4P2NA

Structure of the p domain from a gi.7 norovirus variant in complex with lex hbga
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
295
structure length
285
Chain Sequence
QLTVPNIPLNNLANSRVPAMINKMTVSTDQNQVVQFQNGRCTLEGQLLGTTPVSASQVARIRGKVFSTASGKGLNLTELDGTPYHASPAPLGFPDIGACDWHVSTFKVDQNLSGDPMSRLDVKQNAPFAPHLGSIEFTSDQDPTGDQLGTLAWVSPSTSGARVDPWKIPSYHLAPPIFPPGFGEAIVYFMSDFPIVSGNTAQVPCTLPQEFVSHFVEQQAPVRGEAALLHYVDPDTHRNLGEFKLYPDGFITCVPNTGGGPQNLPTNGVFVFSSWVSRYYQLKPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Major capsid protein
publication title Structural analysis of determinants of histo-blood group antigen binding specificity in genogroup I noroviruses.
pubmed doi rcsb
source organism Norovirus hu/gi.7/tch-060/usa/2003
molecule tags Viral protein
total genus 63
structure length 285
sequence length 295
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-03-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.120 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Positive stranded ssRNA viruses 4p2nA02
2.40.510.10 Mainly Beta Beta Barrel Nucleoplasmin-like/VP (viral coat and capsid proteins) Positive stranded ssRNA viruses 4p2nA01
2OBSA 4X7EA 3ASSA 3ASTA 4OOSA 4P26A 5HZBA 4Z4VA 4RPBA 5IYPA 3V7AA 4X05A 3ONUA 5F4JA 4P12A 4X0CA 4P25A 4P3IA 5IYNA 3Q39A 3SKBA 3SLNA 3D26A 4RDLA 4X07A 4WZTA 4X06A 3ASQA 3RY8A 4OPOA 4RPDA 3R6JA 4Z4SA 4X7DA 4Z4TA 4WZKA 3BQJA 4WZEA 4P1VA 4OOXA 5IYQA 3PA2A 3ONYA 5J3OA 4P2NA 4WZLA 3PVDA 2ZL5A 3BY1A 3Q3AA 4OOVA 4OPVA 2OBTA 4ROXA 4RDKA 4Z4RA 4QV2A 3Q6QA 3Q6RA 4QVAA 4Z4YA 3BY2A 3PUMA 3LQEA 5KW9A 3SLDA 4X7CA 2ZL7A 5HZAA 5E6TA 5IYRA 5IYWA 3LQ6A 1IHMA 4Z4UA 4X7FA 3PUNA 4RDJA 4RM0A 4OP7A 5BSXA 4QVJA 4Z4ZA 3SJPA 5F4OA 3ASRA 3PA1A 4QUZA 2ZL6A 2OBRA 3ASPA 5F4MA 4OPSA 5J35A 3R6KA 5BSYA 4RLZA 3SEJA 3Q38A 4Z4WA
chains in the Genus database with same CATH superfamily
1GO2A 1KQSB 1E63A 4GQNA 3CMAB 2VNKA 4RD3A 1W0KA 3JQPA 3ASTA 4II2A 4J0QA 1UD8A 2C2WA 3JQQA 1FNCA 2VBSA 3OJWA 2DETA 5CDFA 4RCZA 3GIRA 3OZVA 4Z4VA 1VJSA 2ZTNA 2C5BA 4XL9A 2ZZGA 5LMZA 3CMMA 3V7AA 3ONUA 3FKSA 3A3BA 5IYNA 4II3A 1GAWA 2GREA 1WU8A 1W34A 4P6YA 2ZBVA 2GK7A 1R5BA 3AVYA 1PJ5A 4XOPA 4PC2A 1SKQA 2F43A 3G4SB 1NB9A 3VNUA 1VQ8B 3PENA 4C43A 5L46A 1UD2A 3GVJA 3JQRA 4B3XA 4XLEA 1OB2A 5TR9A 3A8KA 1QVFB 1RQRA 2V7VA 2X6YA 4UZEA 2BPOA 2WJVA 4WZTA 4XMYA 3AVTA 3RY8A 2GJRA 2Q6IA 3R6JA 4RD2A 5HKKA 4YAUA 2RC6A 3CCQB 1WOOA 3W2GA 1JA0A 1JB9A 1QGAA 4LBYA 3LNNA 1HVXA 4PABA 4TT3A 3B82A 2V7XA 3WQZA 1H42A 1H85A 1Q9SA 2CC2A 4P1VA 2WJYA 4WZEA 5FO1A 1YIJB 1Q86D 1B23P 3ZZTA 4ACAA 1FNBA 3ZZ0A 1VQMB 5THXA 3E1YE 2GJPA 1F60A 1K8AD 2D3NA 2WR8A 4UAJA 4OOVA 3QFTA 5FNZA 3U6KA 2DIEA 5TRDA 2X0KA 1CQXA 2OK7A 2X3UA 4G7WA 1I18A 1D1NA 3FPPA 3Q6QA 1J9ZA 1N07A 2PLFA 1VQ9B 2BM0A 4ZCIA 4QVAA 2EFGA 2DCUA 2XNCA 1CNEA 3BY2A 2HLDA 1WOPA 4MYTA 1KC8D 3CXCB 3CCMB 3ZBUA 3ZZUA 3CCVB 4DK0A 2QGGA 3SLDA 3W2IA 3ES9A 4YAFA 4P9SA 2QN6A 3LQ6A 3WBKA 2C78A 2WZNA 4XM3A 3SJZA 4QVJA 4YELA 4Z4ZA 1E1QA 1VQ7B 3ASRA 4RD6A 4QUZA 2XZLA 2ZTGA 4TMWA 3ASPA 1WTHD 3CCEB 2GJKA 4Z1MA 2YWGA 3R6KA 4QHYA 5A89A 4P6VF 2ZZEA 2LZJA 1XFOA 3H94A 2XNJA 1E62A 3CP2A 4M2LA 2C4TA 1ZM9A 1W87A 1WSRA 3WYAA 4DQLA 1QGZA 4N3NA 1OHHA 1N06A 3CTAA 4M53A 2DYIA 1Q82D 2B5OA 2VYQA 2PE3A 1OB5A 2NPFA 1VLOA 3GQBA 5IK2A 4C0SA 1VHOA 1E3XA 5DN6A 1S72B 1SKYB 4P25A 3U6BA 1WSVA 3CB4A 1YJ9B 4X8IA 1AMOA 4NBSA 5KSWB 2JIZA 2QDXA 1ELOA 4Y7CA 2E1BA 3Q39A 1IB0A 1VLYA 3G05A 1T6YA 3QFRA 4EH1A 1EFUA 3ZC3A 4XN0A 3CCLB 1COWA 1D8TA 1QUEA 4G6IA 1NDHA 1KK1A 1JNYA 1EP1B 2KVOA 3OPOA 1FRQA 1VF7A 3P26A 1DDGA 1F20A 4DNTB 4X07A 4R71A 4X06A 2VNJA 1XE1A 4Z4WA 1WOSA 4PC1A 4OPOA 2WZPP 4Z4SA 1MABA 3VO2A 1KMHA 2OYNA 2V7TA 2BGJA 2YWFA 3WBJA 4XONA 3BQJA 3ZBTA 5H5JA 3CP8A 4XLFA 5IYQA 3BCFA 3CMEB 5FA6A 2VJJA 1A8PA 3PVDA 3A1PA 2OTLB 3WNCA 1VQOB 2BF4A 3BY1A 3CRZA 1EFRA 4XR6A 2ZZQA 1EFCA 2V7WA 5GV7A 4M1KA 4OPVA 1EFTA 1I7PA 4ROXA 3BC9A 4U9UA 1QFJA 1GR1A 2V4DA 1MRZA 2I1LA 4CQJA 5TV2A 4E0FA 4DK1A 2CNDA 2JDIA 1BLIA 3W5VA 4ZV4A 5B6IA 3OEHA 1EXMA 2BN4A 4LC0A 4AC9A 1KD1D 3V76A 1BJKA 2C4UA 1G7RA 3PUMA 3CPXA 2D9RA 1H8EA 1KZLA 2Q6OA 2XZPA 3KL9A 3W2HA 5KW9A 1GAQA 2BGIA 3A8IA 1BQEA 2ZXHA 4X7CA 3CCJB 5IYRA 4WQMA 5JBQA 1H8HA 1N05A 1Y0RA 1IHMA 1QGYA 2QE7A 4X7FA 4G1BA 3VR6A 4OP7A 4XQFA 1OGJA 3NE5B 3T51B 2XNDA 3CPWB 1YI2B 2X53S 4UZUA 5F4OA 1G7CA 3PA1A 4YHBA 2ZL6A 4HE5A 1QVGB 2R9VA 5FIUA 4RD1A 1TUIA 4ZGNB 5BSYA 4TMVA 3CCSB 1QX4A 1TTTA 1P4MA 2PMDA 3OFNA 4FXUA 4WWVA 2QTLA 4HIZA 1E1RA 4KKSA 2F4NA 3H9NA 4LBZA 3LO8A 1VQ6B 3A8JA 1UMKA 3ASSA 3LVBA 2XEXA 1B2RA 4YEJA 3WY9A 1YITB 4P26A 4UZFA 3ZIAA 2X6XA 5HZBA 1R5NA 4K1XA 4JMQA 3OZUA 3OW7A 2OTJB 2M5SA 1NBMA 2DEUA 2J7KA 4P12A 3W5UA 3WXMA 4X0CA 5TY0A 1YX2A 3I55B 4P3IA 2V7UA 1ZM2A 4B44A 3I1FA 3ZUGA 4AF7A 4P3YA 1WP6A 4G7XA 3CC7B 2NV4A 2CF4A 1XB2A 4TN1A 2XOKA 3W5HA 4NNJA 3SKBA 2D74A 1WORA 1RQPA 5H59A 1U2RA 1R5OA 4ACBA 4PC3A 2XZOA 3D26A 4RDLA 4XN3A 2BV3A 2QA4B 4B43A 2JJ1A 2QMUA 3E20A 4XLCA 2X8KA 2F1LA 3ASQA 4B4DA 4HE6A 4RPDA 2E1RA 4X7DA 3WNBA 2DOGA 3OOCA 1GJRA 1HZEA 4RD4A 2FVGA 4KKUA 5HXBA 1S0UA 3AGQA 1G7TA 1VQ4B 1PJ6A 2JN9A 4OOXA 4B3GA 3PA2A 1ZUNB 5J3OA 4P2NA 1T5EA 1YLOA 1VQLB 4XLAA 1N8RD 2PIAA 4Y9RA 3CW2A 4TKOB 1TLLA 1VHEA 2CRVA 4XD7A 2VBVA 1V5VA 3QFCA 3W2EA 4RDKA 1N0UA 2GK6A 1W0JA 4Z4RA 1KK0A 1FDRA 1E3ZA 1YJNB 3VNVA 4L8JA 1NB0A 1ZM4A 1DDIA 3Q6RA 2B7BA 1T6ZA 2W6IA 1E79A 2D3LA 4M0LA 2R6HA 3MHPA 4B48A 2AHOA 1DARA 1K28D 3DDYA 2FX3A 3LQEA 4DNRB 1S4MA 1E43A 2CW5A 5HZAA 1DG1G 1UD6A 5E6TA 1UD4A 2ZBUA 2DY1A 2Q6KA 2ZITA 2HMAA 3WNDA 1W35A 2BMWA 3OJXA 4RM0A 5BSXA 4FWTA 3SJPA 4AF6A 3AGPA 1KRHA 4YAWA 4Y9UA 4YXWA 1N0VC 1KK2A 3OP1A 4PGOA 4XNFA 3OZWA 3I56B 3MCAA 5J35A 4N3GA 2OK8A 4XLHA 1K9MD 2ZZFA 1G7SA 1M90D 4Q7JB 1UD3A 4RLZA 2HDNB 3CCRB 3SEJA 3Q38A 2VJIA 1OB0A 5GV8A 2ZXIA 4QFMA 2Q6LA 2OBSA 3KEWA 4X7EA 4OOSA 2GPJA 1D2EA 4PC7A 2EIXA 1NRKA 5FL7A 4XOTA 2BSAA 2VNHA 3BH4A 2CK3A 4BPRA 1JJ2B 2HCJB 1VQPB 2VNIA 2X6WA 4RPBA 5IYPA 4RJLA 4X05A 5F4JA 4AVZA 3CC4B 1V0EA 3BNWA 1PKVA 4B3FX 1JA1A 1KTVA 1PJ7A 4ZGQB 1IJFA 2YWHA 1SM4A 3SLNA 1KK3A 5A8AA 1EP3B 1BPLA 4TMZA 4RCYA 2C5HA 2WSSA 4ASUA 4YALA 3A3GA 3A35A 4FN5A 3MMPA 4H9GA 1VQNB 4LBWA 2WYRA 3QSYA 3QFSA 3CESA 1I8DA 3GSIA 4FK8A 3AVUA 3ISXA 4G1VA 4Z4TA 4WZKA 1N08A 5EMNA 5AN9A 3BCDA 4IW3B 2VBTA 1AIPA 4TSFA 3ZPNA 1V0FA 1Q81D 3HAGA 2DERA 1Q7YD 3ONYA 5A88A 4TMXA 1NJID 1EWYA 2CBXA 4WZLA 1QG0A 3OAAA 4G5GA 3FPKA 2XGJA 2BM1A 3GVKA 2ZL5A 3AVWA 3AVVA 2Z6BD 1OGIA 1FRNA 3Q3AA 1YHQB 4TMTA 4YAOA 3G6EB 1FX0A 3JU4A 3OKXA 4M4SA 1EP2B 5DS0A 3W2FA 2OBTA 3J81k 4QV2A 4XKVA 4XORA 1BMFA 1WPCA 3GVLA 3G71B 2X85A 1M1KD 1VQKB 3OW2B 4B47A 4LBVA 4ZCMA 2QTZA 1W9XA 2QEXB 4NCNA 4MYUA 4Z4YA 1VQ5B 2VZLA 1ZM3A 3CC2B 2B7CA 3AVXA 4KKTA 1BX0A 1FNDA 3VMFA 2W6JA 2JJ2A 1TVCA 2V7QA 4PAAA 5DSZA 4XKWA 1K73D 1GVHA 2RC5A 3P27A 2C77A 2ZL7A 1Y0YA 5IYWA 2GQFA 1E64A 3VO1A 2F1MA 1KJZA 2VBUA 2V31A 1BX1A 3T53B 3OE7A 4Z4UA 1YJWB 3PUNA 4RDJA 3B78A 4F7DA 3QE2A 1FNMA 4RD0A 3T56B 1WDTA 3OEEA 1W2BB 4ZCLA 3CD6B 1QUFA 2P3MA 2OBRA 5F4MA 3CCUB 3U2QA 1QFZA 2YWEA 2WPDA 2BVNA 1T6XA 4OPSA 3FJOA 1QH0A 4PC6A 1HA3A 4P22A 1XQBA 1QFYA 1CNFA 5FO0A 4DQKA 5KNLA 3B8HA 1IJEA 1UD5A
chains in the Genus database with same CATH topology
2OBSA 4X7EA 3ASSA 3ASTA 4OOSA 4P26A 5HZBA 4Z4VA 4RPBA 5IYPA 3V7AA 4X05A 3ONUA 5F4JA 4P12A 4X0CA 4P25A 4P3IA 5IYNA 3Q39A 3SKBA 3SLNA 3D26A 4RDLA 4X07A 4WZTA 4X06A 3ASQA 3RY8A 4OPOA 4RPDA 3R6JA 4Z4SA 4X7DA 4Z4TA 4WZKA 3BQJA 4WZEA 4P1VA 4OOXA 5IYQA 3PA2A 3ONYA 5J3OA 4P2NA 4WZLA 3PVDA 2ZL5A 3BY1A 3Q3AA 4OOVA 4OPVA 2OBTA 4ROXA 4RDKA 4Z4RA 4QV2A 3Q6QA 3Q6RA 4QVAA 4Z4YA 3BY2A 3PUMA 3LQEA 5KW9A 3SLDA 4X7CA 2ZL7A 5HZAA 5E6TA 5IYRA 5IYWA 3LQ6A 1IHMA 4Z4UA 4X7FA 3PUNA 4RDJA 4RM0A 4OP7A 5BSXA 4QVJA 4Z4ZA 3SJPA 5F4OA 3ASRA 3PA1A 4QUZA 2ZL6A 2OBRA 3ASPA 5F4MA 4OPSA 5J35A 3R6KA 5BSYA 4RLZA 3SEJA 3Q38A 4Z4WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OBS A;  4X7E A;  3ASS A;  3AST A;  4OOS A;  4P26 A;  5HZB A;  4Z4V A;  4RPB A;  5IYP A;  3V7A A;  4X05 A;  3ONU A;  5F4J A;  4P12 A;  4X0C A;  4P25 A;  4P3I A;  5IYN A;  3Q39 A;  3SKB A;  3SLN A;  3D26 A;  4RDL A;  4X07 A;  4WZT A;  4X06 A;  3ASQ A;  3RY8 A;  4OPO A;  4RPD A;  3R6J A;  4Z4S A;  4X7D A;  4Z4T A;  4WZK A;  3BQJ A;  4WZE A;  4P1V A;  4OOX A;  5IYQ A;  3PA2 A;  3ONY A;  5J3O A;  4P2N A;  4WZL A;  3PVD A;  2ZL5 A;  3BY1 A;  3Q3A A;  4OOV A;  4OPV A;  2OBT A;  4ROX A;  4RDK A;  4Z4R A;  4QV2 A;  3Q6Q A;  3Q6R A;  4QVA A;  4Z4Y A;  3BY2 A;  3PUM A;  3LQE A;  5KW9 A;  3SLD A;  4X7C A;  2ZL7 A;  5HZA A;  5E6T A;  5IYR A;  5IYW A;  3LQ6 A;  1IHM A;  4Z4U A;  4X7F A;  3PUN A;  4RDJ A;  4RM0 A;  4OP7 A;  5BSX A;  4QVJ A;  4Z4Z A;  3SJP A;  5F4O A;  3ASR A;  3PA1 A;  4QUZ A;  2ZL6 A;  2OBR A;  3ASP A;  5F4M A;  4OPS A;  5J35 A;  3R6K A;  5BSY A;  4RLZ A;  3SEJ A;  3Q38 A;  4Z4W A; 
#chains in the Genus database with same CATH topology
 1GO2 A;  1KQS B;  1E63 A;  4GQN A;  3CMA B;  2VNK A;  4RD3 A;  1W0K A;  3JQP A;  3AST A;  4II2 A;  4J0Q A;  1UD8 A;  2C2W A;  3JQQ A;  1FNC A;  2VBS A;  3OJW A;  2DET A;  5CDF A;  4RCZ A;  3GIR A;  3OZV A;  4Z4V A;  1VJS A;  2ZTN A;  2C5B A;  4XL9 A;  2ZZG A;  5LMZ A;  3CMM A;  3V7A A;  3ONU A;  3FKS A;  3A3B A;  5IYN A;  4II3 A;  1GAW A;  2GRE A;  1WU8 A;  1W34 A;  4P6Y A;  2ZBV A;  2GK7 A;  1R5B A;  3AVY A;  1PJ5 A;  4XOP A;  4PC2 A;  1SKQ A;  2F43 A;  3G4S B;  1NB9 A;  3VNU A;  1VQ8 B;  3PEN A;  4C43 A;  5L46 A;  1UD2 A;  3GVJ A;  3JQR A;  4B3X A;  4XLE A;  1OB2 A;  5TR9 A;  3A8K A;  1QVF B;  1RQR A;  2V7V A;  2X6Y A;  4UZE A;  2BPO A;  2WJV A;  4WZT A;  4XMY A;  3AVT A;  3RY8 A;  2GJR A;  2Q6I A;  3R6J A;  4RD2 A;  5HKK A;  4YAU A;  2RC6 A;  3CCQ B;  1WOO A;  3W2G A;  1JA0 A;  1JB9 A;  1QGA A;  4LBY A;  3LNN A;  1HVX A;  4PAB A;  4TT3 A;  3B82 A;  2V7X A;  3WQZ A;  1H42 A;  1H85 A;  1Q9S A;  2CC2 A;  4P1V A;  2WJY A;  4WZE A;  5FO1 A;  1YIJ B;  1Q86 D;  1B23 P;  3ZZT A;  4ACA A;  1FNB A;  3ZZ0 A;  1VQM B;  5THX A;  3E1Y E;  2GJP A;  1F60 A;  1K8A D;  2D3N A;  2WR8 A;  4UAJ A;  4OOV A;  3QFT A;  5FNZ A;  3U6K A;  2DIE A;  5TRD A;  2X0K A;  1CQX A;  2OK7 A;  2X3U A;  4G7W A;  1I18 A;  1D1N A;  3FPP A;  3Q6Q A;  1J9Z A;  1N07 A;  2PLF A;  1VQ9 B;  2BM0 A;  4ZCI A;  4QVA A;  2EFG A;  2DCU A;  2XNC A;  1CNE A;  3BY2 A;  2HLD A;  1WOP A;  4MYT A;  1KC8 D;  3CXC B;  3CCM B;  3ZBU A;  3ZZU A;  3CCV B;  4DK0 A;  2QGG A;  3SLD A;  3W2I A;  3ES9 A;  4YAF A;  4P9S A;  2QN6 A;  3LQ6 A;  3WBK A;  2C78 A;  2WZN A;  4XM3 A;  3SJZ A;  4QVJ A;  4YEL A;  4Z4Z A;  1E1Q A;  1VQ7 B;  3ASR A;  4RD6 A;  4QUZ A;  2XZL A;  2ZTG A;  4TMW A;  3ASP A;  1WTH D;  3CCE B;  2GJK A;  4Z1M A;  2YWG A;  3R6K A;  4QHY A;  5A89 A;  4P6V F;  2ZZE A;  2LZJ A;  1XFO A;  3H94 A;  2XNJ A;  1E62 A;  3CP2 A;  4M2L A;  2C4T A;  1ZM9 A;  1W87 A;  1WSR A;  3WYA A;  4DQL A;  1QGZ A;  4N3N A;  1OHH A;  1N06 A;  3CTA A;  4M53 A;  2DYI A;  1Q82 D;  2B5O A;  2VYQ A;  2PE3 A;  1OB5 A;  2NPF A;  1VLO A;  3GQB A;  5IK2 A;  4C0S A;  1VHO A;  1E3X A;  5DN6 A;  1S72 B;  1SKY B;  4P25 A;  3U6B A;  1WSV A;  3CB4 A;  1YJ9 B;  4X8I A;  1AMO A;  4NBS A;  5KSW B;  2JIZ A;  2QDX A;  1ELO A;  4Y7C A;  2E1B A;  3Q39 A;  1IB0 A;  1VLY A;  3G05 A;  1T6Y A;  3QFR A;  4EH1 A;  1EFU A;  3ZC3 A;  4XN0 A;  3CCL B;  1COW A;  1D8T A;  1QUE A;  4G6I A;  1NDH A;  1KK1 A;  1JNY A;  1EP1 B;  2KVO A;  3OPO A;  1FRQ A;  1VF7 A;  3P26 A;  1DDG A;  1F20 A;  4DNT B;  4X07 A;  4R71 A;  4X06 A;  2VNJ A;  1XE1 A;  4Z4W A;  1WOS A;  4PC1 A;  4OPO A;  2WZP P;  4Z4S A;  1MAB A;  3VO2 A;  1KMH A;  2OYN A;  2V7T A;  2BGJ A;  2YWF A;  3WBJ A;  4XON A;  3BQJ A;  3ZBT A;  5H5J A;  3CP8 A;  4XLF A;  5IYQ A;  3BCF A;  3CME B;  5FA6 A;  2VJJ A;  1A8P A;  3PVD A;  3A1P A;  2OTL B;  3WNC A;  1VQO B;  2BF4 A;  3BY1 A;  3CRZ A;  1EFR A;  4XR6 A;  2ZZQ A;  1EFC A;  2V7W A;  5GV7 A;  4M1K A;  4OPV A;  1EFT A;  1I7P A;  4ROX A;  3BC9 A;  4U9U A;  1QFJ A;  1GR1 A;  2V4D A;  1MRZ A;  2I1L A;  4CQJ A;  5TV2 A;  4E0F A;  4DK1 A;  2CND A;  2JDI A;  1BLI A;  3W5V A;  4ZV4 A;  5B6I A;  3OEH A;  1EXM A;  2BN4 A;  4LC0 A;  4AC9 A;  1KD1 D;  3V76 A;  1BJK A;  2C4U A;  1G7R A;  3PUM A;  3CPX A;  2D9R A;  1H8E A;  1KZL A;  2Q6O A;  2XZP A;  3KL9 A;  3W2H A;  5KW9 A;  1GAQ A;  2BGI A;  3A8I A;  1BQE A;  2ZXH A;  4X7C A;  3CCJ B;  5IYR A;  4WQM A;  5JBQ A;  1H8H A;  1N05 A;  1Y0R A;  1IHM A;  1QGY A;  2QE7 A;  4X7F A;  4G1B A;  3VR6 A;  4OP7 A;  4XQF A;  1OGJ A;  3NE5 B;  3T51 B;  2XND A;  3CPW B;  1YI2 B;  2X53 S;  4UZU A;  5F4O A;  1G7C A;  3PA1 A;  4YHB A;  2ZL6 A;  4HE5 A;  1QVG B;  2R9V A;  5FIU A;  4RD1 A;  1TUI A;  4ZGN B;  5BSY A;  4TMV A;  3CCS B;  1QX4 A;  1TTT A;  1P4M A;  2PMD A;  3OFN A;  4FXU A;  4WWV A;  2QTL A;  4HIZ A;  1E1R A;  4KKS A;  2F4N A;  3H9N A;  4LBZ A;  3LO8 A;  1VQ6 B;  3A8J A;  1UMK A;  3ASS A;  3LVB A;  2XEX A;  1B2R A;  4YEJ A;  3WY9 A;  1YIT B;  4P26 A;  4UZF A;  3ZIA A;  2X6X A;  5HZB A;  1R5N A;  4K1X A;  4JMQ A;  3OZU A;  3OW7 A;  2OTJ B;  2M5S A;  1NBM A;  2DEU A;  2J7K A;  4P12 A;  3W5U A;  3WXM A;  4X0C A;  5TY0 A;  1YX2 A;  3I55 B;  4P3I A;  2V7U A;  1ZM2 A;  4B44 A;  3I1F A;  3ZUG A;  4AF7 A;  4P3Y A;  1WP6 A;  4G7X A;  3CC7 B;  2NV4 A;  2CF4 A;  1XB2 A;  4TN1 A;  2XOK A;  3W5H A;  4NNJ A;  3SKB A;  2D74 A;  1WOR A;  1RQP A;  5H59 A;  1U2R A;  1R5O A;  4ACB A;  4PC3 A;  2XZO A;  3D26 A;  4RDL A;  4XN3 A;  2BV3 A;  2QA4 B;  4B43 A;  2JJ1 A;  2QMU A;  3E20 A;  4XLC A;  2X8K A;  2F1L A;  3ASQ A;  4B4D A;  4HE6 A;  4RPD A;  2E1R A;  4X7D A;  3WNB A;  2DOG A;  3OOC A;  1GJR A;  1HZE A;  4RD4 A;  2FVG A;  4KKU A;  5HXB A;  1S0U A;  3AGQ A;  1G7T A;  1VQ4 B;  1PJ6 A;  2JN9 A;  4OOX A;  4B3G A;  3PA2 A;  1ZUN B;  5J3O A;  4P2N A;  1T5E A;  1YLO A;  1VQL B;  4XLA A;  1N8R D;  2PIA A;  4Y9R A;  3CW2 A;  4TKO B;  1TLL A;  1VHE A;  2CRV A;  4XD7 A;  2VBV A;  1V5V A;  3QFC A;  3W2E A;  4RDK A;  1N0U A;  2GK6 A;  1W0J A;  4Z4R A;  1KK0 A;  1FDR A;  1E3Z A;  1YJN B;  3VNV A;  4L8J A;  1NB0 A;  1ZM4 A;  1DDI A;  3Q6R A;  2B7B A;  1T6Z A;  2W6I A;  1E79 A;  2D3L A;  4M0L A;  2R6H A;  3MHP A;  4B48 A;  2AHO A;  1DAR A;  1K28 D;  3DDY A;  2FX3 A;  3LQE A;  4DNR B;  1S4M A;  1E43 A;  2CW5 A;  5HZA A;  1DG1 G;  1UD6 A;  5E6T A;  1UD4 A;  2ZBU A;  2DY1 A;  2Q6K A;  2ZIT A;  2HMA A;  3WND A;  1W35 A;  2BMW A;  3OJX A;  4RM0 A;  5BSX A;  4FWT A;  3SJP A;  4AF6 A;  3AGP A;  1KRH A;  4YAW A;  4Y9U A;  4YXW A;  1N0V C;  1KK2 A;  3OP1 A;  4PGO A;  4XNF A;  3OZW A;  3I56 B;  3MCA A;  5J35 A;  4N3G A;  2OK8 A;  4XLH A;  1K9M D;  2ZZF A;  1G7S A;  1M90 D;  4Q7J B;  1UD3 A;  4RLZ A;  2HDN B;  3CCR B;  3SEJ A;  3Q38 A;  2VJI A;  1OB0 A;  5GV8 A;  2ZXI A;  4QFM A;  2Q6L A;  2OBS A;  3KEW A;  4X7E A;  4OOS A;  2GPJ A;  1D2E A;  4PC7 A;  2EIX A;  1NRK A;  5FL7 A;  4XOT A;  2BSA A;  2VNH A;  3BH4 A;  2CK3 A;  4BPR A;  1JJ2 B;  2HCJ B;  1VQP B;  2VNI A;  2X6W A;  4RPB A;  5IYP A;  4RJL A;  4X05 A;  5F4J A;  4AVZ A;  3CC4 B;  1V0E A;  3BNW A;  1PKV A;  4B3F X;  1JA1 A;  1KTV A;  1PJ7 A;  4ZGQ B;  1IJF A;  2YWH A;  1SM4 A;  3SLN A;  1KK3 A;  5A8A A;  1EP3 B;  1BPL A;  4TMZ A;  4RCY A;  2C5H A;  2WSS A;  4ASU A;  4YAL A;  3A3G A;  3A35 A;  4FN5 A;  3MMP A;  4H9G A;  1VQN B;  4LBW A;  2WYR A;  3QSY A;  3QFS A;  3CES A;  1I8D A;  3GSI A;  4FK8 A;  3AVU A;  3ISX A;  4G1V A;  4Z4T A;  4WZK A;  1N08 A;  5EMN A;  5AN9 A;  3BCD A;  4IW3 B;  2VBT A;  1AIP A;  4TSF A;  3ZPN A;  1V0F A;  1Q81 D;  3HAG A;  2DER A;  1Q7Y D;  3ONY A;  5A88 A;  4TMX A;  1NJI D;  1EWY A;  2CBX A;  4WZL A;  1QG0 A;  3OAA A;  4G5G A;  3FPK A;  2XGJ A;  2BM1 A;  3GVK A;  2ZL5 A;  3AVW A;  3AVV A;  2Z6B D;  1OGI A;  1FRN A;  3Q3A A;  1YHQ B;  4TMT A;  4YAO A;  3G6E B;  1FX0 A;  3JU4 A;  3OKX A;  4M4S A;  1EP2 B;  5DS0 A;  3W2F A;  2OBT A;  3J81 k;  4QV2 A;  4XKV A;  4XOR A;  1BMF A;  1WPC A;  3GVL A;  3G71 B;  2X85 A;  1M1K D;  1VQK B;  3OW2 B;  4B47 A;  4LBV A;  4ZCM A;  2QTZ A;  1W9X A;  2QEX B;  4NCN A;  4MYU A;  4Z4Y A;  1VQ5 B;  2VZL A;  1ZM3 A;  3CC2 B;  2B7C A;  3AVX A;  4KKT A;  1BX0 A;  1FND A;  3VMF A;  2W6J A;  2JJ2 A;  1TVC A;  2V7Q A;  4PAA A;  5DSZ A;  4XKW A;  1K73 D;  1GVH A;  2RC5 A;  3P27 A;  2C77 A;  2ZL7 A;  1Y0Y A;  5IYW A;  2GQF A;  1E64 A;  3VO1 A;  2F1M A;  1KJZ A;  2VBU A;  2V31 A;  1BX1 A;  3T53 B;  3OE7 A;  4Z4U A;  1YJW B;  3PUN A;  4RDJ A;  3B78 A;  4F7D A;  3QE2 A;  1FNM A;  4RD0 A;  3T56 B;  1WDT A;  3OEE A;  1W2B B;  4ZCL A;  3CD6 B;  1QUF A;  2P3M A;  2OBR A;  5F4M A;  3CCU B;  3U2Q A;  1QFZ A;  2YWE A;  2WPD A;  2BVN A;  1T6X A;  4OPS A;  3FJO A;  1QH0 A;  4PC6 A;  1HA3 A;  4P22 A;  1XQB A;  1QFY A;  1CNF A;  5FO0 A;  4DQK A;  5KNL A;  3B8H A;  1IJE A;  1UD5 A; 
#chains in the Genus database with same CATH homology
 2OBS A;  4X7E A;  3ASS A;  3AST A;  4OOS A;  4P26 A;  5HZB A;  4Z4V A;  4RPB A;  5IYP A;  3V7A A;  4X05 A;  3ONU A;  5F4J A;  4P12 A;  4X0C A;  4P25 A;  4P3I A;  5IYN A;  3Q39 A;  3SKB A;  3SLN A;  3D26 A;  4RDL A;  4X07 A;  4WZT A;  4X06 A;  3ASQ A;  3RY8 A;  4OPO A;  4RPD A;  3R6J A;  4Z4S A;  4X7D A;  4Z4T A;  4WZK A;  3BQJ A;  4WZE A;  4P1V A;  4OOX A;  5IYQ A;  3PA2 A;  3ONY A;  5J3O A;  4P2N A;  4WZL A;  3PVD A;  2ZL5 A;  3BY1 A;  3Q3A A;  4OOV A;  4OPV A;  2OBT A;  4ROX A;  4RDK A;  4Z4R A;  4QV2 A;  3Q6Q A;  3Q6R A;  4QVA A;  4Z4Y A;  3BY2 A;  3PUM A;  3LQE A;  5KW9 A;  3SLD A;  4X7C A;  2ZL7 A;  5HZA A;  5E6T A;  5IYR A;  5IYW A;  3LQ6 A;  1IHM A;  4Z4U A;  4X7F A;  3PUN A;  4RDJ A;  4RM0 A;  4OP7 A;  5BSX A;  4QVJ A;  4Z4Z A;  3SJP A;  5F4O A;  3ASR A;  3PA1 A;  4QUZ A;  2ZL6 A;  2OBR A;  3ASP A;  5F4M A;  4OPS A;  5J35 A;  3R6K A;  5BSY A;  4RLZ A;  3SEJ A;  3Q38 A;  4Z4W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...