XNC A;  4WQM A;  2ZTN A;  3OW2 B;  1GVH A;  3PA2 A;  2V7T A;  2WZN A;  3Q6Q A;  4N3N A;  4ROX A;  3LVB A;  4QVA A;  2C78 A;  1WOR A;  4M1K A;  3LNN A;  2GRE A;  4PC2 A;  1H8E A;  3PUM A;  4OPS A;  2XZO A;  4B48 A;  1EFC A;  1KK1 A;  2BGJ A;  2ZL6 A;  3MMP A;  3W2G A;  4QFM A;  5TY0 A;  1N06 A;  2ZTG A;  3AVX A;  3Q3A A;  4RJL A;  4K1X A;  4GQN A;  2XEX A;  1Q7Y D;  1OHH A;  2PIA A;  5IYP A;  1MAB A;  2XNJ A;  3Q39 A;  3LQE A;  3PUN A;  4C0S A;  5GV7 A;  1IJE A;  1FRQ A;  4NCN A;  1GO2 A;  3CTA A;  2QDX A;  3FPK A;  1YJW B;  1S72 B;  4RLZ A;  1IJF A;  2QE7 A;  1GAQ A;  1V0F A;  2VYQ A;  5TR9 A;  4TMZ A;  2JJ1 A;  4HE5 A;  3VO2 A;  5IYQ A;  2ZBV A;  2V4D A;  2DEU A;  1N0V C;  3ES9 A;  4UAJ A;  1KQS B;  2DYI A;  2R6H A;  1BQE A;  1QFZ A;  1YI2 B;  3OJX A;  1FX0 A;  4ACA A;  5F4M A;  2VBV A;  1B23 P;  4XLA A;  4UZE A;  1VQP B;  4PAA A;  2CND A;  3OP1 A;  4TN1 A;  4AF6 A;  3CRZ A;  3I55 B;  1QGY A;  4HE6 A;  1KMH A;  4R71 A;  5J3O A;  4L8J A;  1H85 A;  3QE2 A;  1AIP A;  3SLD A;  1VQ9 B;  1QG0 A;  5EMN A;  4P26 A;  2ZBU A;  4X7F A;  2QGG A;  4ZGN B;  4G5G A;  4XLF A;  1BJK A;  4ZCL A;  2D74 A;  1UD6 A;  1K28 D;  4KKT A;  3E20 A;  1V0E A;  4G7W A;  4X7D A;  4Z4T A;  5TV2 A;  2GJR A;  1K73 D;  1YJ9 B;  1W35 A;  1DDG A;  3OAA A;  1JJ2 B;  1BLI A;  1FRN A;  1VQ4 B;  1QVF B;  4QUZ A;  1T6Z A;  3CB4 A;  1HZE A;  5HXB A;  4M2L A;  2HMA A;  4N3G A;  1BPL A;  1VQL B;  3CPX A;  1E1R A;  4NBS A;  1G7S A;  4BPR A;  3BCD A;  3BQJ A;  5A89 A;  3A3G A;  2OTL B;  1E43 A;  2HDN B;  3GQB A;  2X6Y A;  1W34 A;  4PC1 A;  2NV4 A;  2X8K A;  3P27 A;  3R6J A;  1JNY A;  2WR8 A;  4FXU A;  3CPW B;  2VNJ A;  2DOG A;  4RDL A;  1WDT A;  5F4J A;  2V31 A;  1EFR A;  1NB9 A;  4RD1 A;  4TKO B;  1XB2 A;  4Z4Y A;  1FDR A;  2KVO A;  2QN6 A;  5A88 A;  2QMU A;  3CCU B;  1M90 D;  2JDI A;  5L46 A;  2ZIT A;  3CCS B;  2BN4 A;  2ZL7 A;  1R5O A;  1JA0 A;  1ZM4 A;  4TSF A;  3BY1 A;  1GAW A;  3OKX A;  3VO1 A;  1GJR A;  1R5B A;  4RD6 A;  1COW A;  1K9M D;  2BM0 A;  2XZP A;  3OFN A;  4YHB A;  1FNM A;  4DK0 A;  1RQP A;  3U6B A;  4RD4 A;  1KK2 A;  3CD6 B;  2FVG A;  4Z4S A;  1VLY A;  2D9R A;  3QFT A;  1UMK A;  1MRZ A;  1SKY B;  3BNW A;  4WZE A;  1OB5 A;  4M53 A;  1QGA A;  5DSZ A;  1N8R D;  4Q7J B;  2GQF A;  1D8T A;  1UD2 A;  4LBZ A;  4X7C A;  1A8P A;  4G1B A;  2BM1 A;  2AHO A;  2WJV A;  4G6I A;  2D3L A;  5DS0 A;  3WBK A;  4TT3 A;  1OGI A;  1QGZ A;  5FL7 A;  4LBY A;  4E0F A;  4OOS A;  1VQ6 B;  3PEN A;  1EP3 B;  4KKS A;  4G7X A;  4RCY A;  3DDY A;  4RM0 A;  5FO1 A;  2B7B A;  3WND A;  1NRK A;  4X07 A;  1G7C A;  2NPF A;  2ZZF A;  3W5H A;  1IB0 A;  3AGP A;  3AVV A;  4B3X A;  4Z1M A;  1M1K D;  4WZL A;  4Y9U A;  3ASQ A;  2ZZQ A;  3WY9 A;  2HCJ B;  1W87 A;  2HLD A;  1NDH A;  2OBT A;  2V7V A;  3CW2 A;  4IW3 B;  1F60 A;  4XNF A;  4B3G A;  3NE5 B;  4X8I A;  1YLO A;  4P6Y A;  3E1Y E;  1BX0 A;  3I1F A;  5DN6 A;  2EIX A;  2QEX B;  2GK7 A;  1VF7 A;  1CQX A;  4XOT A;  2QTL A;  5J35 A;  4PAB A;  2RC5 A;  2ZXI A;  2WYR A;  3W2I A;  3CME B;  3CMM A;  3OEE A;  2OK7 A;  4B3F X;  3QFC A;  4B47 A;  1OB2 A;  3JQP A;  3VMF A;  2QA4 B;  3AVY A;  3ZC3 A;  1WSV A;  2P3M A;  4XON A;  1NJI D;  1HVX A;  3QSY A;  3P26 A;  3CXC B;  4XKV A;  3A8K A;  2PLF A;  2ZL5 A;  3CCM B;  3ZZ0 A;  3A8J A;  1W2B B;  2BSA A;  2BPO A;  1E79 A;  2CBX A;  4M4S A;  3WNB A;  3T51 B;  5B6I A;  4P12 A;  1H8H A;  4YAW A;  5FNZ A;  1H42 A;  3ZIA A;  4RPB A;  4FWT A;  4MYU A;  2XOK A;  3AVW A;  3CCV B;  2I1L A;  1BMF A;  3FKS A;  5IYW A;  1VQO B;  1ZM2 A;  4M0L A;  1VQK B;  4PC6 A;  3G05 A;  3B78 A;  3QFR A;  3VNV A;  1IHM A;  1QUE A;  2W6J A;  4ZV4 A;  1SKQ A;  2F4N A;  2RC6 A;  2YWF A;  1SM4 A;  2CK3 A;  2DCU A;  4FK8 A;  4G1V A;  4HIZ A;  5A8A A;  3WYA A;  2C4U A;  4XR6 A;  5F4O A;  4B44 A;  1TTT A;  1XFO A;  3OZV A;  1P4M A;  1Q82 D;  2C5H A;  2DIE A;  5AN9 A;  1G7R A;  4MYT A;  2BGI A;  1E1Q A;  1E63 A;  3WNC A;  4TMV A;  4RDJ A;  3CC2 B;  2V7W A;  2WPD A;  3OPO A;  1W0J A;  3W2F A;  3BCF A;  5HZA A;  1TVC A;  4DNT B;  4UZU A;  4OPV A;  1UD5 A;  5FO0 A;  2XZL A;  4RCZ A;  2Z6B D;  2B5O A;  3CES A;  1VQ5 B;  4B43 A;  2OYN A;  3LO8 A;  3ZZU A;  2OBS A;  3QFS A;  5HZB A;  2M5S A;  1PJ5 A;  4QHY A;  4XOR A;  1BX1 A;  5GV8 A;  4Z4U A;  2EFG A;  1W0K A;  1EWY A;  4PGO A;  2VNK A;  4YEJ A;  4AC9 A;  2DY1 A;  1FNB A;  2X6W A;  3CCE B;  3ASS A;  2W6I A;  3BH4 A;  3CC7 B;  3HAG A;  2VZL A;  1E3Z A;  2BVN A;  1I18 A;  4C43 A;  4Z4Z A;  3CCR B;  1GR1 A;  3W2H A;  2VBU A;  2X85 A;  1W9X A;  1EFT A;  1DAR A;  1J9Z A;  2CRV A;  3Q6R A;  3W5V A;  4UZF A;  2F1L A;  4P3I A;  4KKU A;  2GJK A;  4P1V A;  3H94 A;  1YIJ B;  1VQ7 B;  3MCA A;  2J7K A;  1V5V A;  3A35 A;  4U9U A;  1TLL A;  1WSR A;  2YWG A;  5IK2 A;  3VR6 A;  4ZCI A;  1VHO A;  1ZM9 A;  2XGJ A;  1R5N A;  4WWV A;  1N08 A;  1I7P A;  1T6X A;  2ZZE A;  3GVK A;  4OOX A;  3WXM A;  4RD3 A;  3U2Q A;  3OW7 A;  1VJS A;  2QTZ A;  5THX A;  2V7Q A;  3AVU A;  2JN9 A;  2VBS A;  4RD2 A;  4YAO A;  3ZPN A;  1YHQ B;  4RD0 A;  4B4D A;  4ZCM A;  3ISX A;  4ACB A;  1WOP A;  1E3X A;  4XLH A;  5TRD A;  4XOP A;  3CCL B;  2JIZ A;  3CCJ B;  2B7C A;  2F43 A;  2E1B A;  3G71 B;  4OPO A;  3GVL A;  1T6Y A;  1KD1 D;  5IYR A;  1N07 A;  3W2E A;  4P25 A;  4TMX A;  3ZBT A;  1VQM B;  1QX4 A;  5H59 A;  1EP1 B;  2GK6 A;  3AST A;  1D1N A;  2DET A;  3ONY A;  2OBR A;  3OE7 A;  4TMT A;  5IYN A;  4RDK A;  3CMA B;  1VQ8 B;  2WZP P;  2FX3 A;  3V7A A;  3W5U A;  2VNH A;  1F20 A;  4NNJ A;  3CP8 A;  4XD7 A;  2XND A;  4Z4V A;  4X06 A;  4XL9 A;  5JBQ A;  4DQL A;  2OTJ B;  2VJI A;  4YAL A;  2VJJ A;  2BV3 A;  2CC2 A;  2Q6O A;  1AMO A;  1N0U A;  4RPD A;  3ASP A;  2BMW A;  1KZL A;  1NBM A;  4Y7C A;  4XM3 A;  2LZJ A;  2VBT A;  5KNL A;  2X3U A;  3ZBU A;  3CC4 B;  4LBW A;  2Q6I A;  3GIR A;  1HA3 A;  2F1M A;  4OP7 A;  4LC0 A;  1KTV A;  2C2W A;  3Q38 A;  3SJZ A;  1CNF A;  4XLE A;  1PKV A;  1WOO A;  2C5B A;  1EP2 B;  1PJ7 A;  4II2 A;  3T56 B;  3V76 A;  1QFJ A;  4DQK A;  2X6X A;  3LQ6 A;  1E62 A;  1EXM A;  1ELO A;  2GPJ A;  2CF4 A;  2WSS A;  4WZK A;  1Q86 D;  1ZM3 A;  1Y0Y A;  3JU4 A;  1OGJ A;  1XQB A;  4PC7 A;  1UD8 A;  1FND A;  2X0K A;  2VNI A;  1G7T A;  5BSY A;  3OOC A;  4Y9R A;  4H9G A;  4XKW A;  3AVT A;  1KK3 A;  2E1R A;  4LBV A;  4F7D A;  3KL9 A;  2JJ2 A;  4WZT A;  1QVG B;  2C77 A;  3FJO A;  4OOV A;  4X05 A;  3R6K A;  1YJN B;  1I8D A;  4YAU A;  3GSI A;  4YEL A;  1WU8 A;  4P22 A;  4DK1 A;  1OB0 A;  3B82 A;  3PVD A;  3ASR A;  4AF7 A;  4CQJ A;  1JA1 A;  2C4T A;  5FA6 A;  3ZZT A;  1RQR A;  4YXW A;  3FPP A;  4Z4W A;  4QVJ A;  1Y0R A;  2BF4 A;  2PE3 A;  3B8H A;  3SJP A;  2YWH A;  1S0U A;  3H9N A;  1N05 A;  5CDF A;  5BSX A;  2D3N A;  5KW9 A;  1DDI A;  2V7U A;  3SKB A;  4JMQ A;  3GVJ A;  3ZUG A;  1QH0 A;  3A3B A;  4P9S A;  2Q6L A;  5H5J A;  1ZUN B;  4XN0 A;  1KK0 A;  4AVZ A;  1S4M A;  4X7E A;  3KEW A;  3MHP A;  4Z4R A;  3VNU A;  4PC3 A;  1KC8 D;  3U6K A;  4P3Y A;  1K8A D;  4XQF A;  3BC9 A;  4FN5 A;  1D2E A;  1WP6 A;  1EFU A;  2DER A;  1UD3 A;  1PJ6 A;  3WQZ A;  3WBJ A;  1B2R A;  4ASU A;  2OK8 A;  3CCQ B;  3ONU A;  2WJY A;  1Q9S A;  4YAF A;  1DG1 G;  1T5E A;  3SEJ A;  3JQR A;  1KJZ A;  2CW5 A;  3JQQ A;  4J0Q A;  5KSW B;  4TMW A;  3OZU A;  4XLC A;  3PA1 A;  1TUI A;  3G4S B;  3AGQ A;  1XE1 A;  4ZGQ B;  1QUF A;  2ZZG A;  1VQN B;  4XMY A;  2V7X A;  5LMZ A;  1UD4 A;  3OEH A;  5E6T A;  2PMD A;  3RY8 A;  1E64 A;  3CP2 A;  1NB0 A;  1VHE A;  3OJW A;  4X0C A;  2Q6K A; 
#chains in the Genus database with same CATH homology
 4QV2 A;  2ZL7 A;  4RPD A;  3ASP A;  3BY1 A;  3SLN A;  4RDJ A;  3BY2 A;  4OP7 A;  5HZA A;  4Z4S A;  4OPV A;  3Q38 A;  4P2N A;  3D26 A;  4WZE A;  2OBS A;  3PA2 A;  3Q6Q A;  4X7C A;  5HZB A;  3LQ6 A;  4ROX A;  4QVA A;  4Z4U A;  4WZK A;  3PUM A;  4OOS A;  4OPS A;  4RM0 A;  3ASS A;  2ZL6 A;  5BSY A;  3Q3A A;  4X07 A;  4Z4Z A;  5IYP A;  3Q39 A;  3LQE A;  3PUN A;  3Q6R A;  4WZL A;  4WZT A;  3ASQ A;  4P3I A;  4P1V A;  4RLZ A;  4OOV A;  2OBT A;  4X05 A;  5IYQ A;  3R6K A;  3PVD A;  3ASR A;  4OOX A;  5F4M A;  5J35 A;  4Z4W A;  4QVJ A;  3SJP A;  5KW9 A;  5BSX A;  5J3O A;  3SLD A;  3SKB A;  4P26 A;  4X7F A;  4X7E A;  2ZL5 A;  4Z4R A;  4X7D A;  4Z4T A;  4OPO A;  4P12 A;  5IYR A;  3ONU A;  4P25 A;  4QUZ A;  4RPB A;  3SEJ A;  3AST A;  3ONY A;  2OBR A;  3BQJ A;  3PA1 A;  5IYN A;  5IYW A;  4RDK A;  3V7A A;  3R6J A;  1IHM A;  5E6T A;  4Z4V A;  3RY8 A;  4X06 A;  4RDL A;  5F4J A;  4Z4Y A;  4X0C A;  5F4O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...