4P2RA

Crystal structure of the 5cc7 tcr in complex with 5c1/i-ek
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
180
structure length
180
Chain Sequence
IKEEHTIIQAEFYLLPDKRGEFMFDFDGDEIFHVDIEKSETIWRLEEFAKFASFEAQGALANIAVDKANLDVMKERSNNTPDANVAPEVTVLSRSPVNLGEPNILICFIDKFSPPVVNVTWLRNGRPVTEGVSETVFLPRDDHLFRKFHYLTFLPSTDDFYDCEVDHWGLEEPLRKHWEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class II histocompatibility antigen, E-K alpha chain
publication title Deconstructing the Peptide-MHC Specificity of T Cell Recognition.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 33
structure length 180
sequence length 180
chains with identical sequence F, K, P
ec nomenclature
pdb deposition date 2014-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00993 MHC_II_alpha Class II histocompatibility antigen, alpha domain
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4p2rA02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 4p2rA01
3FQNB 3LKRB 3KR3H 2QQLL 1XGYL 5CJQH 4WU7A 1G7JB 5CJXC 3OAZH 3BD3A 3U7YL 3NZ8A 1DQLL 4LCCB 5HYEA 3I6KB 2O5XH 2AV7A 4L4JA 2BJMH 5HYSB 3NGBC 1MUJB 5DD6A 3ZL4L 2OK0H 1U8PA 1FL6B 2IADB 5DUBA 4EBQH 1AXTL 1ZWIA 2JLLA 2YD9A 4OLWH 4YHZH 3KLSA 4WRLA 4YH6A 5FYJD 1FGVL 5MEND 2F19H 4NPYA 5GS0D 5FGCB 1C08B 5D8JH 1J0KA 3MBEA 1UKQA 3O2DA 2P8PA 3KS0J 1HQ4A 1KBGH 4NO0D 4C58B 1F13A 2EDOA 4BFIB 1X5XA 2MHAA 3MLTB 4R3SA 3U4BL 4MMXC 4MQXC 3U7AA 1OHQA 1SBSL 4AIOA 3UTZA 4CVUA 3FTGB 5CUSL 5EPMA 4F9PC 1F2XK 4HKBB 4ZAKD 3MV7E 4HS8H 4Y8AA 3CLFL 4HFWB 3NCFB 5DD5L 1A6ZA 2VLMD 5ITFA 2EEAA 5LQBH 1KIQB 3T0DA 1U8IB 1CFVL 3CFCL 3EYSL 1PZ5A 1QFWI 2P43B 4FABL 3BP5B 3TIDB 4JRXD 4HJJL 1N6VA 1QFUH 1TTGA 1F4XL 4MDJB 5EWIH 1CBVH 4IRJD 3MNZA 4JAMB 2F53E 2BHZA 1OP5K 5HHXH 1AY1L 1AD9A 5K93A 3ARFA 3LV3A 3HZKB 1GIGL 3QDHA 3SDAC 4W6YB 5C0AD 4KWUA 4DCQA 1Q9KB 3IETB 5C2BH 4Q6IB 2HFTA 3SDCA 4I0PD 4GG8B 4NWUH 3OJDB 3VDCA 1CGTA 2FNBA 4DEPB 3G5ZB 5C0RL 3KPTA 2F5BL 1T21A 2XG4A 1I8IA 3RVUD 4E41D 3RWDA 2IPUK 4P4KD 3BZEB 1IL1B 4BZ2H 1OSZA 3EYOA 4IMLB 4O5LH 1ZANL 2MQCA 4KQ4L 4M6AA 4PRIE 4ZXBC 3CH1B 4PY8J 5D1XD 3NCMA 1ZT7A 5F3BA 3LKRA 2FH6A 3STZB 4ZTOH 3PDOB 3AB0C 3RUGB 5HSFA 3B43A 1JWMA 5AD0A 3I6KA 2FX8H 1FL6A 2IADA 5EIIA 1IAIH 1R5VB 5IT2H 4HGKC 1QBBA 3BAEH 5CAYB 2BOCA 1ZVHA 1URLA 4GW4A 1IGFL 1I7UA 1A1NA 1X6NA 2BSED 4BFEA 4IHOB 2FH8A 1OVZA 4IOIB 3UTPD 4C83B 3S3SA 4BFIA 3MLTA 1J18A 3QPXH 3DXAA 4XP6L 1MJUL 2BXYA 3MLSL 4HIXL 5DHYB 3NOIA 5FKPB 2ZJSH 4HKBA 2CDFA 2XKSA 3NFPB 1B3JA 2VSCA 1KIQA 3AGVA 5ADPH 5IB3B 3F6IA 4I2XA 5B21A 4JFHD 4YJZL 3TIDA 3KPSD 4X0KB 5LWYH 1KFAH 3P9LB 4N5ED 1IE5A 4YXLH 1MSPA 2VIRA 1MFCL 5T1MA 1DQQB 1WFOA 2YSSB 3B9KD 4P2RB 4S0TD 2ZUWA 2VZ3A 3QUKB 4PP2B 1I3UA 3HRZB 5IQ9B 3IETA 3FQWB 1XGQB 1DBJH 3DO7B 1QLFB 5E0QA 4Q6IA 3PQYD 4GG8A 5JLZA 1FLRL 1FAKT 3RDTC 4GSDH 3ETBF 1BQHG 3OJDA 4RNRA 4OFYD 5JXED 5TQ0H 1YPZB 1FE8L 3G5ZA 3K81A 5EBWB 3FT2B 2AJ3B 2XICA 3TM6A 3BPOC 3G9VA 3HMXH 2J8OA 1MF2H 3BZEA 4PJAE 4FQQA 4NO2A 4XT1C 4M1GH 5MEQB 3QIWB 4IMLA 4ZPVA 3QFJD 4PJCA 4W70A 4NQDB 1F4HA 5F7LB 1GGYA 3CH1A 1LQSR 1JZ2A 5AZEH 1QHOA 4P23D 1FFRA 1AP2A 5K33A 4I3SL 4XP9H 3S5LG 2DLFL 2UZIL 4MZ2A 5AZ2H 3LS5L 4H8WH 3RUGA 5BS0B 3WFHB 3GBML 4DVBA 3K46A 5A40E 2DS4A 1HHHA 5F1NB 4OZIE 4CU8A 1Y18A 2MPAL 1BJ1H 4OGYL 1MNUH 1WIPA 5DEGB 5E8NB 2P4AB 4NKIL 3BRFA 3QNYA 2VXVL 4Y16C 1JNHB 2Q8BH 1JYNA 1HYRC 4EN3C 5IBTH 2D4FA 1Q9OA 4IHOA 2OCFD 4KKCD 3HE7C 1ZLVK 4IOIA 4OZFH 3O3BB 3RQ3A 4ZO9A 1RSFA 4GXUN 4XCEA 1JNNL 2K9UA 2IJ0C 4OIIH 5C6TH 4PJDF 1PSKH 2HKFL 3KPNB 5DVKA 1E4WL 5JQHC 3LEVH 1EX0A 2OZ4L 3GMRA 2IFGA 1C1EL 2DIBA 2ZNXA 5BO1L 1U3HB 4IEFB 3VFMB 2J4WH 1RK0B 4ODHH 4HPYH 1KN2L 4HBCH 3BJ91 3F7RA 5C09B 1H9VA 3EJYD 4QXTB 4UINL 5IROC 4KC3B 4JN1H 2E9JA 4YGVB 5D72L 2UY6A 3KHQA 2FD6L 5IWLA 3QUZB 4GRWH 4ZOEA 1LO2L 2QR0B 3WFBL 3G6JE 4P2RA 2IAMA 2GJ6B 4GBXB 1RK1B 4PP2A 3DNKA 1TJIH 4YHNA 5IQ9A 3GGWB 1XGQA 1I85C 3V5DB 3DO7A 3GSWA 1T1XA 2X9WA 3E6HA 4QYOB 1NSNH 5GZOC 5GGRY 3VXUB 3HPJB 2FJFB 2HKHH 2AK4E 5CD5D 5J06A 1ES0B 4FQLL 2AJ3A 3VJ6A 4CRPA 3B8SA 3MRMA 4PJ9B 2YWYA 4OFKA 4NNYB 3IU3B 3T77B 2XXMB 5MEQA 2W0FA 1J5OH 3VW3L 1B0GB 1U9KA 4AYFA 4Q9CA 1T04B 3C60D 4NHCH 1DP0A 1PG7L 4WVRA 35C8L 4TNWF 1KENL 3B9EA 4BKLB 5DYOB 2YOCA 3M1BB 3MRHB 1F4AA 2R0ZL 5F1NA 1NGPL 3ULVD 3QZWG 1B4JL 2EEBA 4WHDA 2ICES 3MV9B 4XWOC 2LU3A 2Z31D 5F7YC 2CK0L 1EXUA 2XNAB 5DEGA 5JQ6H 1F4WH 4JHWH 3E3QE 1JNHA 2VDKH 4XVTH 4Y1AD 3SE3A 5DQJA 1NLBH 5IG7B 1T7YA 4M5YH 1GZQB 5IHZB 3BISA 4WENB 3O3BA 4K71B 3MGTB 4RCAA 4M6OL 3MA9L 1DLHB 4QRQB 1CZ8H 3FRUB 4LCYB 1UCTA 2H1PL 4U1MB 1WZKA 5JIKA 2WIIB 4HAFA 1OM3H 4ISVB 2MCG1 4MCYA 4NZTL 3LDBC 3FQRB 1U3HA 3VFMA 4HG4K 4FQXC 2V2XB 4UOW0 1RULH 4KVCL 4ZOCA 5C09A 2Q76B 4G8GA 4Z7VE 1BIHA 4QXTA 4KHXH 2CPCA 4YGVA 4MZ3A 4KY1H 5ENWB 1D5IH 1ZVSA 4M9PA 1DVFA 4CN6A 4J3UA 5B38G 2Q6WB 1NFDF 4JB9H 2EXYD 3X17A 5E4EC 5IIEB 4GBXA 1E4KC 2GJ6A 1RK1A 3ULUE 5I75B 1V5JA 4Z5RA 5ID0B 5KSUB 3N1QC 4XMPL 3VXUA 2FGZA 3HPJA 4WCYL 5GGVL 5IB4B 2FJFA 2A74B 4HWBA 1ZLSL 3RZCC 4M4PA 1MCHA 2OLDA 1D5ZB 4CNIB 2EH8L 3IU3A 4L4TE 3T77A 1CLYL 1MAJA 2H2PC 5CWSA 1B0GA 1BFVH 3M8OH 1LD9B 1T04A 3SGEI 1ONQB 4G9FD 4XVUC 3GNMH 4O9HH 1X5LA 4O4YH 4FZEL 5DYOA 3DVIA 4HQQL 1HWHB 4GLRH 3EW3B 2ZCLL 1OGAB 3H7LA 3MRHA 3S4SA 1YMME 1MHEA 2PKDA 1AGCB 3HMWL 4D9QD 2DLGA 2WNGA 1KLUA 1PD6A 1NKRA 3B4NA 3ARGA 1NCBH 3MV9A 3CDYA 5FF6B 1I1AB 4POUB 2XNAA 3S98A 1LNUA 7FABL 3FFCE 1CLZH 1B6UA 1J0JA 4ETYA 3DV4B 1IAIM 3H42H 5IHZA 4E9LA 4JY4B 2YN5A 2OTUA 2CDEA 5HYJD 1DLHA 4QRQA 4LCYA 1P9MA 1J8HD 1PW3A 2R0KL 2R1YB 4B0MM 3WSQH 5ESVA 3VG0H 2WIIA 4NBXB 2QL1A 3BDYL 2CUHA 1D5BB 4JFFD 4P3WA 2DWEB 3VXRD 1N8ZB 1A9EB 2VLRD 4U1GC 3ARDB 3FQRA 3QAZB 3DETC 5GGRA 2P44B 4IRSD 1AC6A 3LKPB 1NEZB 2Q76A 2V17L 1BZ9B 1G7PB 3L3KA 1GGBL 4U3XA 3KPRD 2VLJB 1RUML 4MA8H 2QADC 5ENWA 3MV7A 4WUKH 4G80B 2Q6WA 4YDJA 1U93B 2K7PA 3G6AA 5I74C 1PY4A 1ZT4A 3HE6D 5J6HB 2NY4D 4V1DE 4LSQL 4ODSH 2P24B 5KSUA 5ID0A 3SDDC 3JWDH 3GSXA 3V52H 4R90L 3QUXC 3K4DA 3SCMC 5IB4A 2A74A 2F53A 4Z18A 5FM4A 3VD3A 4JKPH 5FV1L 5CEZD 3RWCA 1DANU 5CGTA 2X70B 3CFEA 3U36B 5GZND 3GMNA 1U8LB 4N0FB 4WV1B 5I15L 4TUJB 1LD9A 2IH3B 5GQBA 3QNXB 5TE4L 1PEZA 1DQDH 1XT5A 1WITA 3VFUA 3DBXB 3RWGB 1YJDH 1U36A 3MBED 1WEJH 1OGAA 4ODWB 1AGCA 2V5YA 3CFBA 1L0QA 4PRIA 1IQDA 4M1CC 2RJMA 1ZLVH 1I1AA 2ZSVA 5B4MD 3O0RL 4TULH 3VGAC 3S7GA 4YHKH 1KXTB 5DJ6B 7CGTA 1TQCC 2YD6A 3DV4A 3NACH 4DGYH 1J87A 4JY4A 3ABZA 1G7LB 5JMOC 2OR7A 2R1YA 1N0XH 2FATH 3MRIA 3PHSA 1D5BA 4ODXB 3BKML 1N8ZA 3ARDA 2GK0A 3VDAA 4LPWA 3V7AG 4DKEH 1NEZA 3GSOA 1HEZA 4TUOA 4OF0A 1BZ9A 1FCCA 2DKSA 4HZAA 3SDCD 2EDNA 4K3GA 4QOKB 3QA3A 2UWEF 1A3LL 1UJTA 4NZRH 3RWFB 1TZIB 1N5YL 3BVNB 3V9FA 4AH2B 5BMFL 1U93A 2F8OA 5DK2A 4MS8D 4LQFH 2ZWLT 4X8XA 3BEVB 4NGHH 3ZDYF 5J6HA 1MEXL 2P24A 3VI3F 3RTQB 3U4EB 3C8HA 5DJYA 1I4FB 1IGIL 4WHYG 3STLA 5FV2A 5LGHH 3JUYA 3SGDI 1T22A 2CR3A 2E27L 1EEYA 4KI1A 2X4NB 2DQCL 5T5NG 5DURD 3U9PL 1T4KA 1I8LA 1FFPB 1UA6H 2O26U 1QQDB 3OHXB 2X70A 4HJGA 2WLZA 4Q7DA 3U36A 4WV1A 5C0BB 4NT6A 2NY0B 4I5BB 2IH3A 4AL8H 3QNXA 1MQ8A 2Y7QB 1NCNA 3GO1L 1HZHL 3KPLA 2AK4B 4WIQA 5DD1L 1JMZA 1FAIL 3MLPA 3Q6GL 4ODWA 4UBDD 1ZTXL 4JY5L 1DUZA 3U7WL 1RY7B 2OP4H 4N8CL 3QO1A 4K55A 1NDGB 2F54E 4WI9A 3DXAD 1MCWW 5ABDE 2CRZA 5EFIA 5JXAL 2Q1EA 4PJBE 2X4UA 1YA5A 5L0QB 3SOBH 3GSVB 1C8PA 4YGAB 1B4RA 2BRQA 2XTJE 1JHLL 4UNVA 1G7LA 1ZGLM 5BOZG 1VGEL 2E6PA 3KWWB 3LZFL 1KNOA 1X4XA 3VXTA 2BDNH 1X5YA 2BXZA 3IYLW 4GAFB 2VLLA 5JW3L 3SJVB 5EN2A 1CWVA 3TNMA 1RJCA 1WC7B 2IBBA 3OKDB 1QSVA 1NLDL 3C87A 3GMPB 2D31A 4JCLA 5T3ZE 3OAUH 1RZFH 2BNUB 2ZOLB 2VH5L 3SBWA 2FR4B 4JZOB 4PJEF 5BVJA 1NCWL 1LK2A 2R2EA 1IKFH 4IRZL 2HT3C 1LEKB 3TZVB 4F8QA 2NY7H 5EUKA 5D7LE 5KSBF 3T8XB 5CMAA 4PD4J 3F5WB 4OUUB 4LIQH 3BGFC 5DA4A 2CIKA 1UCBH 3QDME 1OAQH 4X80H 3RTQA 1OWWA 4J3XA 1EERB 1I4FA 3WNLA 1A2YB 3RVWD 2NQCA 2CRMA 3LIZL 2G5RA 2X09A 1F3JB 1CDIA 1XF5A 2K1MA 2OJZL 3RP1A 4J4PA 2VN7A 3QDJE 1KTDB 1FFPA 3K3QA 4NN5C 4UDTA 4UUJB 3VXNA 3OV6A 3L1OH 3K8MA 4Y4HB 4I5BA 3B9DA 2OJEB 2Y7QA 3RVTC 5DUMH 2AK4A 4EIZC 2BVTA 4LKXA 2X1PA 3GSNL 4NN6B 4KJPC 2HN7A 1EVTC 2EDJA 3NCEB 2B4CH 2MFNA 1VB9A 2VDRH 1CDCA 5EUOF 4YFLI 3PP3K 5CBAB 3VH8B 3CSGA 4IBLT 3WFEH 3MR9A 3GI8H 3LKQB 2KPNA 4NQVB 1Y6KR 4RAHA 1RAMA 3AS3A 4JVPA 3HAEB 4YUEH 2AJSH 2CR6A 1YN6B 2HLFC 3T0EB 3QXDA 4WTZG 3U9UB 2PUQT 3ZKNC 3E8UL 5J3HC 3OQ3B 1ZLUK 3MRLB 1CFSB 3MYJB 2HT2D 2WM0A 3IDGB 1N6QL 2WQ8A 1RZ8B 1CXHA 2OMNA 5IVXE 3S36L 4EKXA 3OKDA 3D39D 1FL3B 4XH2B 2IAMD 3SKMB 1B6DA 2IQAA 4RGOL 1FDLL 1NDMB 2NX5E 4QRTB 5FYJH 5FHAL 2FR4A 2B1AH 4R4FL 4APQA 4YC2B 3MLXH 3VXOB 4QHLB 3TLRA 3ULSB 1S7UA 2VLKB 1P2CA 4WFGD 3H0TB 2CDGA 1OPGL 4OCXH 4LRNH 3WIHL 5KS9E 5KW9H 4Z7VA 1KEML 5DR5H 2J8UB 2BNQB 4OUUA 5DEFB 4P2QE 3WL9A 4HMCA 5C70A 5KZCB 2B5IC 2L0DA 1DDHB 4AEFA 1OD7A 5IEKB 4LSDA 4XAWH 4Z7UB 3NIDF 4PJIE 2OSLB 4D9RD 3V0VA 4N0CD 1QO3A 4O00A 2JB5L 4DN4H 1MRFL 4HDIB 5DRZB 1KTDA 1L7IL 4JQXC 4UUJA 2BFVH 4V1DB 5K9KA 2P47B 3QSKB 2AEPH 4X8JB 2A1WL 3CDFA 5EU6D 3UO1L 5GS0C 4G6MH 4TSAL 3I3DA 3W11D 4D2NA 4RAVB 1L9NA 4K7PL 4L4TA 1S7QA 4HMDA 3HA0A 2IPTH 3DMMB 5D5MB 2CMRH 1T83A 3JTTA 5L8LB 3O11A 3KJ4B 4PJFF 5CBAA 3VH8A 1B0RB 1ACYL 2H2SD 2E7LC 2J88H 1UG9A 2EECA 2CXKA 4MDIA 3LKQA 1SY6A 4NQVA 2E7BA 4PRDB 2DM2A 1YMMA 2HP4A 3DURA 3DYOA 3HAEA 4J12A 1F2QA 5E5UB 5E99H 3SY0B 3BKYH 4N0RA 3U9UA 3FHAA 3VD5A 5SWSE 1JPTL 3KLAB 3CLEH 1YEHH 2AQ3A 1NBVL 4O58L 3AC0A 4G8GD 2LU4A 3MYJA 4ONGH 3TBVB 2OM5A 4FQ1H 1JPGB 4QXWA 5LGKA 4PFEA 4IRJC 1I8KB 3FFCA 5I1KL 4BM7A 3NH7L 3WCYA 3RX5A 4H0GA 1DVFD 5GGTA 4OAWB 1UB6A 1FL3A 4RBPK 1XCQB 3KPMA 3IDIB 1NDMA 1ZHLB 4MYWB 5INDA 2HJKB 4Z0XB 4QRTA 4QRPE 1B2WL 1P6FA 4M7KL 4KVNL 1IGCL 2LAAA 3RVUC 3VXOA 2EC9U 3ZTNH 5D7JD 5C0EB 4QHLA 5I1JH 2YD2A 2ICWJ 3ULSA 5J13B 4HPOL 1JHTB 1FO0B 4FHBD 4KTEL 2WUBH 5C07E 1XH3B 4GXVH 3JWOC 5CJ8A 2NZ9C 1TVHA 4Y5VC 2CJUL 5DGQA 5KSAB 4Q9RH 3NCBB 5D1XC 3UZQA 3QT2A 1NMBH 2W0LA 4G9DB 3QBTB 3PDDA 1DDHA 2EICA 5IEKA 4LFHG 3VXSE 4WW2F 4Z7UA 2OSLA 3FCTB 1WTLA 4KAQL 4HDIA 4K9EH 5DRZA 3EO9L 5JZ7C 4JO3L 4V1DA 1QFPA 4X7SL 3A6BL 5F9WB 3ALPA 3ARGD 5MHSE 3UJTL 4X8JA 1EO5A 1A6WL 3EYVB 2R2HA 4RAVA 3U46A 1WLHA 2XZCL 5F7EL 4M61B 4RGMB 1YEIH 1ZS8A 1EFQA 2DBJA 5LXGL 1K85A 3HR6A 3HRPA 1KIUA 4MVBD 5D2LF 3ZTJG 1NCTA 2DI9A 3O2WH 3JWOL 2B39A 3WIIL 4A6YB 5BXFA 1A1MA 4O51B 3NTCL 3L5WB 3EYQC 2WBJA 4WW2C 3G9AB 4HXBL 4ZG1A 2P5EE 1MH5A 2I5YL 4PRDA 2VUOA 2WP3T 4NWTL 5IV2A 1DBAL 4X7TA 4RQQB 1UWEH 2ICEA 4LLUB 5DK3A 1VDGA 2AJUL 4AQ1B 4JGUA 3TBVA 4X83A 4S1RH 4WO4D 3I3EA 5JIPA 1FV1B 5T1KB 3W0WB 3MV7D 3FMGH 5K9OB 2BSRA 2CKBL 4GT7A 2PXYB 4XBPB 1UADC 4HUVB 2QSCH 3RGHA 1U2HA 1XCQA 4OGXH 4GG6B 4UTBH 1GSMA 4Y5YA 2HJKA 2FO4B 4Z0XA 5BJTB 5T5NF 5JXEC 1CLOL 3U30C 5GS1C 1O0VA 2F53D 5HYSG 5IQ7L 3BSZH 2BRRH 1U92B 1XH3A 3RNKB 4Y19E 5C9KA 1P4BL 3EOTL 2GSGB 4ZDHB 1S7TA 1JPSH 2VKXA 3X11B 4Z8FH 2ZKHH 4M62L 5KSAA 1GGIH 1IM9B 1QSFB 1WT5C 3TWCH 2OL3B 1MELA 4G9DA 4WJ5B 5L2KB 1FVEB 3VXPB 4AEIL 4LU5H 5FUCC 4KZDH 4PJHF 5JW4N 2QHLA 3WLBA 3FCTA 4R2GC 5D7LB 4UDUB 4P3CH 1Q0YH 4YBLC 4OV5A 5GJTL 4G6AD 1AJ7H 4KZEL 1OP3K 2EDRA 4PRID 2FWOB 4UMGA 1BBDL 1EGJL 4PGDB 1ROWA 4G7VH 5E70A 5ICYB 5ACLA 3EYVA 3PP3H 4KU1A 5JORB 3K1DA 1CDYA 1F42A 1W8NA 4LAQH 1M71A 4M61A 1D6VH 4FG6D 3QDJB 4C56B 5HVGB 1QACA 5E8DH 1KJVA 1L0XA 1MFBL 2IPUG 1NUDA 4P46A 1A7PL 3TT3H 3IFNL 3OF6D 2PR4L 3L5WA 1T2JA 3MRKB 4WUUB 1ZVYA 1VA9A 2VR4A 3VXQA 5DQDL 3AS2A 2C7UB 1G9EA 4P2OB 2F74B 3BMVA 4R9HA 3TIEA 4HHAB 4KJWD 4RQQA 5A3IC 4LLUA 1A47A 3EJYC 4JO2L 2F54A 1B0WA 5J11C 4U1JB 5C8JA 3UROR 3HNVH 2VXUH 5A2LH 1W72H 4PJBA 5T1KA 2F9BT 1WAAF 2VZOA 3W0WA 5K9OA 1RZ7H 3R1GL 3WFCH 2EXWC 3O9WB 1P6AB 4RWYL 1X44A 4KDWA 3ULVH 1JTOA 2DM4A 4JZJA 1K4CA 1U8OA 5I1CH 1NAMB 1KEGH 5CD5C 4U6XA 4R97C 4M03A 5F7WC 1S7SB 5I73C 2VSDA 5TH2B 1ZE3C 4G5ZL 2XRAH 2GSGA 2DYPA 3C60C 1HHKB 2NX5B 4I77L 3FKUS 1DUYB 3TO4D 1IM9A 3SEPA 1N0LA 2AI0L 1YEJH 5IFAL 3FAWA 3CSBA 2NXYD 4P9HC 1MCSA 3BI9X 5D70H 5D7LA 4UDUA 5EZJB 2VOTA 1JZ6A 1R5IA 5CJQL 1IEBA 1QSEB 4QF1B 2JJWA 1Z3GL 4G8IB 3N0PB 3QDMA 4G3YH 2BJML 3TC9A 5TQ2L 2W9EL 1ORQB 4PGDA 5FEBA 5I1AB 3K8KA 1BBJB 4YHZL 1E6JH 3SKJH 1PAMA 5CBEB 1V3KA 2F19L 3WO4B 4NC1E 5H35B 2AXHA 3QDJA 5DD0H 2QTEA 1CE1H 4HCRA 1KPRB 3VD4A 4NZUH 1QR1B 3CSPA 5I9QB 5FB8B 1JNLL 1AQDB 5HHPB 5I8KL 1G9MC 3NAAH 5ACZA 4FQPA 2WW8A 3M07A 3EYFB 4LHUA 3S6CA 3TV3L 3FB8A 3N9GH 2F74A 2NXZC 3ARSA 4HHAA 5JOPE 1CFTB 3LVEA 1Q9WA 3VFWA 4F3FA 2QJDA 4X4YB 3P0VL 1LWRA 4LP4A 4DQOH 2QV2A 1QFUL 2YZ8A 1JGUH 2J5LB 2EXYC 5I30H 4WGWB 2R56H 4JFYA 2H3NB 4MA1C 2R1WB 3AY4C 3BUTA 1LE5B 2DM3A 1YECH 4O02H 1R0AH 5AEAA 3OJMB 4Z7OE 1RZIA 1NAMA 1RIUL 5C2BL 4LLVB 2PO6B 3VE0B 4WI2A 2Q8AL 4DAGH 1IC7H 1S7XA 4F7CB 1G9ML 3QEHB 4OM0H 1QYGH 1T03H 4J4PD 1BD2E 1E27A 5F9JB 2NX5A 3MPCA 3EJJX 1DUYA 4BZ2L 5I71C 2ADIA 3MCKB 4O5LL 3KHOA 4MB4A 4Z76B 1D9KB 4UOJA 5DRXA 1C5BL 2V7NB 3QIBB 4KXZH 1UWXK 3CH8A 5GSRB 2GJZB 3O6FD 3KYAA 3QFDB 5KSVB 1BM3L 1FO0H 2IBZY 4QRSB 4LLDB 4XX1E 3QXVA 3IRPX 5EZJA 1QEWA 5KS9A 5I1EH 1FVCB 1LO3H 2W07A 4G8IA 4P2QA 2FGWL 3C2AH 1V7NH 4XVJL 3HC0B 2X4TB 1ORQA 3FFDA 2EIBA 2GSIB 5I1AA 1QPXA 1YY9D 4HKJB 1BBJA 5EU4B 4NP4H 3RBGA 6FABH 4OI8A 4PJIA 1J1XL 4X6DB 1PQZB 1BX2A 5BRZD 5CCKH 4OKDA 4H25B 1EZVX 1I7TB 5F6HJ 5D2NB 5FGBA 1YYMH 3O2VL 1KPRA 5DFTA 8FABB 1NEUA 2AQ2A 4D8PB 1EUUA 1QR1A 5FB8A 1AQDA 4M5ZH 2NR6C 2AEQH 3HG1E 4IJ3B 5DJ8A 5EULV 1X3DA 3S35H 5JIHA 2ZJSL 1EBPA 2MCPH 3ZO0A 1CFTA 1NPUA 4A6YH 2LAGB 3QCTL 1W8OA 5FO9A 2X41A 1FNSH 3UAJC 1MWAH 4ZO7A 4JGMA 4APQD 5ILTL 1J86A 1KFAL 5FDWB 4LVHC 4RGNB 3HE6C 1RI8A 2NY3D 4P4RA 1LE5A 3RHWF 3I6LE 1W2KT 1MREH 3T0VA 1CK0L 4LSRH 1HIML 4JN2B 3VFTB 2FX9H 3LS4H 1P7QD 2KQMA 4PLJD 4OQTL 1KTRL 1RZKC 5HBBA 1DBJL 3S4SG 2PO6A 5EH1A 3AS1A 1OAYH 4FQHB 3L7EA 5T33H 1MCKA 5DD3H 1FZMA 4F7CA 1TIUA 2DBLL 4JPVL 5TQ0L 3QEHA 4TVPE 4JKLA 1I7RA 3D48R 3ULUD 3BZ4A 5GZNC 4ZYKB 3C8KB 3P0GB 1M7DA 1EPFA 5IOPB 3UTTE 1G7HB 3C9NB 1NBZB 2XQBH 1YEGH 5I19H 4X6FB 5FECB 4QRPA 1VESA 4JG0H 4Z76A 3HC4H 2H32B 1OP3H 5J57B 2NTSP 3NN8B 1HH9B 2YPVH 3MBEC 3MRJA 4FFWC 3PF2A 4U1HA 2VDLH 3B2VH 4QRSA 5C07A 1UACH 4LLDA 4L4TD 4P99A 1IC5L 4GO6B 1FVCA 3ARBA 4UTAH 5TDNA 2OL3H 4Z7QF 5EU3B 2X4TA 4MNGB 1ZHBB 2I60L 3VXSA 4LPYA 15C8L 2YPLB 4X6DA 4HKZB 3MOAL 4ZPTA 1EEZB 3ZMRA 1YMMD 5DWUH 4TUKH 5HGGS 1IGJB 2LFGA 5JDJA 3T3PF 3T2OA 2VL5B 5DMIH 3EDKA 3OPZL 1FNHA 1TVBB 5JIIA 3GRWA 5AUMA 4CL7A 2H6PB 5I76B 1LDPL 4LL9A 1CFQB 3FFCD 5E8EA 1A6AB 1X7QB 2Y36H 3ARFC 3JV4A 4DZBB 1IEHA 1AGEA 3OWEA 1MJ8H 1HQRB 1RHFA 4TTDD 1QP1A 2WINB 3AREB 4FFZH 1BF2A 1F58H 5IF0A 3SDCC 4FQIH 4L9LB 5MP6L 3AU1B 1F8TH 4K23L 1BFOB 3RPIB 1TNNA 1G6RB 3QO0B 4UV4L 3DGGB 3SQOL 5F6IC 3MXWH 4MS8C 3C6SA 1Z9LA 3Q0HA 4RMUA 2E8YA 4KROD 1H3XA 4JN2A 3Q2CA 2DKMA 1NGZA 3VFTA 1XGUB 5KTEH 1UM6H 1E4XH 2XFXB 4FQHA 4UQ3B 3T65A 3D69A 4XPFH 12E8H 2UUDK 4JFED 1NGXA 4CVZB 1INDL 3RWEA 4YQXL 5MEPA 3D3VD 1N59A 1FORL 1MCIA 1PKQB 1Q0XH 2B8OT 4X6FA 5FECA 1X5IA 2H32A 1RVFL 3BP7B 1H3VA 2EYRB 2KL6A 3NN8A 1I7ZA 5IB5B 4F7MA 1A3RL 4G6FB 3IS1X 4YXHH 3RI5K 1X5HA 1U8NB 3IFOB 1TNMA 1RUQL 3RAJH 5F1OB 3BE1L 4MNGA 1GPOH 1ZHBA 2X9XA 1GC1H 3KYKL 1QBML 1TENA 4N1HB 2WBJD 4L8CB 4GKZA 1NEZG 4S1SL 5C0FA 3Q5TA 3AXLB 5DUPL 1YQVL 3G08B 3BN9D 4IDLA 3MZGB 4JHWL 5I6XC 1NMCC 1NLBL 3QI9D 3X3GH 3K2UL 4F7EA 4RDQG 2VL5A 1UWGH 5JNYB 2XKNA 1SVCP 2PN5A 2VDMH 2EO1A 5I76A 1I1YA 1DLFH 1CFQA 1CZ8L 1FZKA 1MY5A 4ACPA 4KUCD 5H2BB 4MA7H 3BIBX 4Q2ZB 4NQEE 4OM1L 5D1QA 1DBBL 4YIQA 2P5WE 1HQRA 3RUGF 3AREA 2Z35B 5DRNB 3BT2L 4Q6IC 1ZT1A 1MFDH 4FFVD 1RU9H 4KPHH 4H88H 4JHAL 3I84A 4GS7C 1BFOA 4POZD 4DEPC 3QO0A 3D0LA 3DGGA 5DJXB 1BZQK 4KY1L 5DK0B 1D5IL 3PP4H 4NQUA 4JB9L 3QUYB 1N64L 4LSVH 2ATKA 4EEEA 5FDYA 1VACB 3L5XH 2FIKB 4K3DL 1A6PA 5D93B 1EVUA 3FT3A 4U1NA 2XFXA 3DX9A 4OF6A 4JG1H 1F45A 4LCIH 1UWXH 4TNVF 5FM8A 2GFBB 4MJIE 3S34L 4OLZH 1KN4L 1HKLH 1SHMA 1MCNA 2BMKB 4UV7H 3VGGA 4NSKB 4RISH 1IBGL 1JPFB 2W1NA 2C3XA 5DFWH 1EIBA 1CGVA 1BD2B 4JVUA 2OZ4A 1U8NA 3IFOA 1P4LA 4OTXH 1KG0A 4P46D 3MODH 5DZNA 2G60H 3P4LA 2HH0H 3DRTB 1WWAX 5TE6L 1S5IH 5LGJB 1BJMA 1AFVL 3CXHJ 3CC5A 5ERWA 5A2JH 1YPZF 3AXLA 3G08A 1NL0L 4F7PA 2P49B 2YK1L 3MUZ1 1CLZL 4U05A 4E5XA 3X12B 5DQ9A 3H42L 4GQ9L 1ZA3A 2F54D 1HN1A 5IWLC 2YPKB 4CMMA 2D9QB 4PUBH 2VDOH 2ZOKB 3RJDA 1IAII 2VWEE 4QTIL 4EDXA 4DK6A 4PRHB 3VG0L 2OMBA 3FO0H 4TOYL 2IAMC 1NGYA 4K3JH 4M6MH 1CXIA 2XTJD 4L3EE 2CGRL 3L3HB 1OF2B 1ZSDA 4P5TB 1CL7L 1HI6B 1MJ7H 5T3XH 5IM7B 2NY5H 3MJ6A 4W4OA 3GJFB 4NC2B 2OBGA 2Z92B 2DWDB 4NKDB 5EA0L 43C9B 4GMSH 4HK3J 5DJXA 4PG9B 4PTUA 5CKGA 4WUKL 4YE4H 4U3HA 4MXVF 3FO2B 3FB5A 5T3ZD 2DYPD 4Y7MA 1NAKL 3G5YB 3BN3B 1FVDB 2FIKA 3DSFH 5E8PB 3B9AA 1TETH 5FA4A 3QIUA 3KJ6L 1NC4B 3LHPH 4PBVC 1A6VH 4HC1H 4DKFL 4HWZB 3GJFK 4PJEE 2GFBA 2VXQL 5C08E 4JKPL 4LCWE 4F8TA 3IRZA 4PV8A 4MHHG 2J7LA 2BNRE 3HR5B 3QDMD 4J6RL 1KB9J 5DVLA 5F7KC 4NSKA 3W11C 2EE3A 4XWGH 5KSBE 4MAYA 4WWKA 4BJLA 1HHJB 4G8FB 3SE3C 2P42B 1IZJA 4OFDA 1KULA 5HDLA 2N4IA 3QDGE 3SQBA 3OX8B 5ID1A 1BD2A 1FG2A 3UTTB 3C09C 3V2AR 2BVPB 3K4ZA 1XIWA 1J1PL 3DRTA 1FPTL 1PKOA 5LGJA 5DC4B 1U3HC 3FAXA 4WI7A 4YHKL 4LHUD 5DXWA 1ADQH 5KVGL 3X12A 5BV7H 2IAND 4PB0L 3QCVH 4N0YH 3IDYB 1MI5B 4WEUD 3OKOA 5KVEL 1TCRA 4AG4H 2YPKA 2ZOKA 4HV8A 3IDMB 4ETQB 1UJ3B 3HB3D 4QLRA 1I8MB 4PRHA 4M7ZC 1VFOA 4KJQD 3VG9B 4EZMA 2G2RA 4GBXC 3NABH 2P1YA 4NNXB 1CD1B 4NUGL 5DMGD 1LEIB 3F58H 3ESUF 3L3HA 3WKMH 1RMFL 2FECI 3GJFA 3HG1A 2Z92A 4NKDA 2DWDA 3CPLB 4GRMB 2VQ1B 4WFHE 1FNEB 4UIMB 1NANH 5CEXB 4XVSL 1CGUA 1UYWH 5FYKE 3HPLA 3FO2A 5E00A 5E5MB 1GGTA 2UUDH 4LQFL 1CF8H 4P59H 1FVDA 4OD1L 1JE6A 1G6RH 4Y4KD 25C8L 5E8PA 4L8DB 3WS6A 1SYSA 2XN9B 3MRQA 4EDWH 4YHOL 4MNQB 1UH3A 3IAGC 2W0KA 4XNZC 3VH8G 3VGEA 5GS3A 4HWZA 5DI8B 1A22B 3X3FH 1MCJA 4WDIA 1YNLH 1SEQH 3ARGC 4JFDD 3FZUD 3T4YA 3DO3A 4M1DL 4Z7WB 3N06B 4P2QD 4U6VL 3RZCA 4LPXA 3PHQB 4OFPA 5BW7A 3HAEG 5FYLE 1TJGH 3T4AB 1QUNA 4Q0XL 4G8FA 4TQEL 3IFPB 4K3EH 4HWBL 3DUSB 2DQIH 3QWOB 3NCCB 3SPVB 4FQCL 4HJ0D 3EO0B 3UTTA 4DTGL 2J6EA 1F6FB 3NIDE 1I3GL 1K5NB 1P9MC 5D7SH 3ARWA 3ROLA 4A2LA 3PABB 5C0CE 4DVRL 3MRFB 3HZMB 1FN4A 4UI2A 4TPRH 1A0QH 1U0QA 1EHLH 1KPUB 2CLVA 1BWMA 1BEYH 5SX5K 4KKBD 4PPTA 4MXWH 1EO7A 2MQ0A 4MD4B 4XAKD 2EH7H 2C3GA 4U1SB 3QUMB 4OBSA 1CIDA 3VGBA 3TT1H 4KKAD 4U1LB 1JGVL 1KJ2B 1SJVA 4ETQA 1I8MA 4D0CA 1MCPH 2NY6D 5SWSD 1G7MA 1CD1A 3NCJL 5L9DH 4CVWA 2V7HB 1N5AB 3MRPB 3PJSB 3UPRB 3DYMA 3CPLA 3P77A 4GRMA 4PRPB 2VQ1A 2E9WA 1AD0B 1WBZB 2B20A 2X4OB 4IOFD 4ODUA 4QHKI 3CAFA 4CDGC 1VGKB 2BC4B 2DJSA 4LEXH 3ZSSA 4XC1L 4ZFFB 2H45A 1G9NH 2R8SH 5CIPA 5F96H 5DHVB 5FUOH 4QRPD 5ETUB 3HNTH 4LIQL 3OKEA 4JREB 3D25B 2BVUA 3AVEA 2IF7A 4MNQA 2PYEE 2APTA 1RUKH 5I8OH 5C07D 5CILL 3GHBH 5DI8A 3IT8D 1QOKA 2FEEL 2P7TB 3W2DL 3L6FA 2HRPH 3ARBD 4Z7WA 5TDOB 1I1AC 2IGFL 1T2QH 2F8VA 2OR8A 4QY8B 3T4AA 4R96B 1G0YR 4EUPB 1WFUA 3VXSD 1A5FL 1QRNE 3DUSA 2PYFA 3THML 4YPJA 1CXEA 4OKVA 3QWOA 2PW2A 3CU7A 3VFVB 3ZZ1A 5T1LA 4YHMH 3RWHA 3MV01 2HAZA 1QFHA 1DZBA 4J3TA 1K5NA 3MJ8A 3O8XA 4ZUWB 5HYQA 3HZMA 5BZWA 4NQXB 4JQVA 1UFUA 4ZTPH 3HZYA 1KPUA 3ARDC 3QAZC 4QEGA 3GI8L 5J1SC 3KXFE 4KJWC 4L8SA 2D4DA 1XF3A 4BUHA 5E6IB 5E56A 1A1OA 4MD4A 4GLRI 1YDPB 4F57H 3LQAH 1CN4A 4U1SA 4U1LA 2P5ED 5FHBH 1KJ2A 4P9ML 3MJ9A 3KS0H 5TE7H 4Z77A 4U1KA 3L95A 2L7JA 3KAAA 2O93L 3P73B 3FO9A 6CGTA 1KCUH 1HE7A 1A7RH 2V7HA 1I9RL 2AV1B 4QT5A 3HUJB 1N5AA 5HGAB 2XZQL 4KRPD 4NKMB 3INUH 3MRPA 1XR9B 4IDJH 4PRPA 4PBWD 5C3LD 5GGUB 4NQEA 3RVVC 3WXVH 2A9ML 1AD0A 3RL1B 5I16B 2X4OA 4EI5B 2P5WA 1NJ9B 2JB6B 1RJZB 3U2SA 1I8LC 5EB9A 1AGDA 4XMLL 1VGKA 2BC4A 2BCKB 4BH7A 4WV1C 4MA3B 1CICB 5GS2D 2L7UA 3QPQC 3FONA 4KQ3L 3NA9H 3H9HB 5DHVA 3GK8L 5ETUA 2VDPH 3EKCA 1R3IL 3D25A 2NXYC 1GXEA 4K2UH 3BUYA 3GMQB 1IKNA 4Y19D 1FJ1A 4ZXBD 3TYFA 1CU4H 4JQIL 1VFAA 5F9OH 2PTVA 1BQHA 1DEEB 4QY8A 2NY2B 4JDVA 1WZLA 3DUHA 1CVRA 4EUPA 4BH8B 5GRUH 1T0MB 4WY7H 4XNMB 4K7PY 3LB6C 4LP5A 1A9BB 5C3TA 3PL6B 4LCUB 4OZHE 1AO7E 4QHMB 2WK2A 2IPTL 3WS3A 4PJ5D 2O5ZL 1I9JH 4ZUWA 1TQBC 9CGTA 4NQXA 2P8LB 5ITBL 3DYPA 3RGVB 2E8ZA 2BVQA 4HLZH 4LVNB 3A6CH 5E9DE 1WCBB 5JDSB 5DJDB 5D1QD 1OAZL 1KLGA 1XR8B 2PETA 2Y06H 2Y6SC 4FTVB 4TN9A 3VRLE 4MQTB 5L6YH 3Q6FA 1BOGB 4J2XA 5FFLA 4YDLC 3SBWC 1C5CL 2UVFA 4UT9H 2VMFA 4DN3H 5K9QG 3VWKB 4OCMC 1K2DB 3TN0B 1I3VA 1R3JA 4FQ1L 1HH6B 1FL5B 3VFNA 3P73A 3TJHC 1QSZA 4ZUUB 3R4DA 4AZ8A 3EUUA 1OAXL 5J6GB 3B6SB 2AV1A 2RBLA 3RTQC 3HUJA 2HJFA 1U3YA 2HFGH 2W9DL 1XR9A 3JXAA 4CDHA 5GGUA 3RL1A 4XPGL 1NJ9A 2JB6A 2J12B 5KVFL 1O7SA 1RHHA 4J4PC 4L3EA 5CGMA 1ZHNB 2QHRH 1N4XL 4L29B 4J8RB 4GFTB 1XCTB 2VE6B 4GRLB 1CICA 5KVDL 1WAAE 2NY0C 5M7QA 1H0DB 2HVJA 3D85B 4LAJH 5J1AB 4YHLL 1H8NA 1FFNA 1NCDL 1OSPH 2UYLB 4X7DC 3VWJA 4J7RA 4M93C 4IIQA 3GMQA 3ARTA 4MWFB 3NBNA 4X4ME 1F3RB 3WXWH 4NQCB 1OY3B 4G7YH 3U82B 4YDVA 3DVGB 5KOMC 3GMMB 4HS6B 2P8MA 2EDQA 4K9EL 3GSUB 2COQA 1YY9C 4XBGB 1CG9B 3F8UB 4OLXH 4LLMA 2DB8A 4JY6B 3OR7A 5DJ0B 4BH8A 4ERSL 3PWUB 1YNKL 3B2UC 4LNVA 4XNMA 4PJEA 3TO2B 1A9BA 1VFBA 3PL6A 5C08A 3L3GB 4FQJH 3H9SD 1YEIL 3CX2A 4Z7VF 3LQMA 5SX5H 3MYZA 2VTFA 4EN3D 2DQEL 3E3QC 2AGJL 2YEZB 3O2WL 2I25N 1LEGB 2BHYA 1IFHH 2P8LA 3TA3B 3QDGA 3QNZA 3QG7L 5JDSA 1WCBA 4RFNB 3MZTA 4BSWB 1RUAH 5DJDA 2M1KA 3F7QA 1Y0LB 3DV6B 3OJ2C 1JF1A 4XXDB 3E6FA 4ODBD 2C4FU 4LPUA 1S9KC 2DQTH 1UWEL 4F2MB 5TF1H 3BQUA 3NPSC 2Z0BA 2PTTA 3MLYH 3QJFB 3L3OB 3TN0A 32C2B 1CGSH 4S1RL 5IHLB 4ZQKA 2Q87A 1HH6A 4QNPF 1LMKA 5IMKB 5DRWB 5JOPD 5I1IL 4ZUTA 2JK5B 5KANG 4QRUB 2QSCL 3B6SA 3TBWB 4ZD3H 4PLJC 3KPPA 3OKLA 3QUMH 4OGXL 3JZ7A 4CW1B 3QIUD 2YN3A 4DW2H 4D0DB 1YYLH 5CLWA 3LOWA 4HS3B 4XNYL 3ULUC 4X6CB 4L29A 3IGAB 4J8RA 3UXFA 2VE6A 2BRRL 1YMHA 4Y4HC 3F65A 4Y5XB 4L4VE 2YRPA 2E9BA 3D85A 5C71A 5J1AA 1JRHH 1MHPL 2ZKHL 1KSRA 2UYLA 3MUGA 4MAYD 4PS4H 4WWKD 2C26A 2FJHB 2FJGA 1LHZA 3F12A 2R69L 2A2QT 2Y23A 3C8DA 2OI9B 4GKNB 4RMSA 5FK9B 1T83C 1UGNA 4FNLH 5ICZB 2HFEB 5I17B 3HNSL 3DVGA 4HS6A 4LGRB 4P48A 4P3CL 1AJ7L 4XBGA 1XIWD 5DT1L 1I1RA 1CG9A 2X4SB 1WZ1L 5K9JL 4JY6A 3PWUA 2LVCA 2GK2A 5LBSH 1H3TA 2LVEA 5J9PA 4XWOD 2RGSA 1VPOH 4Q74A 4ZS7L 2FEEI 2IFFL 1WIOA 4XCCH 3W82A 1IILE 1OD9A 4KKLC 1A6TB 3MMEB 4ZFGL 4PGCB 4R26L 1CIUA 1O7VA 2YEZA 4KI5E 4KGJA 1LEGA 2A77H 2DTSA 3SKOA 3FOMB 3PGCB 1L6XA 3EYUL 1GYAA 4BSWA 3DTXB 4Z7UF 1Y0LA 3DV6A 4JM2B 3HC3L 4XXDA 3CJJA 4ORGB 5CINH 2XWJB 1H3PH 1FSKB 2FL5B 3EZ8A 5ELIA 3UMTA 2DQGL 3QJFA 4OGAC 3HG1D 32C2A 1QBLH 1SY6L 4RIRB 5LCVL 5SWZB 3TBYA 5IMKA 5DRWA 5ISZD 2IQ9L 1Y6MR 4XP5H 3DPBA 4PBXA 1RZ7L 1Q94B 2BZDA 4OT1L 5FA3B 5D5MF 2JK5A 4G43B 4NM8H 1K4DB 4NFBA 3UJJL 5D71L 4ODTH 4EXPX 3D2UA 3V4VH 3T2NL 1JVKA 4KDTA 5IHBA 5KG9B 4JM4L 3ZT6A 3V4PL 2YA2A 4CW1A 5LJYH 1S8DB 1KEGL 5TDPA 1F5WA 1U95A 4DKAA 2EDLA 3BPNC 1YC8A 3D18A 4O2FB 1M7IA 2R1XB 4LLQB 3DHJA 1NC2D 3I6LD 4ZFOB 2IH1A 2QQKH 4Y5XA 3RZCD 1WWCA 3VGFA 2AW2A 3VFRA 3QRGL 4XP1L 3REVB 2R23B 4PJ8B 5C0IA 5HHVH 3BPLC 5FUZH 2FJHA 2H2PD 4GKNA 4PY7A 4TVPD 1PGRB 4HKXA 4JKMA 4LLYB 1YQ2A 2FBOJ 1FP5A 1OTTD 1YZZA 2HFEA 3Q3GB 4XVUD 3TCLA 5I17A 5ICZA 4U6TA 2FZ3A 5I1HH 5GJSH 2VAAB 3LPWA 4XBEL 1MFAL 1JL8A 2WBJC 4MB5A 3VMNA 4Z0BL 4BFGA 1T6WA 4PD4K 2X4SA 5H37H 2YS4A 4N90E 4FZ8H 5JTWA 2FSEA 1KCRL 1IGYA 3LH2H 3QXUA 1U8QA 1RFDL 5E7FA 3I9GL 4NKQB 3CXDH 4OSUH 1KCSL 4KJYA 5D96C 1AC0A 3MMEA 4PGCA 1INQB 1X4YA 5C7XH 2N7BA 2ITCA 3UC0L 2VC2L 5EZOL 1QRNA 3ES6A 3FOMA 5CJBA 1YY8A 4EI6B 4Z7QE 4OZHB 3NGBB 1AO7B 1UXSB 3MJGX 5JHLH 3P4NB 3MROA 4UQ2A 4QXGL 4Y5YC 4DOHE 2XA8H 2FL5A 4POZC 3DUUB 5FGSA 3BZDA 5I2IA 2E9IA 3BP4B 3T3PE 1Q1JH 1PDKA 3KXFA 5J13C 4RIRA 3QXTA 1FZJB 4P2CG 4R8WL 5FA3A 5KSAC 3M45A 1K4DA 2HTLD 1OARL 3ARZA 3SE8H 1IEAB 3VFGL 5I18H 1LGVA 4O02L 5KJRL 1G7IA 4EIGB 5KG9A 5GRYA 1U42A 5ADOH 1XAUA 1KYOJ 4YXKL 4NDMB 1IQWL 3QQ3B 1WIUA 3D0VB 2GI7A 3SDDD 4MQSB 2R1XA 4X9FA 3MGAA 4LLQA 4OUOA 4DGVH 1S7RB 4ZFOA 1RD6A 3QUXD 5FGCE 5GS1A 4LSSH 2A6DB 1T20A 1MIEL 4RFOH 4HWEH 4PB9L 2A9NH 5IKCB 5HY9A 4GH7B 4N5UA 2AK1L 2GHWB 3OXRB 4K7FB 3SDAB 3RL2A 2RR3A 4KTYA 4PRBB 1FO0L 5T1LD 5T5FL 4P46C 3Q3GA 3ARRA 1MAML 5I8CA 1S3KL 4UT6H 2VAAA 5F8QC 3GSQB 1LO3L 4GG6F 1MRCH 3O8XD 1C5DB 1QFWL 4D94A 1H5BA 4I13B 2X4QB 5IBLC 4M1CD 1ND0B 3MUY1 5GGSY 5EIVA 4F37F 3N85H 1FH5L 4PR5A 1MCQA 3OR6B 2HWZH 3QCUH 2AERT 4XNXH 1NH6A 1JGLH 4MX7A 2D7TL 4I48A 1JK8A 2DQFB 5F7DB 1N7ML 5HDQL 4MSWB 2RFXA 1YEKL 2AEQL 1LP9B 1XEDA 5CP3A 4EI6A 4U2YA 1F6AB 1RQ5A 4OZHA 4R0LA 3DX8A 1AO7A 1UXSA 2X1XR 1VKXB 3P4NA 3BRDA 5T1DH 4RMWA 4ZNCD 4Y4FA 4JZJC 2JIXB 3RA7H 1FBIL 4MJ4A 4A6YL 2EDBA 5HI5D 5CJOL 2ADGA 1HSBB 3BP4A 2B2XH 3PHOB 1AR2A 4NQED 2AVGA 2DI7A 2P5WD 2AP2A 5GHWH 4Y8DC 1X5FA 1WJ3A 5BZDB 2JELH 1FZJA 1KB5B 4ZOAA 4OLYL 3IJYA 2IG2H 3RNQB 2FDBP 4D3CH 1QRKA 3G5XB 3MUJA 1B90A 3RUGE 2V5SA 3H3KA 1ACZA 3C5SB 1XGRB 1PYWB 3PIQB 3PWPE 4MHHI 5FCSH 2IC2A 4NDMA 3D0VA 4LVEA 4LNRB 1FGNH 1XGPB 5IBUB 2ZPKH 4XGZB 3WHE1 1A4KA 3MRBB 2Y4SA 3TYGL 3ECBA 5EBLB 2A6KA 4HULB 1AIFB 5IKCA 1QKZL 1U91A 4K7FA 4KK5C 3GB7B 2VZ1A 4X4ZA 1AKJB 1GJIA 4MJID 2NW2B 1KELH 3T1FA 1WAAA 1U58A 3LSOB 2OYPA 1BMGA 2VISB 5HHMB 3BFOA 5T3ZL 3RDTB 1A7NL 2WZPD 4ONHB 1F97A 4OD2A 4X4MA 2CH8A 5F7HA 4XNUL 1PJ9A 2X4QA 3QDAA 1AI1H 4NQSB 3S37H 4XZUB 1ZAGA 3HI5H 4TRPH 4P2RE 4RWHA 5F7DA 4EOWH 1E28B 5C6WH 2Y07H 3MV8B 2DD8H 4U31A 2D7OA 1M6OA 4OLUL 1R6VA 2Z4QA 3LEXB 4XMKH 3RIAF 3EZJB 2VXTL 1P7KA 1YPZE 5ESQB 2JIXA 2VDQH 5B39B 4Y16B 1F58L 2C3VB 4U0RB 5EZLA 3P30H 2YMXH 1HSBA 1C16A 4AEEA 4GW5A 3HE7B 2P46B 2VDNH 2CQVA 4BZ1H 1XGTB 3TCXA 4NQDE 4L3ED 5L7XH 3MXWL 3I02B 5B8CB 1N2RB 1CICD 5E6ZA 3RNQA 2AJYH 2EEDA 1JYVA 1SJEA 3G5XA 4JFXA 5AWNL 2HT3D 1JFQL 1M7XA 5BS0E 2YRLA 5CHNA 5IJVA 5F89B 2RHEA 1LO0H 1F90L 2ENYA 4YDIH 1XGRA 1UM6L 5I1LA 4P49A 1PYWA 3VWJD 2BSTB 4HUNB 3O6LL 4LNRA 2ADFL 1T66D 4D0BB 1XGPA 4XGZA 2R39A 1XF2B 1IGTB 4XPTL 1BLNB 1MQKH 4LSUL 4XX1G 1HWGB 3GHEL 4FQ2H 3PWNB 5GGSA 3P4OA 2DQUL 4MXVE 1NAML 4OZFB 3RIFK 2HJLB 3UYRL 1LK3L 3WO4C 5E95B 2H8PA 1YEDB 3P0YH 4LSPH 4KRLB 2YD5A 4L8BA 3CVIH 4ALAL 3GB7A 2DIAA 4MMZC 5M95B 1AKJA 1R3KA 2VXSH 5EU5B 3FB6B 5FGBC 3LSOA 5C08D 3GIVA 3RVTD 4LCWD 4J1UB 1XGYH 3BEWB 4D9LL 5HPMB 2BNRD 2YC1A 3GMLA 4HXAL 4L4VA 3V7MA 4XCYB 3U7YH 1DQLH 4ONHA 4KJPD 4S10A 4Z78B 3ZL4H 5IMOB 5CKAA 2APVA 1AXTH 3QDGD 3TVMA 1FGVH 4HX1A 4P0DA 2QSQA 4NQSA 4GRWB 5L88L 3X3GL 5E2TL 2JCCB 4U7SA 5HHOD 3BQUD 5F7FA 1A14H 1F00I 2UZXB 5DLMH 1E28A 1MCOL 2NY6C 3G6DH 3OMZA 5J3HD 5CFHA 1FYTE 5CUSH 2X4RA 4XRCB 1YEFH 4JRYB 4AEHL 1T7VA 5DD5H 5B39A 1G0DA 3SDXB 5DVMA 1WBYB 2C3VA 5F7NC 2PO6C 3HMXA 1JGEB 3MJ7B 1CFVH 3CFCH 5FO8A 4IOFC 4FABH 4OCRL 3EIFA 3BKJL 1Z9MA 1CS6A 4HJJH 3I2CL 3ZHLA 2KUTA 4X6DF 1F4XH 1XF4B 1JBJA 3I02A 3WFDL 5B8CA 2DOCA 1AY1H 4NJAL 4PGBB 1YUHB 3GZKA 4HLZG 3LDBB 5F89A 3FQXB 1D5MA 2KBGA 3L5XL 4WFHD 5D1ZB 4FQXB 4AT6B 5DC9B 1EFXA 1BVZA 3DARA 4JFQA 3OKMB 3AFLA 2BSTA 2A83A 5JPNB 3A0OA 4I1NB 5IFHH 3ARBC 4OIAA 5HHQB 1ORSB 1SJXA 4JG1L 1ZGLB 2F5BH 3BIAX 4FXGB 1XF2A 1IGTA 3KYMA 1BLNA 5DGRA 4OLZL 1WBXA 2Y5TA 5JR1L 1GHFL 3K0WA 1IAKA 4OZFA 1ZHKA 4KQ4H 1YEDA 3L3JB 1MIML 2GUOA 2FX7L 5TJWK 2X2YA 5IVNA 3FB6A 3CK0L 4BSVA 2FHBA 4OCWL 5HPMA 5LAXB 5B22A 1NBYA 5FYLD 5J1TC 3I50H 5EOCL 2MKLC 1K3IA 4JHZA 3RJQB 1WUNT 4IJ3C 2G60L 3CZJA 1S9WA 4RZCA 4QHUA 2DTML 3BDXA 1CYGA 2GCYA 4KXZI 4HBQA 1AR1D 4Q9QL 2D03L 4LIQE 5I0ZA 1HSAA 5C2UB 3JV5A 1IGFH 3KPQA 5MERA 3ALXA 2C1PA 1KTLB 5C0CD 1FFOB 2JCCA 3QEQB 2ZP0T 3QG6A 3R06A 5FOJA 5MI0B 3K1KC 2DDQH 4EJ1C 2HLAB 4RGNC 4XP6H 3UPCA 3S96B 1KIRA 2G5BA 1RIHL 1MPAL 3MLSH 4HIXH 5EZIL 4JJ5B 3IXTB 4JRYA 3C6LB 3QISA 3VFOA 3JTSA 4QRRE 3RVXC 4KRPC 2EIDA 5DS8B 3T0AA 5JMRA 3D2UD 2MTPA 1CDUA 1MJ7L 2XWBB 3GRWL 5T3XL 1OW0A 1T89A 5IHUL 4DWHA 3W9DA 2AABL 4GMSL 4JANB 5DDHB 4CAGA 1HHGB 1XF4A 2ED7A 3PGFL 2HFFA 1WVZA 43CAB 1J10A 4ONFL 1MFCH 3UX9B 3FO1B 1Z0NA 1OGAE 4W81A 5E2WL 2VN4A 1QA9A 2A38A 2NZ9D 2NZIA 3LKNB 5JPNA 4S1QL 1MFEL 1KB5H 3NZHL 3BH9A 5DMJB 5HHQA 1FE8H 3FQNA 4YDKL 1ZGLA 3V6ZB 4KK8D 4FXGA 2Y5EA 3CCHB 1G7JA 3LQZB 2QADB 4LCCA 3EFFB 2I07B 5HYSA 1AXSB 4O2EB 1MUJA 3HI6L 3PWPB 5JZ7D 3SKNB 2PYED 1WFNA 5I74B 5E2UL 1VEMA 4XXCA 4I3SH 1C08A 4PRAB 2UZIH 2XV6B 1RIVL 3LS5H 4Y2DB 3GBMH 1X4ZA 1IGML 3ARPA 3SCMB 4HGWB 3BGMB 3TNNB 3EOYG 4M4RA 4K8RC 1N3NB 2DRUA 4F9LA 3N1FC 1QRND 4OGYH 2BVOB 5D1QC 2LQRA 3AREC 2PCPB 4NKIH 3FTGA 3Q5YA 1IT9L 5K9QI 2VLJE 3RFZC 3EYQD 3FOLB 1EMTL 1EA9C 1KTLA 3F7YB 4HFWA 4HIJB 1TTUA 2DMCA 4ZMAT 3R0NA 1U8IA 1K9TA 4OJFL 2AJVL 3BP5A 1WZMA 4L5FL 4WU5B 3KXFD 3CMOL 1G84A 1E4WH 3S96A 4MDJA 4JRXE 4JJ5A 3C6LA 1C1EH 5BO1H 4JAMA 4C57C 5DS8A 1N6UA 1KN2H 3BWAB 3HZKA 4P57B 2XWBA 2BVYA 1KCVL 3QHFL 1Q9KA 4UINH 4K8RL 5D72H 2FD6H 5DDHA 4DFIA 4PREB 1LO2H 43CAA 1DANT 4X4XB 3WFBH 1OGTB 4EUPG 3MGOB 1UYWL 3IFLL 3FO1A 1IL1A 4E41E 1OB1B 2KDGA 2NW3B 3MFFB 1H8OA 3VFSB 2APXA 3LMJH 5HI3D 4BK5A 2BOBB 3UTQB 4FQLH 3V6ZA 3STZA 3PDOA 3C5ZB 4WNQB 5CD3B 5DMKB 3EFFA 4R2GD 3IJSB 1VADB 1UKSA 2J1KA 3PWPA 3KNBB 1R5VA 1PG7H 35C8H 1OAKL 3V4UL 1KENH 1T5WB 2WSKA 1UH4A 4Y2DA 5AYQA 2FYYB 2R0ZH 3BGMA 4OFIA 1NGPH 4C83A 1TVDA 3ZDZE 1B4JH 5D7SL 1FFQA 3ROOB 4NC1C 3U0TB 3GI9L 5HDBF 3WV0A 4F7TB 3UTPE 2BVOA 1U8JB 2CK0H 1A0QL 4NO3B 1P1ZB 2PCPA 1FNGB 2WIMA 1F02I 5DHYA 5FKPA 1G7QB 2UWEB 3FOLA 4QOKE 4AJ0A 3W9EB 1T1YB 4Y4FD 2KZ1B 3F7YA 4W4OC 3NFPA 4Z7OF 3MRRB 1U8HB 4KHTL 5IB3A 4M6OH 3MA9H 5E9DD 5A3ID 4CUCA 5KANI 4WU5A 3TT1L 1ED3B 2H1PH 4NRXB 2EDEA 3QH3B 4JFHE 4X0KA 1JWUB 1SM3L 5E5RB 5DFVC 1RZGB 4CN1A 3P9LA 3UYOD 4NZTH 4ZFZB 4B53A 2AEWA 5IEHB 5D93C 1DQQA 2YSSA 4P57A 1GOGA 4KVCH 3QIUC 3HZVB 2EXWD 3QUKA 3K80A 1SQ2N 3HRZA 1Z5LB 2ERJB 3VGHA 3FQWA 2RB8A 1FYTB 2EZ0C 1QLFA 4JPIB 5C0BE 3PQYE 5JHDB 1YPZA 1EV2E 4PREA 4RMRA 4X4XA 3FT2A 5EBWA 1OGTA 3MGOA 4OCSL 1NFKA 4AQOA 4OFVA 2NY1D 4MAYC 4WWKC 3KDMB 2R0LH 1G9NL 5CZKA 5HJ3B 2EIEA 3QIWA 1OB1A 5BQ7B 5FUOL 4UILL 3HNTL 4ONOA 4NQDA 4XMPH 5JOEA 2ESVB 1PZUB 5GGVH 1ZLSH 2NMSA 3UTQA 5I8OL 2CO6B 3O4LD 4ZUSB 1XIWC 5GRJL 4CMHC 1JUFB 5BS0A 3WFHA 3L7FB 2EH8H 2ZG3A 4WNQA 2D7QA 5CSBA 2HRPL 5CD3A 5DMKA 3MLZL 2V2TB 4YFLF 3IJSA 1VADA 3BPCB 1GL4B 4RFEB 4Y89A 5E8NA 4LF3B 3O3EB 3VXMB 4HQQH 1TCMA 2FIRT 4R4BB 3R8QA 4XC3L 3SJVE 5IW1B 3HMWH 2BERA 2E7MA 4DGIL 2R2BB 1GAFH 4DZ8B 1CR9L 3U0TA 1OCWL 3WD5L 3MLWL 4NO3A 2HTKD 3KPNA 4ZTPL 3MUHL 2XZAL 3HLAB 3GSRB 7FABH 5IUSA 1KPVB 1G7QA 3RZWA 4JPKL 2HA1A 3OZ9L 1T1YA 1NGQH 1WGOA 4LEOB 4E42B 1RK0A 3UTSB 5FAAA 3GBNH 2NXZD 3S3JA 3LQAL 4L1HA 2FB4L 1K8DB 3GMOB 2BSSB 2R0KH 1ED3A 4NRXA 5IESL 2XIDA 3QH3A 5D6CB 3BDYH 3IU4L 3OGOE 3O6KL 3QUZA 3X14B 4I0KA 4ZFZA 4P5MB 2QR0A 4A2MA 3WJLA 4DKDC 2NLJB 3WS6C 1J05B 3C2SA 3HZVA 2ZUQB 3B3IB 1JTPA 2V17H 3JVGA 3GGWA 1GGBH 3V5DA 1FYTA 2X4PB 4IDJL 4NRZB 4QYOA 4HSQA 1VEPA 4M6NL 4DK3A 1RUMH 1JHKL 4QRRB 2ORBH 1ES0A 2DF3A 4QNPE 5FCUL 1BQSA 3DVNB 5BW7C 4M8QB 4PJ9A 1IM3B 4NNYA 3OAYK 5C0JB 2X42A 3KDMA 4I3RL 2PW1B 1OP9A 3NA9L 5HJ3A 4LSQH 5EUOB 5BQ7A 5J0BA 1ZMYA 3CGTA 1NMAL 2VDPL 3EOBB 4H5SB 5IB2B 2NNAB 1J7VR 4R90H 1OTTC 4K2UL 2DN7A 3FHQA 4PLNC 2SEBB 1T0NB 3Q5OA 4BKLA 2VITB 1IRAY 4PTTB 3VA2C 3AAZB 3VGDA 1JUFA 4L4VD 3M1BA 3SGKA 1OTSC 3T0EE 2NTFB 2V2TA 4HUXB 2WUCL 1X9QA 3BPCA 4MXQD 4TVSa 5TE4H 3IDXL 3TVMD 1J88A 4J3OC 3I85A 4LF3A 4W6XB 5DSCB 2DLEA 3O3EA 5GISL 3IDYC 3SGJA 3BX7C 2DQDL 5IW1A 3GKWL 5IG7A 1GZQA 2R2BA 4LDEB 4PJ7B 3FB7B 3MGTA 1DBKL 3VG9C 4WFEE 2OTPA 3F62A 3FRUA 3MRNB 3O0RH 4U1MA 2B0SH 2OX5A 4TVPL 3HLAA 3GSRA 4ISVA 1KPVA 3PGDB 3UP1A 5MENB 2NR6D 1INEH 2J6EL 4Z7WF 1EHAA 2V2XA 4X9IA 2VLKE 4NO0B 5DMYA 4DN3L 2J8UE 2BNQE 4JRWA 5D6CA 3CXHK 1S5HB 3X14A 4LASH 3BKMH 4HT1L 3UAJD 2HTLC 3AS0A 2AJZB 2R0WL 4NJ9L 2NLJA 4Z7UE 4ZAKB 5IIEA 1KOAA 1A7QH 1J05A 1BREA 3KYOB 4PGJA 1OT1A 3B3IA 2HFGL 4ENED 1SYVB 4JFOB 2C3HA 3G5VB 1EFXD 1FC1A 2YXFA 4M3JA 4OBRA 3WO3B 4JRXB 3UJIH 2OR9L 4QRRA 1N5YH 3GKZA 5BMFH 4IRJB 2P48B 1S9VB 1D5ZA 1V3MA 4CNIA 5C0JA 4NZDA 1MEXH 5D5ME 4PGEB 5KN5B 4UB0H 1D5XB 5C0AB 5I66B 5IB2A 1I9IL 1ONQA 3MXVL 3E2HB 3O3AB 3P2TA 1IGIH 4I0PB 3BKCH 3TJEL 4WI8A 2VITA 2DL2A 4WW1B 4PTTA 2E27H 1NANI 4W68A 3WXWL 3D6GA 2DQCH 3C08L 3O8XC 4FFWD 4JQVC 3U9PH 2NTFA 4E41B 4LFHD 4XI5D 2JE8A 1SJHB 4P4KB 4CN4A 1DQML 5GRVL 3MLVL 5FF6A 4L8SC 4OLXL 4FP8H 2WWKO 3GO1H 1HZHH 4RAUB 4Y5VB 2HMIC 5DSCA 4U33A 5D1XB 5DD1H 1P5VA 3O41B 1FAIH 3SO3B 3AROA 3Q6GH 4FQJL 1ZTXH 4JY5H 4LARL 4LVOC 3U7WH 4PJ7A 3FB7A 4H26B 4N8CH 4NNPL 4NN7C 5B3NA 4XPHL 3HFMH 1KB9K 4F58L 5J89A 4JDTL 2AXJA 3MRNA 3D9AL 4YEFA 5JXAH 1RUAL 2DWEA 5ICXB 1A9EA 3CSYB 1BFSA 5EBMB 4Y2OA 3EHBC 5HI5C 1BECA 2CKBB 3VXRE 1MRDH 4KUZL 3ARFD 2YHGA 3LKPA 1JHLH 2DQTL 1VGEH 2G9HB 1QLRB 3LZFH 4G6KL 1NCAL 1WK0A 1G7PA 4QXUL 4YX2L 1M05B 2EC9T 2VLJA 1QD0A 3JBG7 1S5HA 1HILB 1OLZA 2R29L 5J12C 1UM4L 4G80A 5DEZA 1GGCL 5CP7B 4X99B 5E2VL 3KYOA 3CDGB 1SYVA 4JFOA 1DBML 2F5AH 5CGYD 1KJ2L 3MJ9L 1IKNC 2VH5H 5F21B 3FN9A 1NCWH 4JRXA 5INCB 3KPSB 1JWSB 4IRZH 3BP6B 1DL7L 3KVQA 1FIEA 4LOUC 1DFBL 4AMKH 3B9KB 1U8LA 2XKUA 4N0FA 3O6ML 1JRHL 1XZ0B 3HI1B 4TUJA 3QQ9C 2XXCB 5BCAA 3HCVB 4MCZB 4X5WB 3PQYB 4I0PA 5IVZB 1T1ZB 4WW1A 1ZA6B 2A6IB 3LIZH 3DBXA 3RWGA 4FNLL 3U30B 4QGTA 2OJZH 2QQQA 3HUJF 4AK1A 1JZ7A 1JMXA 4E41A 1SJHA 4P4KA 4HIHB 4QCIB 4B7IA 3QFJB 4RAUA 3A67H 4P23B 3KLHD 4K94C 1HK6A 1QNZL 1CT8B 3O41A 3GSNH 5DJ6A 3W0WE 3QQ4B 4R7NB 1IC4L 1I1CA 3S88L 3GJEB 5HGDB 4X98B 2HRLA 5EOTB 2Q20A 5TGBB 4YBLB 1ETZB 4X7CC 4GG6E 1AQKL 4OCYL 4XNQB 5BVPL 2ZG2A 2ITDB 4ODXA 1HDMB 2E6JA 4FFYL 5ICXA 1MHCB 1NCCL 2XPGB 3MCLH 4U7MA 3MLUL 3ZKXB 1BZ7B 3HHRB 2VWEC 3E8UH 2G9HA 1QLRA 2Y1VA 3ELAT 1M05A 1QSFE 3DIFB 1N6QH 3L5HA 4QOKA 1CICC 1HILA 5L2KE 3EBAA 5HHNB 3RWFA 1TZIA 3S36H 4OCLC 5F7MC 3BVNA 4NIKB 4K94L 1J9CT 4AH2A 1MJJB 3LN5B 1A4JB 3VWJC 3BEVA 2BY3A 1FDLH 1YN7B 4U6YB 3MA7B 4IIQC 4MAUL 4G42B 3OAYH 1T66C 1T80A 3U4EA 1BVLB 4R4FH 2HVKB 3CVHB 1NFIB 1JWSA 5J11B 2X4NA 2V5MA 3O81A 3H6JA 3WIHH 3OHXA 1QQDA 3ZYIA 4PJXE 4C56E 1KEMH 3B9KA 3P9MB 5FGRA 3EDEA 5C0BA 1XZ0A 3PL6C 1DN0B 4FOMA 3HCVA 4MCZA 3PQYA 5IVZA 2FO1A 2EDWA 5EOCJ 4PLKD 2EE2A 3BYTA 4WUUE 1X5GA 2YKLL 3VRJB 5F7UA 2JB5H 5IB1B 3QULB 3BMWA 1MRFH 1L7IH 5GJSL 3JSSA 4HIHA 2CRIA 2A1WH 5I1GL 3UO1H 2JJTA 1NDGA 3QFJA 4TSAH 2EYTB 3C60B 4P23A 2VYRE 1W72B 4K7PH 3BQUC 3QQ4A 3PWVB 4R7NA 3GSVA 3TN0C 1AGFB 4GXUM 5JW5B 5IGXH 3GJEA 3KWWA 4X98A 5EOTA 4EVNB 3RWJB 5TGBA 1ETZA 1DJSA 3TBTB 4XNQA 3TBSB 1S78C 2Z31B 4S2SB 1EZVY 2CIIB 1RZJC 1MVUB 2ITDA 3SJVA 1H15B 1MHCA 2XPGA 4MB3A 5L8KB 2W60B 4Y1AB 1KCKA 1WC7A 4NFDA 3GMPA 4P2RD 4PY8I 5F97E 1JPTH 2ED8A 5C0DB 2EDKA 1NBVH 4O58H 4LKCB 5GRZA 3BZFB 5IBUG 2BNUA 2ZOLA 4JZOA 5I1KH 5GS0H 3NH7H 3MRDB 1FCGA 1WWWX 4HFUL 1LEKA 3PDGA 3TZVA 2XWTB 3B5HA 5EC1B 3IDNB 4U1IB 4JKWA 3PUCA 1TJHH 4N9OB 1A4JA 3T8XA 2ILLA 3KPOB 1YN7A 3QIWD 3F5WA 1QSEE 5EORL 5EDXA 4J3SA 5D9SB 4NQDD 1BVLA 1B2WH 5ADOL 2HVKA 3EFDL 4M7KH 1NFIA 4KVNH 4L9DA 3UBXB 4I4WB 1IGCH 3PWLB 1A2YA 1NGWB 3OTTA 1F3JA 4HPOH 1RZJL 4KTEH 4YO0B 4DGVL 5BS0D 5IFJB 3P9MA 2CJUH 2HT4C 5IR1B 4Y4HA 4M7LT 2OJEA 1DN0A 1ZLWK 1LE9B 1W0WB 5JO5B 1RJYB 4JO1L 4G6JH 1MCLA 1AHWB 3VRJA 1JPST 2D2OA 4HK0B 4KAQH 5IB1A 3QWQB 3EO9H 4B5EA 5DVOA 4X7SH 3A6BH 4ODVL 1CTNA 3EGSB 1AE6L 1AR1C 5I8EB 1HCVA 2EYTA 3S8WA 3WYRA 5B39G 3I6GB 4G9FB 1X5AA 4X6CF 5FYKL 5I71B 1CI5A 1W72A 1LO4L 3OL2A 5EIQA 3ARXA 5F7EH 1MLBB 1U3HD 1YN6A 3T0EA 5LXGH 1EO8L 2JJSA 2DJUA 4XNXL 2H9GB 5C09D 3JWOH 3WIIH 4EVNA 3RWJA 4EQ2A 3MRLA 1CFSA 3MOBH 3TBTA 1MCEA 1IMHC 3NTCH 3TBSA 3IDGA 2Z31A 4S2SA 4YFEA 2CIIA 4XP4H 1E0OB 3QUZD 4L3CB 1RZ8A 2I5YH 5IK3B 5IMLB 1S7VB 4NWTH 1DBAH 5DA0B 2W60A 4Y1AA 4KDTC 3MNVB 4XH2A 5FYLL 4YBHA 3X13B 2AJUH 4GBXD 2GJ6D 4H20L 5C0DA 3SKMA 4ZO8A 5L2JB 1JZ8A 3BZFA 2MSPA 4Q9BA 2DAVA 2EE9A 3RX8A 3WE6B 5HYJB 4UNUA 1J8HB 3VXUD 5GHWL 2CKBH 4Y5XC 4OZFG 4JFFB 3VXRB 1F4YH 1MCFA 2XWTA 5EC1A 2VLRB 2VLKA 3IDNA 4PJ9D 5ACMA 4U1IA 3H0TA 3P9WB 4JFZL 2IG2L 4IRSB 3LPFA 1BQUA 4S1DC 4H1LB 1EK3A 2BNQA 2J8UA 4C4KO 3P11L 5DEFA 5D9SA 1LO5B 1CLOH 5EO0B 4MD5B 4KK8C 5FYKU 3KPRB 3PWLA 2A0LD 5IQ7H 1NGWA 4GUPB 4JM2F 3VMOA 2VR5A 3ZE2F 3V0WH 4X6DE 4YO0A 4YHPB 3EOTH 3V5HB 1QLEL 4JO4L 5D2NE 3STBA 4D9RE 1JGDB 1F3DJ 1ZOXA 1FIGL 1JTTA 3N1PC 4M62H 2MJWA 3HE6B 2NY4B 1ZXQA 3MV9D 1LE9A 2W65B 5EU7C 1W0WA 4HF5L 5T3XE 5JO5A 4K3HA 3V79C 4M43L 4PYHA 2WLYA 5JPMB 2QKIB 1AHWA 1Q9LB 4HK0A 2KQNA 4X5XB 5GJTH 3DMMA 5D5MA 4KZEH 3NZ8B 2AV7B 3EGSA 1B0RA 1BBDH 1EGJH 1JRHI 3B5TA 1U8PB 5FXCH 1ZWIB 3LD8B 2I9LB 2LV4A 5F1KC 4NPYB 1MWAB 5CZVL 4JPWL 1MLBA 5JUEL 3SY0A 2X1OA 3MBEB 4RGNE 1MFBH 4WI3A 1PLGH 2P8PB 2OQJB 3KLAA 2H9GA 1A7PH 1DR9A 3IFNH 4N8VB 2PR4H 4FA8A 2MHAB 1JPGA 2EC8A 2GTZB 4EOWL 1I8KA 4JEGB 4L3CA 3ZT5A 1A6UL 1CQKA 5EPMB 1S7VA 4ZSOE 3MNVA 1A7OL 4OAWA 4WHYH 4LRIA 1RJLB 4JO2H 1A6ZB 1R5WB 3HS0B 5ITFB 3IDIA 2JJUA 1ZHLA 1YEEL 2W9LA 3DWTA 1DSFL 2ZUYA 3MBXL 1J8HA 4M7LH 5J8OA 4TSCL 4LSTL 5C0EA 3VXRA 1JHTA 1FO0A 2VLRA 4I18B 4RWYH 2AJYL 4IRSA 3WMSA 3LV3B 2ARJQ 5HI3C 4Z95L 4WTWA 3RU8L 3FRPG 1LO0L 4DCQB 1LO5A 4MNGE 5EO0A 3U1SL 3SDCB 4OZHF 4CGTA 4GUPA 4NUJB 2YPLE 3PV6B 4XPBH 4G5ZH 1OGAD 4WEBL 3V5HA 4POYA 2D3VA 4RMTA 1BFTA 3SHSA 4I77H 1UB5B 2R4SL 1H5BC 3DX7B 1OSZB 2CLRB 2E5EA 3EYOB 4ZNEA 3CVHH 1I1AD 4LSPL 5IFAH 3HTLX 3VRLF 4KK6C 4ZFOL 4NRYB 2QKIA 2VXSL 5F3BB 1Q9LA 4X5XA 4PJXB 1U3ZA 2W92A 1Z3GH 4OZGE 5DURB 1JWMB 5AD0B 5FOBB 5EBGA 2D0FA 5TQ2H 1KV3A 2W9EH 4A6YA 4R0LC 4C59B 5LVEA 2O5YH 4O51A 3QB7C 5EIIB 2D0GA 2I9LA 2XACC 1Z6JT 3F7VB 4Y4FC 3EAKA 5F1SA 3CFDB 2R4RL 4ORZC 1MWAA 2BOCB 4GW4B 3ARDD 1X5JA 3WDIA 1I7UB 1A1NB 1UVQB 4XPAL 3EJZC 4OB5L 2OQJA 1FNFA 1A14L 1JNLH 3U83A 4N8VA 4KMTL 5DLML 1S9YB 5I8KH 3CZFB 2GTZA 3SDYL 3QEGL 4JKKA 2VLJD 3G6DL 3DXAB 1FV1A 4NYLB 4OQ1A 4NKOB 1YEFL 3TV3H 4JR9L 1UT9A 1BQLL 2PXYA 4XBPA 4F80A 4HUVA 4P9HH 2CDFB 4BQ9A 1RJLA 1R5WA 3HS0A 3FN0L 4GG6A 5I6XB 1P53A 1NMCB 4JJHA 3WKNA 3P0VH 4I2XB 2FO4A 5BJTA 1PKQE 3ARVA 1WQVT 3H3PL 2QSVA 4UT7H 1TDQA 5TFSL 3RVVD 2NY1C 5SX4I 4I18A 1U92A 3RNKA 4ZDHA 3TEUA 2VIRB 4UAOB 5T1MB 3IF1B 3X11A 1BAFL 1QSFA 3QPQD 1RIUH 3UDWA 2OL3A 1LP9F 4WJ5A 2WANA 5L2KA 1FVEA 3VXPA 5JLZB 2Q8AH 4PJGE 1G9MH 4GS7B 4RNRB 3IDUA 4NUJA 5IFHL 1ZLWH 3PV6A 2QQNH 2WV3A 2AS5M 3KR3L 2ATPB 3RY6A 1UB5A 2XG5A 4FQQB 4NO2B 3PWJB 3DX7A 1BJ8A 2FWOA 2CLRA 2O5XL 3CMGA 4ZPVB 1C5BH 4PJCB 2OK0L 5ICYA 4EBQL 4OLWL 5JORA 1BM3H 1AP2B 4NRYA 4U0QB 4C56A 4PJXA 5D8JL 3LB6D 4DVBB 5FOBA 1HHHB 2FGWH 3I50L 1KBGL 2HTKC 4XVJH 1Y18B 3QWRA 2DIJA 5GPRA 2VABB 5DJAB 3MRKA 4WUUA 1J1XH 3F7VA 3CFDA 2C7UA 3QNYB 3WDHA 4P2OA 1UVQA 4M00A 3O2VH 1Q9OB 4HS8L 2Y6SD 5LQBL 1V8HA 3V6OA 4RX4A 4XCEB 1S9YA 3CZFA 4V2BA 3V95A 1B88A 2DDQL 4R4ND 4U1JA 4NYLA 3VMPA 4QOKD 1CDJA 5HDBE 4NKOA 2X40A 4PRNB 2DMBA 3GMRB 5EWIL 1CBVL 3O9WA 4ZS6C 5HHXL 5E8OB 3QP3A 4NBYB 3TJHD 2V2WB 2VQTA 4LMQI 3VI4F 3QCTH 2EIZB 1GVIA 3ZLQC 3RTQD 1J1OH 4PIRF 1QFOA 4CU7A 5ILTH 4NWUL 2EDHA 1S7SA 5HVFB 3ZSTA 4JE4B 5TH2A 5KVMC 4PG2A 3D39B 3IF1A 1CK0H 2BK8A 2XOTA 1HHKA 1HIMH 2IAMB 2H26B 5C0BD 4YHNB 2NY0D 4OQTH 3GSWB 1T1XB 3E6HB 1C7SA 4TNVK 2AK4D 2DBLH 1KB5L 4JPVH 4I0CC 2ATPA 3VJ6B 4ZTOL 3MRMB 3LRGA 4KI5F 4MXQC 4FRWA 4H1LH 2ARJB 1QSEA 4QF1A 3JUZA 2W0FB 3PWJA 4HZLB 3TVMC 3WNMA 2FX8L 3ILQC 2F58H 2DLIA 1IAIL 5IT2L 1KYOK 3BAEL 4NM4H 5CBEA 3RIFF 2DKUA 5H35A 3B2UD 3T1WA 1IC5H 4PRHE 2FBJH 1A64A 4WHCA 2Y25A 2J3SA 5HHPA 2VABA 2I60H 5EU6B 5DJAA 3TH3T 3QPXL 1EXUB 15C8H 1KUMA 1RZKH 2B1HH 3MOAH 3SJVD 3EYFA 5DVNA 4KI5C 2N1KA 1H3UA 4U0RC 5DZOA 5DQJB 5CEZH 3DROB 2NYYD 4PP1C 1CXFA 3OBAA 1Q8MA 3ME0A 3OPZH 3TP4A 2VQUA 5ADPL 4Z9KB 4X4YA 1EH9A 3C09B 1LDPH 3AUVA 3T3MF 5B8CC 1FYHB 5HYIA 1NBQA 1E6OH 4GAGH 4PRNA 5LWYL 1MLCB 4MCYB 5F71A 4H8WC 1I1FB 3ALWA 3O2DH 3TZVD 4ENEC 2H3NA 1UC6A 2R1WA 5E8OA 1EAPB 4YXLL 1SEBB 2V2WA 3F7PC 2EIZA 5MP6H 3S9DB 4K23H 4G8GB 1UZ8B 4RA3A 4LLVA 4UV4H 3VE0A 4MJ2A 2ZSWB 3RKDC 3SQOH 4ZSOB 4GSDL 4GRWF 1ZVSB 1DVFB 2JCCF 3D39A 4M7ZB 1ZEAH 5F9JA 5K59E 3HMXL 1MF2L 2H26A 2UZYB 4M1GL 1TTFA 2VZTA 4Y4HD 3MCKA 2N7AA 3ZT7A 1D9KA 4YHYB 5F9DC 3OKKB 4Z5RB 2V7NA 3QIBA 1HNFA 5GSRA 2GJZA 3ZTJH 3LMJL 3QFDA 5KSVA 5AZEL 3QHZH 5IMMB 3L3IB 3K2MC 5D7JB 4XI5C 4XP9L 1INDH 3FQTB 4PGZA 4YQXH 3SDXF 5AZ2L 1F11B 4H8WL 2ARJA 1FORH 5BV7B 2Z8VC 3H8NA 5ANME 2OXHA 1A8JH 4HZLA 2R9HC 1V3JA 1KJ3H 3HC0A 1MI5E 3NFSH 2LE9A 5CWSB 1RVFH 2GSIA 1J11A 4GJTB 4HKJA 5EU4A 1MNUL 2ZG1A 3WFZA 2FHFA 1A3RH 1PQZA 2CXGA 3S35X 4H25A 2GY7B 1I7TA 2Q8BL 5D2NA 5F3HB 3T0ED 5IBTL 5BRZE 3S4SB 1RUQH 2A73B 4NC0B 8FABA 1MHEB 1X5ZA 4XNZB 3BE1H 4D8PA 1GCFA 1KLUB 3H7BB 3RX7A 3KYKH 2FECL 3ARGB 1QBMH 4KKLD 5EU6A 4OIIL 4N9GB 2P45B 5C6TL 4S1SH 2DLHA 1PSKL 5DUPH 1EHNA 1YQVH 2XI9A 1LNUB 3WNPA 5C0NC 3LEVL 3DROA 4OZGB 4WHTB 3K2UH 1OW0C 1T89C 2J4WL 3BIKB 4WFED 4ODHL 4HPYL 2RQ8A 2ARWA 2CUMA 2LU7A 4HBCL 2LTQB 3PE9A 1BIIB 2OTUB 2CDEB 5F93C 3D1MC 4JN1L 4OGAD 5ESVB 2XN9E 2HYMA 2EO9A 4OM1H 3IKKA 1DBBH 1MLCA 4MNQE 1I1FA 3T09A 5FDWA 4HC1A 2VLKD 5GGRB 5D1ZC 5CGYC 1EAPA 1SEBA 3BT2H 2BNQD 4YZFF 4JHAH 1WV7T 4Z7WE 1OP5H 1TJIL 1UZ8A 3L3KB 3WHXB 5KZCD 1KLFA 4WO4B 5CJ5A 2ZSWA 5D7IE 1NSNL 4ZSOA 4HUKB 4HH9B 3MV7B 4LCCC 4S11A 2HKHL 4ZYKA 3C8KA 4YDJB 1N64H 4V1DD 3PXHA 5IOPA 3G6AB 1G7HA 1ZT4B 3C9NA 1NBZA 2OXGA 1J5OL 2R0LL 5C92A 3ET9F 4BQ6A 4K3DH 4XXCC 5E94B 3OKKA 1HH9A 3GSXB 4NHCL 5IMMA 2F53B 3L3IA 1T2XA 5D7JA 2ZCKH 3FQTA 3S34H 4BQ8A 1F11A 3DMMD 4F9LC 4LGSB 1KN4H 1ADQA 3RWCB 2V5RA 1SMAA 3WN5B 3CFEB 5EU3A 3GMNB 3KLHC 1IBGH 4PJGB 4EXKA 3AM8A 2YPLA 1HINH 2MMXA 1F4WL 4HKZA 5JQ6L 1EEZA 4B41A 3VFUB 1CTOA 5MI0C 2VDKL 5F3HA 4XVTL 1IGJA 2UVEA 2A73A 3NCYP 4MJ5B 4M5YL 2KH2B 3CFBB 1TVBA 3H7BA 1GAFL 5TE6H 4PRIB