4P2NA

Structure of the p domain from a gi.7 norovirus variant in complex with lex hbga
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
295
structure length
285
Chain Sequence
QLTVPNIPLNNLANSRVPAMINKMTVSTDQNQVVQFQNGRCTLEGQLLGTTPVSASQVARIRGKVFSTASGKGLNLTELDGTPYHASPAPLGFPDIGACDWHVSTFKVDQNLSGDPMSRLDVKQNAPFAPHLGSIEFTSDQDPTGDQLGTLAWVSPSTSGARVDPWKIPSYHLAPPIFPPGFGEAIVYFMSDFPIVSGNTAQVPCTLPQEFVSHFVEQQAPVRGEAALLHYVDPDTHRNLGEFKLYPDGFITCVPNTGGGPQNLPTNGVFVFSSWVSRYYQLKPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of determinants of histo-blood group antigen binding specificity in genogroup I noroviruses.
pubmed doi rcsb
source organism Norovirus hu/gi.7/tch-060/usa/2003
molecule tags Viral protein
molecule keywords Major capsid protein
total genus 63
structure length 285
sequence length 295
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-03-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.120 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Positive stranded ssRNA viruses 4p2nA02
2.40.510.10 Mainly Beta Beta Barrel Nucleoplasmin-like/VP (viral coat and capsid proteins) Positive stranded ssRNA viruses 4p2nA01
4RM0A 4P2NA 1IHMA 4Z4VA 3Q6RA 5KW9A 3PA2A 4QVJA 4Z4YA 2ZL7A 4Z4WA 4RPBA 4ROXA 4Z4RA 4OOSA 5HZBA 2OBSA 4WZKA 4QVAA 4Z4ZA 5IYPA 5E6TA 4P3IA 3D26A 5HZAA 4WZEA 5F4JA 3Q38A 4Z4UA 5F4OA 3ASPA 4X07A 3LQEA 4X7CA 3R6JA 4X0CA 4P26A 2OBRA 3SLNA 3BY1A 4P25A 5BSYA 4X7FA 3BQJA 2ZL5A 4P12A 3ASRA 4X7DA 3PUMA 4QV2A 3BY2A 5IYQA 2OBTA 5IYWA 5IYRA 3SLDA 3PA1A 3R6KA 4OPOA 3ASQA 3LQ6A 4X05A 5F4MA 4Z4SA 3V7AA 3Q39A 4X7EA 3Q6QA 3RY8A 3Q3AA 3SKBA 4RDJA 5J3OA 4QUZA 3PUNA 3ASSA 3SEJA 3SJPA 3ONUA 4RLZA 4RPDA 4OPVA 4WZLA 3ASTA 4OP7A 2ZL6A 5BSXA 4RDKA 4X06A 4OPSA 4P1VA 4OOVA 5IYNA 3PVDA 4Z4TA 4OOXA 4RDLA 5J35A 4WZTA 3ONYA
chains in the Genus database with same CATH superfamily
3P27A 2JJ1A 3OW7A 4RD1A 4B4DA 4Z4VA 1KK2A 1XB2A 1UD5A 3ES9A 5A89A 2OTJB 1IJFA 3W5VA 4XN0A 4LC0A 3U2QA 3OOCA 3CESA 5JBQA 3OFNA 2PLFA 2ZL7A 4NBSA 2FVGA 3JQPA 3OKXA 1TTTA 5FO1A 4XQFA 3E1YE 4XLCA 2V4DA 3SJZA 3LVBA 1EP3B 3CCUB 1D8TA 1KC8D 4WZKA 1VQ7B 2XEXA 4QVAA 3CPXA 5E6TA 4B44A 3MMPA 2ZXIA 4LBWA 2GPJA 3QFSA 4MYTA 2XOKA 5F4JA 4G7WA 3P26A 2X6YA 2DY1A 4Z4UA 4KKUA 3G6EB 2KVOA 5F4OA 3T56B 4M1KA 5H59A 1E63A 2GK7A 1BPLA 2VJJA 4FWTA 2QN6A 3OEEA 3R6JA 4P26A 4QHYA 2ZZEA 1WP6A 5FNZA 5BSYA 3CC4B 1N08A 4UAJA 2BM0A 1I18A 3ZZUA 3AGPA 2XZPA 3FPPA 4R71A 2EIXA 4P12A 1DDGA 3ASRA 2QEXB 1F60A 2ZITA 1KQSB 4ASUA 2BF4A 2B5OA 2V7TA 1WSRA 2R9VA 4DNTB 4TMTA 1A8PA 3H94A 2V7WA 3FPKA 2OBTA 1ZM4A 4G7XA 3BC9A 2WJYA 3R6KA 3OJXA 3ASQA 3BCDA 4XLHA 1GO2A 3ISXA 3LQ6A 5F4MA 3G71B 1EFUA 1XQBA 4BPRA 1WOPA 3W2GA 3U6BA 3Q6QA 3JQQA 3FJOA 5TR9A 1R5NA 1KMHA 5J3OA 2VBVA 5GV8A 5THXA 1D2EA 2VZLA 2QA4B 2X0KA 4G1VA 1FDRA 4Y9RA 3SEJA 1VQPB 1QX4A 1UD6A 1G7SA 3G05A 4RPDA 3CTAA 4WZLA 3W5UA 1VQ6B 1W0JA 1VQMB 1COWA 4RDKA 4KKTA 4YAFA 4RD6A 4AF6A 3CCRB 3MCAA 1FNBA 2BV3A 3QE2A 3CW2A 4XL9A 3WNCA 1XFOA 4H9GA 5DS0A 3OP1A 5L46A 4M53A 4TSFA 4JMQA 1QUEA 4OOXA 1W2BB 4TMZA 5IK2A 1U2RA 5J35A 1YHQB 4B48A 1EWYA 4AVZA 1KZLA 4NNJA 3ZPNA 1B23P 1G7CA 1IHMA 1NB9A 2XZLA 5KW9A 4XMYA 1K73D 4B3FX 4XD7A 5AN9A 2ZZFA 4PC6A 4AC9A 1FRNA 2BVNA 2PE3A 4RPBA 4Z4RA 2VBSA 3H9NA 2BSAA 4UZEA 5TY0A 1PJ6A 4YEJA 1IJEA 4K1XA 5LMZA 3T53B 1VHOA 2HMAA 4YAUA 4M4SA 1V0EA 4PAAA 4Z4ZA 3CCJB 1OGIA 1E79A 2WZPP 5FO0A 4B43A 4XN3A 1ZUNB 2PIAA 5DN6A 1AIPA 3QSYA 1FNDA 4C0SA 4TMVA 2BMWA 1TVCA 2F1LA 2Q6KA 4L8JA 2Q6LA 2YWFA 1OB5A 2WSSA 1WSVA 2V7VA 3GVKA 4DQKA 3I55B 2VJIA 3VNUA 1DDIA 1KK1A 1E1RA 4KKSA 1PJ5A 3LO8A 2X8KA 3ZBUA 4YAWA 4ZCIA 4PC2A 2BGJA 2W6IA 2GK6A 3WBKA 4P25A 1WOSA 1ZM3A 2JJ2A 4RJLA 2GJRA 1F20A 4XOPA 2F43A 1NBMA 4P9SA 4YXWA 4ACBA 1DARA 2GREA 3ZIAA 1KK3A 3CP8A 3A3GA 1H85A 4Y7CA 1EP1B 3QFRA 1BX1A 1W34A 1UMKA 1VLYA 1R5OA 4M2LA 3KL9A 4WQMA 1H8HA 1QUFA 1EFRA 1Y0RA 1UD8A 2NPFA 4RCYA 2OTLB 2ZBUA 3PA1A 2EFGA 1B2RA 4OPOA 3OAAA 4ZGNB 3I56B 4G5GA 2OK8A 2DERA 1KRHA 1T6YA 3FKSA 4Z4SA 1KJZA 1QGYA 2AHOA 3V7AA 2Z6BD 4X7EA 1W0KA 5B6IA 2BM1A 2CF4A 4RD3A 1ZM9A 1NJID 3DDYA 4RDJA 4DK1A 2HDNB 3VR6A 1S0UA 2CBXA 1MRZA 1TLLA 3PUNA 4P22A 1JJ2B 3BNWA 4ACAA 2C2WA 1D1NA 3CCSB 3OW2B 3JQRA 1QVFB 2DCUA 2VYQA 4QFMA 4OPVA 2LZJA 1KK0A 2R6HA 3KEWA 5DSZA 3WNDA 4XKVA 3VO2A 1HZEA 2ZL6A 1NB0A 4X06A 5KSWB 4OPSA 1AMOA 4P1VA 2QTLA 3T51B 1QFYA 1EFTA 4RD4A 4E0FA 2DEUA 4TN1A 1G7RA 2E1BA 5IYNA 3W2FA 1VQNB 3PVDA 4B3XA 1QGAA 1I8DA 4ZCLA 2DYIA 4P6VF 4RDLA 1EXMA 3A35A 1BX0A 4WZTA 5A88A 4PABA 1WDTA 3CCEB 3OPOA 1IB0A 1WOOA 1R5BA 2WJVA 5HKKA 2YWEA 5FA6A 4EH1A 3W2IA 1E64A 1I7PA 4QVJA 4FXUA 5FL7A 4XLEA 3W2HA 3AVWA 2I1LA 3QFCA 2X3UA 4ROXA 4OOSA 4TKOB 2X6WA 2B7CA 5HZBA 3CMMA 2OBSA 2QMUA 4ZV4A 1V5VA 4YHBA 2ZTGA 3CB4A 1T6ZA 3AGQA 1OB2A 2V31A 5IYPA 3CXCB 1K8AD 3CRZA 4P3IA 2CRVA 3D26A 4RCZA 2F4NA 1CNFA 2ZZQA 1PJ7A 4WZEA 3Q38A 3GVJA 1CQXA 2BN4A 3LQEA 4XNFA 2VNJA 1SKYB 4G1BA 4U9UA 4X7CA 4XR6A 4XM3A 3CCQB 2XGJA 4DNRB 3CMEB 2OBRA 2YWGA 3AVUA 2JIZA 3SLNA 1FNMA 2C78A 1W35A 3WXMA 4LBYA 4Y9UA 1VJSA 2C4UA 4PC3A 4HE6A 1BMFA 4UZUA 4UZFA 4X7FA 1HA3A 1E43A 2DETA 1OGJA 3BQJA 3J81k 1YJNB 1SKQA 2F1MA 2BPOA 2DIEA 3B78A 1PKVA 2ZL5A 5FIUA 1YIJB 4AF7A 1E3XA 4TMWA 1YJWB 2C5HA 4RD0A 2FX3A 4RD2A 4PGOA 3OZWA 1EFCA 5H5JA 3PUMA 2OK7A 1BJKA 3WYAA 2ZXHA 4WWVA 3GSIA 4P6YA 4QV2A 1UD4A 3BY2A 4X8IA 5IYWA 4II3A 1Q82D 3SLDA 5TRDA 3B82A 5TV2A 1YJ9B 2XZOA 2C5BA 3OE7A 3NE5B 1GVHA 1JA1A 4DK0A 1FNCA 1BQEA 4FK8A 3CC7B 1QG0A 2RC6A 3Q3AA 3SKBA 4P3YA 2XNDA 4N3NA 4TT3A 3ZBTA 3U6KA 3G4SB 4QUZA 1N8RD 1T5EA 3HAGA 3B8HA 2B7BA 4TMXA 3ASSA 2D74A 4NCNA 3CC2B 3A1PA 2VBUA 3ZZTA 4RLZA 3CPWB 1VQKB 1WU8A 3BCFA 2W6JA 2X53S 5HXBA 2ZTNA 2WPDA 1QH0A 3ASTA 1M90D 4YELA 3QFTA 5GV7A 4OP7A 1H8EA 3OJWA 2GQFA 2V7XA 2DOGA 4M0LA 2VNIA 1K28D 2CNDA 2CW5A 2QGGA 4HE5A 1YITB 2Q6IA 2WZNA 3BH4A 3VNVA 4Z4TA 2XNCA 2YWHA 4Q7JB 3AVTA 1SM4A 2VBTA 1VQOB 1UD3A 3ZZ0A 3ONYA 4RM0A 4P2NA 3WY9A 1CNEA 4Z1MA 2QE7A 2M5SA 1JB9A 3Q6RA 5CDFA 2XNJA 3PA2A 4HIZA 4Z4YA 1VQ8B 1JA0A 2X85A 1E3ZA 2C4TA 4Z4WA 1N0VC 2WR8A 3AVVA 4II2A 2D3NA 1H42A 1GJRA 1MABA 3A8JA 4LBVA 3CCVB 1KD1D 2GJKA 1P4MA 3WQZA 3CCMB 1VHEA 2VNHA 1G7TA 2ZZGA 4ZCMA 1Y0YA 1WPCA 3LNNA 1GAQA 2WYRA 3E20A 4FN5A 1M1KD 1S4MA 1N07A 1YLOA 2OYNA 5HZAA 1QGZA 2QDXA 2GJPA 1N05A 4ZGQB 1Q86D 3CD6B 3ASPA 2JDIA 1XE1A 4X07A 4XLFA 3OEHA 1Q9SA 2V7QA 3W5HA 4X0CA 1J9ZA 1VQ9B 1K9MD 1TUIA 1S72B 3BY1A 3VMFA 3ZC3A 1N0UA 1YX2A 4J0QA 2CC2A 2BGIA 1VQLB 2X6XA 3A8KA 3CP2A 4XLAA 4N3GA 3I1FA 3WBJA 1V0FA 1ELOA 1YI2B 3V76A 4G6IA 1QFJA 4X7DA 2ZBVA 4B47A 2RC5A 2V7UA 4PC1A 3GIRA 1GR1A 1W87A 3GQBA 1DG1G 2C77A 2Q6OA 3ZUGA 4XORA 1BLIA 1N06A 5IYQA 4XOTA 1E1QA 5IYRA 1WTHD 2JN9A 1RQPA 1VF7A 3CCLB 3JU4A 4X05A 4XONA 1QVGB 4F7DA 1OB0A 3PENA 3Q39A 4YALA 1W9XA 1HVXA 3AVXA 3RY8A 1VQ4B 4IW3B 1Q81D 1GAWA 1ZM2A 3AVYA 1NDHA 3OZUA 2VNKA 1E62A 3MHPA 5KNLA 2PMDA 4YAOA 3OZVA 1VLOA 3SJPA 4CQJA 1WORA 3ONUA 1UD2A 3GVLA 4GQNA 2D9RA 1FRQA 4C43A 2J7KA 1T6XA 1FX0A 2D3LA 3W2EA 1Q7YD 2CK3A 5BSXA 1OHHA 1QFZA 2P3MA 1EP2B 2HLDA 4PC7A 4DQLA 2E1RA 4OOVA 3VO1A 3A8IA 4LBZA 2HCJB 1RQRA 3WNBA 5A8AA 2QTZA 1VQ5B 3CMAB 1JNYA 3A3BA 5EMNA 2NV4A 1NRKA 1KTVA 4B3GA 4XKWA 4MYUA
chains in the Genus database with same CATH topology
4RM0A 4P2NA 1IHMA 4Z4VA 3Q6RA 5KW9A 3PA2A 4QVJA 4Z4YA 2ZL7A 4Z4WA 4RPBA 4ROXA 4Z4RA 4OOSA 5HZBA 2OBSA 4WZKA 4QVAA 4Z4ZA 5IYPA 5E6TA 4P3IA 3D26A 5HZAA 4WZEA 5F4JA 3Q38A 4Z4UA 5F4OA 3ASPA 4X07A 3LQEA 4X7CA 3R6JA 4X0CA 4P26A 2OBRA 3SLNA 3BY1A 4P25A 5BSYA 4X7FA 3BQJA 2ZL5A 4P12A 3ASRA 4X7DA 3PUMA 4QV2A 3BY2A 5IYQA 2OBTA 5IYWA 5IYRA 3SLDA 3PA1A 3R6KA 4OPOA 3ASQA 3LQ6A 4X05A 5F4MA 4Z4SA 3V7AA 3Q39A 4X7EA 3Q6QA 3RY8A 3Q3AA 3SKBA 4RDJA 5J3OA 4QUZA 3PUNA 3ASSA 3SEJA 3SJPA 3ONUA 4RLZA 4RPDA 4OPVA 4WZLA 3ASTA 4OP7A 2ZL6A 5BSXA 4RDKA 4X06A 4OPSA 4P1VA 4OOVA 5IYNA 3PVDA 4Z4TA 4OOXA 4RDLA 5J35A 4WZTA 3ONYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RM0 A;  4P2N A;  1IHM A;  4Z4V A;  3Q6R A;  5KW9 A;  3PA2 A;  4QVJ A;  4Z4Y A;  2ZL7 A;  4Z4W A;  4RPB A;  4ROX A;  4Z4R A;  4OOS A;  5HZB A;  2OBS A;  4WZK A;  4QVA A;  4Z4Z A;  5IYP A;  5E6T A;  4P3I A;  3D26 A;  5HZA A;  4WZE A;  5F4J A;  3Q38 A;  4Z4U A;  5F4O A;  3ASP A;  4X07 A;  3LQE A;  4X7C A;  3R6J A;  4X0C A;  4P26 A;  2OBR A;  3SLN A;  3BY1 A;  4P25 A;  5BSY A;  4X7F A;  3BQJ A;  2ZL5 A;  4P12 A;  3ASR A;  4X7D A;  3PUM A;  4QV2 A;  3BY2 A;  5IYQ A;  2OBT A;  5IYW A;  5IYR A;  3SLD A;  3PA1 A;  3R6K A;  4OPO A;  3ASQ A;  3LQ6 A;  4X05 A;  5F4M A;  4Z4S A;  3V7A A;  3Q39 A;  4X7E A;  3Q6Q A;  3RY8 A;  3Q3A A;  3SKB A;  4RDJ A;  5J3O A;  4QUZ A;  3PUN A;  3ASS A;  3SEJ A;  3SJP A;  3ONU A;  4RLZ A;  4RPD A;  4OPV A;  4WZL A;  3AST A;  4OP7 A;  2ZL6 A;  5BSX A;  4RDK A;  4X06 A;  4OPS A;  4P1V A;  4OOV A;  5IYN A;  3PVD A;  4Z4T A;  4OOX A;  4RDL A;  5J35 A;  4WZT A;  3ONY A; 
#chains in the Genus database with same CATH topology
 3P27 A;  2JJ1 A;  3OW7 A;  4RD1 A;  4B4D A;  4Z4V A;  1KK2 A;  1XB2 A;  1UD5 A;  3ES9 A;  5A89 A;  2OTJ B;  1IJF A;  3W5V A;  4XN0 A;  4LC0 A;  3U2Q A;  3OOC A;  3CES A;  5JBQ A;  3OFN A;  2PLF A;  2ZL7 A;  4NBS A;  2FVG A;  3JQP A;  3OKX A;  1TTT A;  5FO1 A;  4XQF A;  3E1Y E;  4XLC A;  2V4D A;  3SJZ A;  3LVB A;  1EP3 B;  3CCU B;  1D8T A;  1KC8 D;  4WZK A;  1VQ7 B;  2XEX A;  4QVA A;  3CPX A;  5E6T A;  4B44 A;  3MMP A;  2ZXI A;  4LBW A;  2GPJ A;  3QFS A;  4MYT A;  2XOK A;  5F4J A;  4G7W A;  3P26 A;  2X6Y A;  2DY1 A;  4Z4U A;  4KKU A;  3G6E B;  2KVO A;  5F4O A;  3T56 B;  4M1K A;  5H59 A;  1E63 A;  2GK7 A;  1BPL A;  2VJJ A;  4FWT A;  2QN6 A;  3OEE A;  3R6J A;  4P26 A;  4QHY A;  2ZZE A;  1WP6 A;  5FNZ A;  5BSY A;  3CC4 B;  1N08 A;  4UAJ A;  2BM0 A;  1I18 A;  3ZZU A;  3AGP A;  2XZP A;  3FPP A;  4R71 A;  2EIX A;  4P12 A;  1DDG A;  3ASR A;  2QEX B;  1F60 A;  2ZIT A;  1KQS B;  4ASU A;  2BF4 A;  2B5O A;  2V7T A;  1WSR A;  2R9V A;  4DNT B;  4TMT A;  1A8P A;  3H94 A;  2V7W A;  3FPK A;  2OBT A;  1ZM4 A;  4G7X A;  3BC9 A;  2WJY A;  3R6K A;  3OJX A;  3ASQ A;  3BCD A;  4XLH A;  1GO2 A;  3ISX A;  3LQ6 A;  5F4M A;  3G71 B;  1EFU A;  1XQB A;  4BPR A;  1WOP A;  3W2G A;  3U6B A;  3Q6Q A;  3JQQ A;  3FJO A;  5TR9 A;  1R5N A;  1KMH A;  5J3O A;  2VBV A;  5GV8 A;  5THX A;  1D2E A;  2VZL A;  2QA4 B;  2X0K A;  4G1V A;  1FDR A;  4Y9R A;  3SEJ A;  1VQP B;  1QX4 A;  1UD6 A;  1G7S A;  3G05 A;  4RPD A;  3CTA A;  4WZL A;  3W5U A;  1VQ6 B;  1W0J A;  1VQM B;  1COW A;  4RDK A;  4KKT A;  4YAF A;  4RD6 A;  4AF6 A;  3CCR B;  3MCA A;  1FNB A;  2BV3 A;  3QE2 A;  3CW2 A;  4XL9 A;  3WNC A;  1XFO A;  4H9G A;  5DS0 A;  3OP1 A;  5L46 A;  4M53 A;  4TSF A;  4JMQ A;  1QUE A;  4OOX A;  1W2B B;  4TMZ A;  5IK2 A;  1U2R A;  5J35 A;  1YHQ B;  4B48 A;  1EWY A;  4AVZ A;  1KZL A;  4NNJ A;  3ZPN A;  1B23 P;  1G7C A;  1IHM A;  1NB9 A;  2XZL A;  5KW9 A;  4XMY A;  1K73 D;  4B3F X;  4XD7 A;  5AN9 A;  2ZZF A;  4PC6 A;  4AC9 A;  1FRN A;  2BVN A;  2PE3 A;  4RPB A;  4Z4R A;  2VBS A;  3H9N A;  2BSA A;  4UZE A;  5TY0 A;  1PJ6 A;  4YEJ A;  1IJE A;  4K1X A;  5LMZ A;  3T53 B;  1VHO A;  2HMA A;  4YAU A;  4M4S A;  1V0E A;  4PAA A;  4Z4Z A;  3CCJ B;  1OGI A;  1E79 A;  2WZP P;  5FO0 A;  4B43 A;  4XN3 A;  1ZUN B;  2PIA A;  5DN6 A;  1AIP A;  3QSY A;  1FND A;  4C0S A;  4TMV A;  2BMW A;  1TVC A;  2F1L A;  2Q6K A;  4L8J A;  2Q6L A;  2YWF A;  1OB5 A;  2WSS A;  1WSV A;  2V7V A;  3GVK A;  4DQK A;  3I55 B;  2VJI A;  3VNU A;  1DDI A;  1KK1 A;  1E1R A;  4KKS A;  1PJ5 A;  3LO8 A;  2X8K A;  3ZBU A;  4YAW A;  4ZCI A;  4PC2 A;  2BGJ A;  2W6I A;  2GK6 A;  3WBK A;  4P25 A;  1WOS A;  1ZM3 A;  2JJ2 A;  4RJL A;  2GJR A;  1F20 A;  4XOP A;  2F43 A;  1NBM A;  4P9S A;  4YXW A;  4ACB A;  1DAR A;  2GRE A;  3ZIA A;  1KK3 A;  3CP8 A;  3A3G A;  1H85 A;  4Y7C A;  1EP1 B;  3QFR A;  1BX1 A;  1W34 A;  1UMK A;  1VLY A;  1R5O A;  4M2L A;  3KL9 A;  4WQM A;  1H8H A;  1QUF A;  1EFR A;  1Y0R A;  1UD8 A;  2NPF A;  4RCY A;  2OTL B;  2ZBU A;  3PA1 A;  2EFG A;  1B2R A;  4OPO A;  3OAA A;  4ZGN B;  3I56 B;  4G5G A;  2OK8 A;  2DER A;  1KRH A;  1T6Y A;  3FKS A;  4Z4S A;  1KJZ A;  1QGY A;  2AHO A;  3V7A A;  2Z6B D;  4X7E A;  1W0K A;  5B6I A;  2BM1 A;  2CF4 A;  4RD3 A;  1ZM9 A;  1NJI D;  3DDY A;  4RDJ A;  4DK1 A;  2HDN B;  3VR6 A;  1S0U A;  2CBX A;  1MRZ A;  1TLL A;  3PUN A;  4P22 A;  1JJ2 B;  3BNW A;  4ACA A;  2C2W A;  1D1N A;  3CCS B;  3OW2 B;  3JQR A;  1QVF B;  2DCU A;  2VYQ A;  4QFM A;  4OPV A;  2LZJ A;  1KK0 A;  2R6H A;  3KEW A;  5DSZ A;  3WND A;  4XKV A;  3VO2 A;  1HZE A;  2ZL6 A;  1NB0 A;  4X06 A;  5KSW B;  4OPS A;  1AMO A;  4P1V A;  2QTL A;  3T51 B;  1QFY A;  1EFT A;  4RD4 A;  4E0F A;  2DEU A;  4TN1 A;  1G7R A;  2E1B A;  5IYN A;  3W2F A;  1VQN B;  3PVD A;  4B3X A;  1QGA A;  1I8D A;  4ZCL A;  2DYI A;  4P6V F;  4RDL A;  1EXM A;  3A35 A;  1BX0 A;  4WZT A;  5A88 A;  4PAB A;  1WDT A;  3CCE B;  3OPO A;  1IB0 A;  1WOO A;  1R5B A;  2WJV A;  5HKK A;  2YWE A;  5FA6 A;  4EH1 A;  3W2I A;  1E64 A;  1I7P A;  4QVJ A;  4FXU A;  5FL7 A;  4XLE A;  3W2H A;  3AVW A;  2I1L A;  3QFC A;  2X3U A;  4ROX A;  4OOS A;  4TKO B;  2X6W A;  2B7C A;  5HZB A;  3CMM A;  2OBS A;  2QMU A;  4ZV4 A;  1V5V A;  4YHB A;  2ZTG A;  3CB4 A;  1T6Z A;  3AGQ A;  1OB2 A;  2V31 A;  5IYP A;  3CXC B;  1K8A D;  3CRZ A;  4P3I A;  2CRV A;  3D26 A;  4RCZ A;  2F4N A;  1CNF A;  2ZZQ A;  1PJ7 A;  4WZE A;  3Q38 A;  3GVJ A;  1CQX A;  2BN4 A;  3LQE A;  4XNF A;  2VNJ A;  1SKY B;  4G1B A;  4U9U A;  4X7C A;  4XR6 A;  4XM3 A;  3CCQ B;  2XGJ A;  4DNR B;  3CME B;  2OBR A;  2YWG A;  3AVU A;  2JIZ A;  3SLN A;  1FNM A;  2C78 A;  1W35 A;  3WXM A;  4LBY A;  4Y9U A;  1VJS A;  2C4U A;  4PC3 A;  4HE6 A;  1BMF A;  4UZU A;  4UZF A;  4X7F A;  1HA3 A;  1E43 A;  2DET A;  1OGJ A;  3BQJ A;  3J81 k;  1YJN B;  1SKQ A;  2F1M A;  2BPO A;  2DIE A;  3B78 A;  1PKV A;  2ZL5 A;  5FIU A;  1YIJ B;  4AF7 A;  1E3X A;  4TMW A;  1YJW B;  2C5H A;  4RD0 A;  2FX3 A;  4RD2 A;  4PGO A;  3OZW A;  1EFC A;  5H5J A;  3PUM A;  2OK7 A;  1BJK A;  3WYA A;  2ZXH A;  4WWV A;  3GSI A;  4P6Y A;  4QV2 A;  1UD4 A;  3BY2 A;  4X8I A;  5IYW A;  4II3 A;  1Q82 D;  3SLD A;  5TRD A;  3B82 A;  5TV2 A;  1YJ9 B;  2XZO A;  2C5B A;  3OE7 A;  3NE5 B;  1GVH A;  1JA1 A;  4DK0 A;  1FNC A;  1BQE A;  4FK8 A;  3CC7 B;  1QG0 A;  2RC6 A;  3Q3A A;  3SKB A;  4P3Y A;  2XND A;  4N3N A;  4TT3 A;  3ZBT A;  3U6K A;  3G4S B;  4QUZ A;  1N8R D;  1T5E A;  3HAG A;  3B8H A;  2B7B A;  4TMX A;  3ASS A;  2D74 A;  4NCN A;  3CC2 B;  3A1P A;  2VBU A;  3ZZT A;  4RLZ A;  3CPW B;  1VQK B;  1WU8 A;  3BCF A;  2W6J A;  2X53 S;  5HXB A;  2ZTN A;  2WPD A;  1QH0 A;  3AST A;  1M90 D;  4YEL A;  3QFT A;  5GV7 A;  4OP7 A;  1H8E A;  3OJW A;  2GQF A;  2V7X A;  2DOG A;  4M0L A;  2VNI A;  1K28 D;  2CND A;  2CW5 A;  2QGG A;  4HE5 A;  1YIT B;  2Q6I A;  2WZN A;  3BH4 A;  3VNV A;  4Z4T A;  2XNC A;  2YWH A;  4Q7J B;  3AVT A;  1SM4 A;  2VBT A;  1VQO B;  1UD3 A;  3ZZ0 A;  3ONY A;  4RM0 A;  4P2N A;  3WY9 A;  1CNE A;  4Z1M A;  2QE7 A;  2M5S A;  1JB9 A;  3Q6R A;  5CDF A;  2XNJ A;  3PA2 A;  4HIZ A;  4Z4Y A;  1VQ8 B;  1JA0 A;  2X85 A;  1E3Z A;  2C4T A;  4Z4W A;  1N0V C;  2WR8 A;  3AVV A;  4II2 A;  2D3N A;  1H42 A;  1GJR A;  1MAB A;  3A8J A;  4LBV A;  3CCV B;  1KD1 D;  2GJK A;  1P4M A;  3WQZ A;  3CCM B;  1VHE A;  2VNH A;  1G7T A;  2ZZG A;  4ZCM A;  1Y0Y A;  1WPC A;  3LNN A;  1GAQ A;  2WYR A;  3E20 A;  4FN5 A;  1M1K D;  1S4M A;  1N07 A;  1YLO A;  2OYN A;  5HZA A;  1QGZ A;  2QDX A;  2GJP A;  1N05 A;  4ZGQ B;  1Q86 D;  3CD6 B;  3ASP A;  2JDI A;  1XE1 A;  4X07 A;  4XLF A;  3OEH A;  1Q9S A;  2V7Q A;  3W5H A;  4X0C A;  1J9Z A;  1VQ9 B;  1K9M D;  1TUI A;  1S72 B;  3BY1 A;  3VMF A;  3ZC3 A;  1N0U A;  1YX2 A;  4J0Q A;  2CC2 A;  2BGI A;  1VQL B;  2X6X A;  3A8K A;  3CP2 A;  4XLA A;  4N3G A;  3I1F A;  3WBJ A;  1V0F A;  1ELO A;  1YI2 B;  3V76 A;  4G6I A;  1QFJ A;  4X7D A;  2ZBV A;  4B47 A;  2RC5 A;  2V7U A;  4PC1 A;  3GIR A;  1GR1 A;  1W87 A;  3GQB A;  1DG1 G;  2C77 A;  2Q6O A;  3ZUG A;  4XOR A;  1BLI A;  1N06 A;  5IYQ A;  4XOT A;  1E1Q A;  5IYR A;  1WTH D;  2JN9 A;  1RQP A;  1VF7 A;  3CCL B;  3JU4 A;  4X05 A;  4XON A;  1QVG B;  4F7D A;  1OB0 A;  3PEN A;  3Q39 A;  4YAL A;  1W9X A;  1HVX A;  3AVX A;  3RY8 A;  1VQ4 B;  4IW3 B;  1Q81 D;  1GAW A;  1ZM2 A;  3AVY A;  1NDH A;  3OZU A;  2VNK A;  1E62 A;  3MHP A;  5KNL A;  2PMD A;  4YAO A;  3OZV A;  1VLO A;  3SJP A;  4CQJ A;  1WOR A;  3ONU A;  1UD2 A;  3GVL A;  4GQN A;  2D9R A;  1FRQ A;  4C43 A;  2J7K A;  1T6X A;  1FX0 A;  2D3L A;  3W2E A;  1Q7Y D;  2CK3 A;  5BSX A;  1OHH A;  1QFZ A;  2P3M A;  1EP2 B;  2HLD A;  4PC7 A;  4DQL A;  2E1R A;  4OOV A;  3VO1 A;  3A8I A;  4LBZ A;  2HCJ B;  1RQR A;  3WNB A;  5A8A A;  2QTZ A;  1VQ5 B;  3CMA B;  1JNY A;  3A3B A;  5EMN A;  2NV4 A;  1NRK A;  1KTV A;  4B3G A;  4XKW A;  4MYU A; 
#chains in the Genus database with same CATH homology
 4RM0 A;  4P2N A;  1IHM A;  4Z4V A;  3Q6R A;  5KW9 A;  3PA2 A;  4QVJ A;  4Z4Y A;  2ZL7 A;  4Z4W A;  4RPB A;  4ROX A;  4Z4R A;  4OOS A;  5HZB A;  2OBS A;  4WZK A;  4QVA A;  4Z4Z A;  5IYP A;  5E6T A;  4P3I A;  3D26 A;  5HZA A;  4WZE A;  5F4J A;  3Q38 A;  4Z4U A;  5F4O A;  3ASP A;  4X07 A;  3LQE A;  4X7C A;  3R6J A;  4X0C A;  4P26 A;  2OBR A;  3SLN A;  3BY1 A;  4P25 A;  5BSY A;  4X7F A;  3BQJ A;  2ZL5 A;  4P12 A;  3ASR A;  4X7D A;  3PUM A;  4QV2 A;  3BY2 A;  5IYQ A;  2OBT A;  5IYW A;  5IYR A;  3SLD A;  3PA1 A;  3R6K A;  4OPO A;  3ASQ A;  3LQ6 A;  4X05 A;  5F4M A;  4Z4S A;  3V7A A;  3Q39 A;  4X7E A;  3Q6Q A;  3RY8 A;  3Q3A A;  3SKB A;  4RDJ A;  5J3O A;  4QUZ A;  3PUN A;  3ASS A;  3SEJ A;  3SJP A;  3ONU A;  4RLZ A;  4RPD A;  4OPV A;  4WZL A;  3AST A;  4OP7 A;  2ZL6 A;  5BSX A;  4RDK A;  4X06 A;  4OPS A;  4P1V A;  4OOV A;  5IYN A;  3PVD A;  4Z4T A;  4OOX A;  4RDL A;  5J35 A;  4WZT A;  3ONY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...