4P2RA

Crystal structure of the 5cc7 tcr in complex with 5c1/i-ek
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
180
structure length
180
Chain Sequence
IKEEHTIIQAEFYLLPDKRGEFMFDFDGDEIFHVDIEKSETIWRLEEFAKFASFEAQGALANIAVDKANLDVMKERSNNTPDANVAPEVTVLSRSPVNLGEPNILICFIDKFSPPVVNVTWLRNGRPVTEGVSETVFLPRDDHLFRKFHYLTFLPSTDDFYDCEVDHWGLEEPLRKHWEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Deconstructing the Peptide-MHC Specificity of T Cell Recognition.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords H-2 class II histocompatibility antigen, E-K alpha chain
total genus 33
structure length 180
sequence length 180
chains with identical sequence F, K, P
ec nomenclature
pdb deposition date 2014-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00993 MHC_II_alpha Class II histocompatibility antigen, alpha domain
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4p2rA02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 4p2rA01
2IBGA 1K8IB 3OX8A 4NZTH 3U83A 4LRNH 2ESVA 3BIKA 5AZ2L 3T0EE 2AI0L 1KG0B 4NP4H 4U1GC 2BC4A 4M6ML 1U8NB 4PGDB 1I8LA 3D39A 5JIHA 1FNGB 5LCVH 3RGVB 2IFGA 4EN3A 1CLYH 4XWOD 2YD7A 1NCDL 3E8UL 1UCTA 3W81A 2IQAA 2D03L 5CSGA 1MUJB 1ZA6A 2X41A 3LKOB 5EUOF 1XCQA 2VZTA 1G7IA 4PFEA 1JTOA 1V7ML 1S9YB 4XP4H 2BRRL 2OR8A 4ONOA 1HXYB 2ITCB 1YUHB 1ORSB 4P5MA 1OAKL 4XXDB 3LN5A 3E1F1 1C8PA 1XGQA 1X9QA 3RAJL 4J3OC 4FTVD 2V7NB 5E8OA 1BZ9A 1HQ4B 5DJAA 1HHIA 5DK3A 1BIIA 1QTYT 3B3IA 4YO0A 4DWHA 1A3QA 3GHEH 4OIAA 3TPUA 2CK0L 3QWOB 2X1XR 2EYTB 5HYSB 1MCCA 1A6UL 4RMUA 2FHFA 2DKSA 3AM8C 4WUKL 3KPNA 4M7JL 1KIPB 1RVFH 1FL6A 1H0DB 5IVXF 4GRLD 3HI1B 5TDOA 1ZT4B 1QQDA 4HZLA 5D7IE 1Q0XL 4LP4A 2HT2C 5ERWA 3GM8A 1U93A 4WFHE 3D5OF 3DSFL 2DQIH 3RIAK 1V3JA 3SE3A 3O3AB 5LWYL 5SX5H 4D0DA 1NL0L 3OR7A 3BP5A 4JKWA 1N59B 5DSCB 2W07A 3MRLB 4MD5A 5HYJB 5E6IC 1QLRB 3PNWB 4LHQB 1MFBL 4MJ4A 4WV1A 3VXRA 3EFDH 3SGJC 2FGZA 3QCTH 5EBMA 2GUOA 4UMGA 5ESAB 4JO2H 5I1JL 2XZCH 2IANA 3OKOB 3MUZ1 4XVTL 4ELMF 5GZOC 3QPQD 2PR4L 1I7TA 3TCLB 4WI2A 4N0UA 2RJMA 1IKFL 2CLRA 2W60B 3W11D 1MQ8A 1YJDL 5CP7A 5DUBA 2A6DA 3EFFB 12E8L 4FTVE 5BRZB 2VNCA 2D31A 5I9QB 2X4UB 2GJZA 1FH5H 1ACYL 5CBEA 3LKOA 5I18H 2ICWA 3BT2L 3INUH 5HGDA 4KV5E 3WUWB 1ZEAL 1KLGA 4RFEB 1JWSB 1P84K 4L9LC 2XY1A 3AC0A 2A6IA 4YIQA 1S7RB 4QT5A 5GS1B 2XWJA 5GRVK 2BVEA 5D8JH 5IIEB 3ROOA 3NOIA 1BIIB 3B3IB 5IHUH 4HBCH 5BMFL 1ZE3C 2R69L 3EOAB 1CIDA 1RJYB 3MV8A 3K0WA 3OPZH 3EO1A 2YD1A 4A6YA 4KAQH 1N8ZB 4JM2B 4DGIH 3TBSB 3BKCH 2WP3T 3HC0A 5DI8A 5FUOH 3C6SA 1T21B 4MAUH 1RULL 4O02L 1T7ZA 1X7QB 3KHQA 4OGYH 4AL8H 4N1HB 3BUYB 4PJHE 1JK8A 2D0FA 5L8LB 4XRCA 3Q5YA 1FAKT 1ZK9A 4OLWL 3GI8L 3CFBB 2FO4B 2MSPA 1XF4B 1KIQB 3GSWB 3RI5F 3QUKA 3HRZB 1UWGL 3DVNA 4OFKA 4U1JB 4UV7H 3S7GA 1E27A 1VADA 2W0FA 1TQCC 3BQUC 3OKDA 5BJTB 4P2QE 1QG3A 4DUWA 3MLZH 2C1OA 3FB7A 5D7SH 5JQ6L 1F3JA 3WD5H 2BMKA 3V52H 5HVHC 3ARTA 4XP1L 3CVIH 5LAXA 3C60A 2YPKB 2NQCA 1KENH 1ADQA 1MCOL 5HDQL 4RFOL 4ZFGH 2XYCA 1WIPA 1X6NA 2NX5D 3D85D 1TCMA 3FQXB 1QFWI 3VI3F 4JY5H 1KPRB 4J4PA 5D5ME 1QFHA 4KDVA 3FN0H 43CAB 3VGHA 2PUQT 2P47B 5SWZD 2FGWH 1IAII 1MAKA 3VXUB 5BV7H 1RHHB 4L3EA 3RVTC 2J8UB 3RJQB 3SE4C 4TUJA 4F57L 2JF1A 2ZG3A 2A73B 1WK0A 2QJDA 4P5KA 2AKRA 3I2CH 3EO1B 1B90A 4EBQL 5FYLD 3VXTB 1S7TA 1B6UA 3LEVH 2C3VA 3EJYC 3WIIH 5LGJB 1HIML 1KTLB 1H3TA 5JZ7D 3ZDYF 1J12A 2VXSL 2BVQA 4KZEH 3FKUS 1CD1A 5TPWH 5AD0B 5JNYA 5EIVA 1JV5A 3KS0H 2QQKL 3PV6A 1NUDA 4JM2C 1XZ0B 2YWZA 1BIHA 4LNVA 5E94B 4LVOC 3OJVC 5D93C 5L6YH 1BQHG 4NUJB 3WFHA 2FO1A 1S5HA 2D4FA 3CVHB 4ACPA 3QUMA 3ILQC 1UH2A 43C9B 4ZD3L 3EDDA 2AK4E 1EFQA 4WY7L 5CGTA 5DEGA 2VZSA 3UO1H 4ISVB 5ALBH 3FB5A 1CTNA 1BM3L 5DVMA 4Y1AB 2X4QA 1YN6B 1T7YA 1FGNL 2ZCKH 4WIQA 4LPUA 5CAYB 1X4XA 5SWZE 4DN4H 5A40E 1WTLA 4N0FB 1K9TA 5D72H 4ZUTA 5I1HH 4IOIA 1CE1H 2L4OA 5EIIB 4OI7A 1FZJB 3VFRB 3C6LC 2YRPA 2AJUL 2W9DH 5HSFA 4LSSH 2B2XL 3VGFA 4M7LT 4OV6F 4M8VA 2YPLB 1QKZL 3JXAA 2WM0A 1FFNB 3C8DA 4K3JL 3B9VA 5D1ZD 5T1LD 5D6CB 5D93B 2OZ4H 5DUPL 1EO7A 5ILTH 3A0OA 4XNZC 2DM2A 4AQOA 2VKXA 4XMPH 4PY8I 3FT3A 1VSCA 5J1AA 5EUKA 2GK2A 1GIGL 4XGZA 4MHHI 2HFEA 5C70A 4WU7B 1Q9WB 5LGJA 3VXSD 2DLIA 3NGBC 3GK8H 5GISL 2EYSA 1JUFB 3ARGA 2BP3A 2EEBA 2XTLA 1YMHA 1MF2L 1HK6A 2GFBB 1CICA 4DGYL 5IT2L 3ZT6A 1XCTA 4Q97A 2DTML 5JPMB 2BVPA 5J4MA 1FV1A 1WVZA 4KJPC 1ADQH 1M6OA 3QEQA 4ZUUA 3B9DA 1DSFL 1KB5L 1Z0NA 15C8H 3PWPB 5EWIH 2BY3A 3GSXA 5D5MA 4RISL 4YHYC 2B1HH 3PGCA 4HIEB 3U0PB 3FHAA 3V8CA 5AZEH 2ARJA 4HH8A 3QHFL 4PTUB 2J5LC 5D96B 3MXWL 5HD8D 4X4XA 2G2RA 2PCPB 2OL3B 4ZUTB 3VXPB 1RMFH 4JN2B 5D4QA 2R9HC 5EU6B 3IAQA 1AP2A 1FNSL 4OTXL 3TNNB 4DKEL 5CBAB 3OJDB 1U8HA 2Y7QB 1CLZH 1YEKL 3ESUF 3R8QA 1JFQH 3MLTB 4M4PA 3GB7A 3KPPA 4HXBL 5C0JB 5KS9F 3DX7B 1UZ8A 1P7QA 2LV4A 4Y5XC 4HEPG 5D6CA 1FE8L 1FC2D 2CMRL 2B5IB 3MFGB 4F9LC 5DQDH 4H26A 3QBTB 3PHQB 4N8VA 4LCYA 5L2KD 4NUGH 1Q0YH 5GRJH 2R23A 4FQ2H 1IKNA 3IDYC 4XPTL 3VE0B 1JF5A 1FO0H 3ARUA 4EIGB 3OKKA 3KNBA 4PP2B 1B2WL 1FSKC 4I3SL 3B6SA 5IR1A 4OCYL 3B9AA 1PFCA 3ULVE 2GTWB 4P2OB 4NKOA 3T0XA 2MKWA 4N0CD 3B9KB 1GAFL 1HH6A 5KSAA 2H45A 1NFDA 2MQCA 3GUTA 5FM5M 3V4UH 1JL8A 3QDGE 4OCMC 1VKXB 2UY6A 1UB5B 4IRSD 2WIIA 4PJDE 5CHNB 2WWKT 1BZQK 4NO0B 3ARSA 4TVPE 5AUMB 4W6WB 1LEKA 2YD5A 1RUAH 3GKZA 5IOPA 1I3VA 4ORGA 4D0CA 5D70H 4KUCD 5HYIA 4PJ5A 5E8OB 2UYLB 3IFLH 4HKXA 1J0KA 5CJXC 1UC6A 4Q9QH 1FVEB 1EGJH 1MRFH 2XA8H 2ZUWA 3LDBB 5F8RC 5FM4A 5MERA 5E08L 3ARDA 4BH8B 4FFZL 3QDGB 25C8L 1CDJA 4M3KB 4R7DB 3EDJA 3BKMH 4FQXD 1ZT4A 2YD6A 5F9OH 3TCXA 1S7SA 1SYVB 2VWEC 3HB3C 5J6HA 1BWMA 3HG1A 4YPJA 5IGXH 1OAQH 4XXCC 4EJ1C 3ULVD 1HHJA 2MPAH 1QLEH 3P11H 5IM7A 3MC0A 1K4CA 4U6YB 4X7TB 3CJJA 1QUNA 1IT9L 2V7HB 1N5AA 1J7VR 1L0QA 2FEDD 3BHBA 4BYHA 1J87A 1DR9A 4PJIA 2GSIB 1CDHA 4YWGL 4GAYB 3TFKC 1MCNA 3KPRD 1XF2A 4JRYA 3GSNB 4PYHA 4ELKB 5DTFA 3ARDC 4E41E 1JPTH 1KEGH 3BE1H 3VXRD 4ZAKC 4CL7A 5KSAB 4YX2H 3SQOH 5EORH 4XPBL 3MREB 4E9LA 1YEHH 4FFYL 1CN4A 1NMCB 3DUUA 2X4UA 1PZUB 2JIXB 5CBEB 3G04A 5ICXB 2VH5L 3D39E 3LKNB 3U1SH 5I1DB 5FHAH 3MRCA 3DMMB 2LU4A 2Z31B 3ZO0A 2VQ1A 4ZFFA 2AQ1A 2VABB 4OQTA 3SKOB 4TUKL 2EIEA 3U4BL 4IRJC 3UTQB 4H20L 5MEOB 5DA4A 4OGZA 4YZFE 1FVDA 5A2FA 2QHRH 2VLKD 3FO0H 1BBJB 4CU8A 4OM1H 3LQAL 1LO3H 2PO6C 3CPLB 4L4VD 4BUHA 2Z35A 3HE6D 1FPTH 5GGUB 5ITFA 4OZFB 4LVNC 3EIFA 3QUZA 4P9HC 2R4RH 4G43A 2HFGH 2VAJA 3GIZL 5TF1H 3F5WB 1FORH 1I9RL 4NJ9L 4YHNA 2HT4D 4UBDD 2JIXD 2OBGA 1I8MB 3STLA 5JOFA 3K8MA 5DMIL 2GSGB 4R4FL 5I73C 4CMMA 1CD8A 4P23C 1MCHA 3DURB 5HYJE 2H2PC 1HILB 3LHPL 2K7PA 1I3GL 1N3NB 4YR6A 5E56A 1GZQB 4LOUD 5GSVA 3NA9H 3EYUH 1RUKH 3RWEB 1BEYH 4G42A 4G8EB 5LKNA 4JCLA 2NXYC 1ZT1A 4P3CL 5I15H 5CWSA 4QXTB 1W0VB 1MFAH 3RL2B 4HJGA 4Z7OE 1NGXA 1I3RA 2DQTL 3ZL4L 3NZHL 3RTQD 5JW5B 4HQQL 4K7PL 3MREA 4ZTOH 1Q9OB 4HJ0D 3S96B 4I3GA 2G5BA 1T0MA 2H3NB 4OM0L 5DT1L 4JR9L 5FKPA 4M1DH 1KACB 1MPAH 1JPGB 1QSFA 2Z31A 3MV9A 5F9JA 4OLUL 3GI9H 1PYWA 3W0WE 2J5LB 5D96C 4WEUD 5JORA 3CH1A 4K9EL 2ICEA 3PQYE 3G9VA 4EQ2A 2ITDA 4OQTL 3HFML 5IMOA 4DCQB 2A73A 2UVEA 3BN3B 3LH2H 2C3XA 4HPOL 5JHLH 5JXAH 5F1NA 3M45A 1CVRA 5B39G 1MCIA 1JMXA 4OIIH 4WI4A 2I60H 3RY4A 1NBZA 3UTZB 2GY5A 2X9XA 1MCJA 3BD3A 2ZNWA 2X89A 4NWTH 1BGXL 4J3WA 5C2BL 3CSYA 3RTQB 1F58L 1YEEL 3WLWC 5L2KB 3AFLA 2XA3A 4WTWA 4QRPA 1T7WA 1C1EL 3O41A 5ALCL 1T1ZB 3V0VA 4L1HA 3RI5K 4OF7A 2DBJA 1JJUA 5HJ3A 4FG6D 5E6ZA 4YAQA 2ATPA 4LIQH 1WICA 3LV3B 3A6CH 1IZJA 1A9EA 1CR9H 4NP4L 4QOKD 4XP5L 3QPXL 5JHDD 3CXHJ 4JFHD 3LB6C 4F7TA 1MWAB 1NBYA 4XCYA 4A2MA 3IT8D 4IMKA 4NFCA 2NY7L 5AAMA 3RU8H 3RZCC 1Q9OA 3S96A 1A7NL 3SY0B 2D03H 1TMCB 4ZFOA 4MLSA 4HC1A 3QPQC 5DS8A 1AGDA 2XQBL 4GKOA 1UACL 4LLAA 5IFJB 4U1HA 2A6IB 4YIQB 1IAKA 1IAIM 4HUVB 1RZJL 2YBRA 2YXFA 4RGMC 1MJ8H 4FZEL 4P46A 3C08H 3SDDC 4F33B 1IFHH 4UIMB 2YD9A 1ZSDB 1ZHBA 5C3LD 1OF2B 2FX7H 4M8QB 3VXUD 2BXZA 2DWDB 5DJ0B 1P7QD 4OT1H 2OL3L 2ADJA 3BAEH 2CQVA 1NEZB 2YK1L 2IH1A 4Z95L 3TBSA 3RDTB 4WUKH 3C6SB 1G9NL 4LKCB 4ONHB 3MV8D 1XF5B 1MQKH 1BQUA 1QSEE 4LDOB 3DVGB 2Q6WA 2AERT 5IVXE 1MI5E 4R97C 3RX8A 2DWEB 1SJEA 1OTSD 1CGTA 1B0GB 1U92A 3KPOA 1TTUA 2Q20A 3MJ9L 1U8OB 2IGFL 1LK3L 1T1YB 1JPFB 4YXHL 4RGOH 2OJEB 4LBEA 5C0BB 1U8KA 1FO0A 3DBXA 5T5NG 2YN5A 2OR7A 4XVTH 4FS0A 3VFUA 4XNZB 2LFGA 5CIPH 2G75A 2EE6A 3QI9C 4D3CH 4KK6C 5JQHC 4U7KA 3MGTB 1NBYB 3QDMD 2B1AL 2D2OA 5E4IA 5DEZA 5LAXB 2XIDA 2FLBT 1U8JB 4NNYA 2WBWB 5EOTA 3L3GA 3UC0L 5HYFA 1WJ3A 3P9LB 4NHUA 3TWCL 5TDNA 1KUMA 2UWEF 4QCIA 1WTGT 3QEHB 2BNQD 4KTYA 2RBLA 5I30L 1D9KC 4O58H 5TQ0H 5F93C 5MEND 4NKDA 1DDHB 1AQKL 1HYRC 2VZ1A 2UZIL 4HBCL 1OGAB 2GITB 2IAMB 4GSDL 3L5WB 3OPZL 2ADJB 4EIZC 4K7PX 3VWKC 4DGIL 3BKCL 4ZXBD 3EYVA 2OZ4A 3QDMB 5F72S 4O02H 4OD3H 4OGYL 3V6BR 3AAZA 2ZSVB 3HI6L 1TNMA 2CDEB 4NQTA 3F58H 5C0CD 1X5JA 3AMLA 4FZ8L 2JK5B 3OF6A 3MRKA 1X5IA 5J56B 4TUOA 1GGBH 4NRYA 4LSDA 1JTPA 2QSCH 3CX5K 3V4PH 3KLAB 4G6KL 2VISA 2APXA 4G6MH 3TBTB 4N5EC 3HNSL 4I4WB 5E2WH 1UWGH 5L9DL 2O5YH 2OTWA 1DBJH 1JPFA 2VAAA 5DEGB 2WIIB 4NN7B 2FH8A 4DZBB 4Y19B 3VXMA 2NXZC 1TZIB 2GJ6E 1JPSH 4M9OA 3V52L 3K80A 2H41A 4PGBB 4I77H 4PJXB 3MJ9A 5I76B 5HHQB 4HWZB 3LN4A 4GW1B 3NTCH 4JAMB 3SCMB 4X4YA 2F53D 1J1XH 3TT1L 2X10A 3VGDA 1KENL 5HDQH 5B38A 4O9HH 2ZUSA 4X6BB 5IQ9B 4B53A 4JRYD 2DLTA 5I71B 3SGEH 1F5WA 3S5LA 1XF3A 1S7XA 1MHCA 5FGSA 1R0AH 4JY4A 4JVPA 4YQXL 2A0LD 2FGWL 4Y16D 3NCBB 4KKAD 1EV2E 2UV3A 3TVMB 2MJWA 3ARVA 4X4MA 2F5AL 5C0CE 1G1YA 2J8HA 3TIEA 4D94A 6CGTA 2IFFL 2F5BL 1KPVA 3BDYH 2VE6A 4XNYL 4RQQB 4D0BB 1EEYB 3RWCA 3SDXB 2XG5A 2DL2A 4JZJB 1J1OL 1QFWM 3H9HA 1HOCB 1R6VA 1UM4H 2VLME 2NR6C 1YMHB 1S9WA 2GJ6D 4M4RA 4D9RD 3NVQA 4NQDA 4QF1A 2VISB 2QR0A 3QULB 1BECA 1AFVH 3CLEH 2QBWA 2V5YA 4JKLA 3O4OC 2EO1A 5C8JB 2QTEA 1PG7W 5I19L 1X5LA 4MQXC 1DFBH 3UJJL 5ICXA 2XRAL 5FKAA 1KIRA 1TZIA 1A6AA 4UT6H 4LRIA 2CLVB 5GHWH 3PGCB 2NYYD 1J0ZA 3CC5A 3HRPA 5JW4N 2J4WH 3U36B 3G6DL 4EXPX 4OKVB 4MCZA 4OFDA 4JO1H 1M7IA 5FCUL 5B21A 3TFKD 4EKXA 2A83B 5IBTH 4P5TD 3QWOA 2JJSC 4ODUB 5EH1A 4LSSL 4OZFA 3ZKNC 4DFIA 3MLTA 3O2DA 3O4OB 4MD0B 4QHNA 1FL6B 1H0DA 5SWSD 1P7QB 4R96A 1KIUA 5FHBH 4LDLB 4JJHA 4R26L 5DUPH 4KQ3H 2H6PA 5AWNH 5DGQA 4MA1B 4JFDB 4H26B 2Z91B 2R2HA 1BQSA 3THML 3GNMH 5DHVB 2FR4B 4EXKA 4WTXA 2E27L 4ZOAA 4MA7L 4IS6B 4WHTA 4HMDA 5JPNB 1N26A 1KJ2H 2DQGH 3ARFA 5E99H 4G9DA 4NQXB 3I6GA 1F4YL 3BMVA 4YUEH 2CXKA 1MCPL 3MRRA 2F8XC 3J7HA 1C5CH 1Y6MR 4LCWB 5IWLC 5BCAA 5CLTA 5GS0L 2HWZL 2WUBL 4ZFZA 5ABDE 1LILA 5DWUH 4P9HH 3QO0B 5C0DB 1UB5A 4JFQA 5FKPB 2OR9L 4ODWB 3VXQA 5EU6E 1FG9C 2ZSWB 4RISH 3HG1D 2VJXA 5I1GH 1CDBA 4HWNA 3X11B 2Z31D 5IBUG 1D5ZB 2IQ9H 1YMMA 1W2KT 1MH5B 1NGPH 4J3XA 1AY1H 1KJ3H 1LO5A 1V3LA 3QUYB 1MRDH 4OI8A 3ESVF 4OF6A 2XG4A 1YEKH 5MENB 5AYUL 4P59H 1SM3H 3P4NB 4PJDF 4G80A 1N64L 4JDZA 1X7QA 4TSBH 1FG2B 2X1OA 1FLRL 3LCYA 4HKZB 4HCRL 5KVFH 2Y07L 4WHYG 2PW1A 1IL1B 1BVLB 1NMBH 2IPKB 4XRCB 1NCWL 1FN4A 2VDPH 4MWFB 4KZDL 3SE9H 4NQVA 4XX1E 5HXMA 4X6DB 1I1YB 2X4NB 1DQLH 4R2GD 1HKLL 1FDLH 3L7EB 1DVFD 4QXGL 2Y06L 4I0PD 4OAWB 4XPGL 1J11A 1NLDL 5FYJU 4YDLC 1XGUB 5DYOA 3LIZH 1B2WH 4I3SH 3H9SA 2CO7B 2AJVH 3EOYG 4Y5YC 5D7LE 3ULSA 4TNWF 1CXFA 1FNGA 1WFUA 5KANG 4NZRL 4ZODA 3DX8A 4J6RH 3TIDA 2P8LB 4GKSA 2GK0B 4ZFOB 2I24N 5CEYA 43CAA 4OUUB 4LLQB 5FECA 1RUQH 4YDJA 4HEME 1SQ2N 3KVQA 2ZJSH 3A67H 4F8QA 4YXLL 5EOCJ 3LKRA 5ADPH 2VQTA 1HQRB 3U7WL 5DRXB 2CRMA 3X13A 3FB6A 1I1AA 2ZCLL 2DLFL 3MODH 3CPLA 1EGJL 5DUML 5L8JB 5GZOD 2AKRB 5I16A 3ULUE 4OSUH 3V9FA 1UWXH 2D0HA 4Y2DA 3VW3H 3RDTA 2R0KL 1WWAX 4O4YL 1MFDH 5TDOB 2B7DT 2NXZB 3G5YA 4G7VH 5KTEL 2I9TB 4FABL 5HDBF 1AO7E 1K2DB 1WWBX 2JJVA 4UUJA 1SY6A 3P4MA 4WGWB 3ZE1F 3CFKA 1JWMB 1VENA 1SEQL 1KJMB 2MPAL 5ANME 1CL7L 2R15A 4OFPA 1MLCA 3PIQA 5AG8A 4FQLL 1IC7L 5H37H 3L5XL 1FO0B 4NWUL 3VWKA 2YMXL 2ADFL 2LVEA 4BUGA 2MQ3A 3TZVB 3VA2C 4JQVC 4WI3A 3TBYA 2X1PA 4OZ4B 3B9EA 3T8XB 1ZT7B 5EOCL 4PGCB 2LVCA 2DQCL 3WDIA 3CK0L 4GRWB 2CLRB 1B3JA 1QBMH 4DGVL 3BE1L 5D7JA 5DRZB 4I9WD 3SDAD 4WW2A 4V2CB 5F6HJ 3SQOL 3CFEB 3EFFA 1B88A 1GH7A 1P6AB 1R5IA 4BQCA 2PXYB 4NN6C 4ODVH 4ONGH 1FYTB 4KRMB 4XPFL 3U4EB 5FEBA 3MUY1 1VACA 2VR9A 4FQPA 5IMKB 2GJ6A 3VD9A 4JPKL 4WW1B 3CGTA 3KLHC 1IBGH 4H20H 3KDMB 2QQLH 1QSVA 3ZTNH 4XPHL 4JKKA 3QQ4B 4I48A 4MYWB 2NY5L 2FX9L 5DRXA 2R56H 3MA9H 2K1MA 4YDVB 5I1CL 3D1MC 5AG9A 4QHUA 3O2VL 5KN5A 3EKCA 5I16B 4A6YB 4KK6D 1NUGA 2JCCB 2IMMA 1BD2E 3OR6B 4XC1H 2DQJH 4LSTH 5DD3L 5J13C 3WE6A 1ROWA 1UZ6E 4HX1A 3EZ8A 3HMWL 2P42B 1UG9A 3AY4C 3C2AH 1I9RH 5D6DC 2MQ0A 3NH7H 2VLJE 5BVPH 2ZPKL 4KKCD 2R0LL 2XFXB 1JWMA 2QSTA 2E9WA 4LLMA 2Y1VA 4OQ1A 3PWPD 2FJFA 2X1WL 4TULH 2WLYA 2V5RA 2DIBA 4NGHH 4IMLA 4PLJC 3TYGH 1X4ZA 1IC4H 4HUXB 2ATPB 3CH8A 3EYUL 1AR1D 2EIZA 1BEYL 3HPJA 3OSKA 2EIBA 4UTBH 1F90L 4HUMB 3SGDI 3CXDL 2NTFB 1MCLA 3LMJL 1Q1JH 2VXQL 3D48R 3ZL4H 4EI5D 3TZVC 2BHUA 1CG9A 3IDXL 2RFXA 3OTTA 5I6XC 4CRPA 1NGYA 3GSQA 5CD5C 4KPHL 3TEUA 4M1DL 3QDAA 3QXUA 3MSPA 1G6RL 2QKIB 2QEJA 3CFJB 1YN7A 3Q3GA 1EJOL 1Z9MA 3HUJF 1HDMB 5EUOA 2RIKA 4PRNB 5FYKU 4BJLA 4JM2D 1YNLL 1NANI 3KDMA 4G8FB 4Z0BL 1BD2D 5HHME 2J8UA 4JO4L 3C8HA 4TUJB 1AR1C 1S7WB 3RVWD 3KPQA 5FYLH 2DLHA 1JNLH 2BSSA 4LCYB 4S1QH 4FA8A 3VXTA 4DQOH 3R06B 1NCNA 5DJCA 2DQHH 4Y4HD 3GMMB 5C2BH 3FCTB 3VCLA 1ZGLA 1F58H 1YEEH 1NLBL 5T3XE 1VPOL 3K81A 5INCB 4OZHA 3ULUH 5J11C 5C0CB 2YR3A 5DMKB 3MLSH 4Z7VA 4K3EH 1EO5A 4MDJA 3CNKA 1OAXH 2EDLA 3QULA 3PL6D 3GMPA 2WINA 3U6RA 4DEPB 5HY9A 1QHOA 2VN4A 4LIQL 5T1LA 3CUPA 1A21A 3OXSA 1B0RA 3V4VL 4ZQKB 4LEXH 1TJIL 5HI3C 3PDDA 5GGSB 4ORGB 1AE6L 2IEPA 3WS6A 1JPST 3DUSA 3OJ2C 5DR5H 3QXDA 3QDGD 3M1BB 1UVQA 3DVFA 1CLOH 1ZAGA 5IROC 3FQWA 2DQDH 1G7HA 2GYSA 5FA3B 2H32H 3HZMA 3ZMRA 4ELMB 5JW4M 1UACH 4QEGA 5FYKD 1RVFL 3BDXA 1FFNA 4PJEF 3UZEA 5D1QD 1WBXA 1PDKA 1IFHL 5FF6B 1LE5B 3V2AR 1I8IA 1NC2B 1BHGA 3FRUB 2Z4QB 1T4KB 1Q0XH 2EDHA 4JHAH 4PRPA 3D6GA 3SQBA 2F8VA 2X4OA 2C3GA 3MNVA 4WDIB 4XTRD 4ZTPH 1MIMH 1A7OL 2CPCA 4PJ7A 3RPIA 1YMMD 1E28A 1G9NH 1JVKA 3DARA 2DN7A 3BEVB 3BP6A 1JRHL 5KG9B 1XF1A 2W38A 2I27N 3AMKA 3FQNB 4ELME 3O3DB 35C8L 1QSZA 3MJ6A 4I2XA 5I71C 1MQKL 4MCYA 4QKXB 1U36A 4J4PD 3IRPX 4NZUL 4R0LB 3MRRB 4JQXC 1A6VL 4M3JA 3HPLB 1C12A 3VMNA 3VXSA 4LP5A 4I4WA 3MJ9H 4LCCA 3FN3A 3WIFA 3GMPB 5BW7A 4JG1H 4MA1C 4Z5RB 5L7XH 1MUJA 1ACYH 5F3BA 2XKNB 5D2LB 3O6MH 1D5IL 4IBLT 4Y4FA 1WCQA 2HH0L 4JLRB 5EC2A 5ENWA 5TH2A 4M7LL 1DBML 4D3CL 2IPTL 2EDYA 2IADA 1MAMH 3SE8H 3SE3C 1N6VA 1RSFA 4CU6A 2J8UE 5C0GA 2H2SC 1UVQB 5BZWA 5IB3B 3R1GL 4X6BA 1YYLL 2WBJD 4KAQL 5FA3A 2CJUL 3O45A 3TO4A 1XF3B 1JP5A 1J0JA 4DUVA 5C0JA 1GRWA 4M5YH 1QVOB 2IF7A 1I7UB 4N0YL 2UWEE 3EO0A 4JFPB 3MFFA 5IKCB 1WAAF 2Z92B 1S9XB 4OUOA 4WO4D 4KU1A 5EFIA 3CFDB 1U91B 1XR8B 5DO2C 1QO3A 4YHNB 3MGOB 4L4VE 4P57A 1G7MA 4YPGB 2DYPB 5I2IB 2NYYC 2VLJB 5CD3A 3S37L 1VFAB 3HAEB 4Z7WA 4UV7L 4YR6B 3BP6B 32C2A 2FECI 5A3IC 1KTKE 1EAPA 1NEZG 5JQ6H 4PJHA 3IAGC 4MHHG 2B0SH 1OOAA 1BBDH 3R0NA 3S4SG 4N9GA 4G6KH 4LHUD 1IKNC 4XP1H 3WFDL 1HH9B 3QXTA 5GGVY 1CGYA 3VFTB 3Q1SL 3E2HB 2FIKA 3PWNA 5FDWA 4M6OL 4RWHA 4LEOB 3LEYH 4NO0A 4OUUA 4OLEA 4KHXL 5DEFA 5JDSB 5F1SA 2Z93B 1F4AA 3QIWD 3NCCB 4QT5B 3HNTH 4MAYC 3LKRB 3P77A 1HSAA 5C0GB 2W92A 2VIRA 4Y5XA 4APQA 5I1EL 4RMQA 2A83A 3IS1X 1RJYA 2AS5M 3ARFC 3V7AE 3MLUH 2IBBA 1T04A 1W8NA 4B5EA 4ZSOE 2YOCA 4JHBA 4L3AA 4MD0A 4TOYL 2BSRA 3VG9B 3SDXE 4ZO9A 3S34L 2VC2H 2ORBL 3PQYD 2HT3D 4HDIA 4OV5A 5LQBL 1H3PH 1KYOJ 3QWRA 1XIWC 1XGRB 1I4FB 2Z8RA 5DD1H 2IG2H 4MSWB 1MEXH 3QEGL 1IGFL 4XNYH 3RX7A 3CVHH 1CFSA 5T3ZH 1CDUA 1TFHA 3GMRA 3ALPA 3RP1A 5JHDB 1A2YA 1S9YA 2XOTA 5C6PB 4I0PB 1Y6KR 2G60H 5F71A 1UM4L 3T65B 4CGTA 3UDWA 3I50L 3VD3A 3OBAA 3F12A 3RGVA 5B38G 1LO2L 4ORZC 2NY2B 2YPKA 1H3UA 3PQYB 2VOTA 1CE1L 4K2UH 5D7LA 4FTVA 1KPRA 4P2RD 1E4XI 2N7BA 2W0KA 3TBWB 1C5BH 4Q74A 2GJ6B 1D9KB 5C1MB 5ITBH 3IDNB 1U3ZA 4PS4H 1Y0LB 1DZBA 5JDSA 4K07A 2EYRA 1U93B 4GUPB 3UBXG 3IF1B 4PG2C 3TVMC 4JO1L 1W0WB 4UOW1 3GRWL 3SJVD 1G7LA 5GZNC 5BVJA 4EI6A 3QT2A 3DXAA 1UEYA 4IOFD 5GGUA 1NEZA 5C6TL 1T04B 1C16B 5F88B 2E9BA 4LVEA 1GYAA 1NSNL 3NIFF 5EUOE 1S7UB 1OP9A 3MA7B 3QUZB 1SJXA 5GISH 3KXFE 3V6OC 2R2EA 4X6CE 1LE9B 3RIAF 1QQDB 3KG5A 1PD6A 2AEQH 3EHBC 4YHIA 1AHWB 3T0VA 1FN4B 5DJ6B 4NO2A 3QUML 5JLZB 3IYLW 5K9QI 2YUXA 4JREC 3NCJL 3BD4A 4UILH 3MGAA 5CJBA 4ERSL 1KJ2L 2NY3D 3RUGA 5DD5H 5L88L 5HHPB 3CDYA 4L4JA 3VXRB 4FHBD 5IBLC 2BRQA 4GBXD 4GQPH 4HH9A 4R2GC 5AZEL 5JOPD 3ALXA 3RL2A 3QZWA 2ZZUT 3V0WL 5IMLB 2CRYA 3QIUB 5INDA 3PHSA 5JA9A 3I02A 1VFUA 3OMZA 4PUBL 1RMFL 5L8KB 4P9HL 5DK0B 1EMTH 2NW3B 1X44A 2OR9H 2NY4B 4JDVA 1CT8A 1PQZB 2QQNL 4M5ZH 3EYFB 4R4BB 3N1MC 5I74B 5C86A 4FXGA 5IFHH 1CFTB 5HVHB 1Z5LA 4MA3A 1A3LH 3FT2A 3VXMD 4RMWA 4ZXBB 1OM3H 1Z2KA 5E9DA 1F2QA 1KGCE 5SX5K 3C5ZD 1F45A 3SKNA 4ZPVA 5K9QG 4OD2B 2ZCHH 5MENE 3ULVF 1QR4A 2BMKB 1TTFA 3FTGA 4PJ9B 2Y07H 4O2EB 1X5AA 5J11B 4YHIB 5F6HI 1NCUA 4OZHB 5C0CA 2EZ0C 4HUUA 4CW1B 4Y2OA 4BZ2H 5IB1A 5JXEC 1FV1B 5CMAA 3KLHD 3SDYH 4JQVA 4LQ1A 3U30C 2G9HB 5HHPA 4WUUD 3V4UL 4YAQB 4BELD 3GSXB 5D5MB 5DDHA 3IDUA 3IDIB 4MJIA 5C0AD 4CADA 1P53A 4OJFH 2A77L 3BWAB 1KJVA 1GGTA 2FSEA 4TSCL 2PYEE 1N0XL 3C5ZB 3FFCA 3IKCA 4P4KC 4NDMA 1WZLA 2XV6B 5D2LF 3RL1A 3ZE1E 1S8DA 1T0NA 4Z8FH 4UAOC 4Q9QL 1R5IB 4U1KA 5A2JH 2LTQC 2ED7A 4F2MA 4CJ1A 2UUDK 4N68A 1MJJA 4NQDD 5T1DL 4B0MM 4CN6A 2XPGA 1DQDL 4OZGA 2NY0D 1Z3GH 1RZJC 3P9MA 1XT5A 5F8QC 1ZV5A 4F33A 1NGZA 5MHSE 3D2UA 1CFVL 4M48L 1V05A 3W5NA 4YXLH 5C71A 2V2XB 4JG0L 1ZHNA 4QTIH 4WUUB 5IGXL 5E2UL 3KYNB 5ANMB 1IGJB 4YE4L 1YA5A 5DQJB 3LRGA 1JZ4A 4YNYA 1P4BL 4GMSH 4UU9A 4P4KD 2VXVL 1YEFH 4KTEL 1AXSA 1D5XB 4Y1AA 1TZGL 1OGTA 1FIGH 1ED3B 4X9IA 4BFIB 1PG7L 3UTOA 2DWEA 3ZLQC 4NQDB 4GKNB 2AVGA 4PJ8D 5IB1B 1J10A 2VDOL 1TLKA 5E94A 1HH6B 5EORL 1CXIA 1YEHL 3VG0H 5F7HA 3B2UD 1H15B 4V1DD 4IIQA 3WS3B 3TNMA 1QEWB 1RZGA 3O9WA 5EOCH 4D9RE 4L8SA 3EOTH 1FGVL 4LF3B 3S3SA 4D0CB 4LHUG 4NNXA 2W59A 1MFCH 4H5SA 3FQRB 1WBZB 4YC2C 1K8DA 2FLRT 4RWYH 3IDJA 1FNEA 2VRAA 1KOAA 3O3UN 1A4KA 2FATH 2P5EA 3WKML 4ODUA 2Q86A 1MJJB 4LDEB 3I6KB 5CKAA 5EUOB 3T0BA 5AEAA 1IBGL 1J0YA 3GSNL 1NGZB 2R0WL 3UX9B 3RNKA 3TYFB 4UDTB 4NRXB 3VFWB 2VMFA 4X7EC 4HWEH 2NY5H 3QCVH 3U48A 3MRDB 4M62H 4K8RC 1QFUL 3ALWA 4DEPC 3HZYA 4MQ7B 2H8PA 5F7UA 2V2TB 1HHJB 4PIRF 2F54E 3HI5H 4EUPG 3QJHB 3W9EB 2HJKA 3V7AG 1X3DA 3HMXA 1TVHB 4CVXA 3QDMA 3HAEH 4HFUL 5HGAA 3O11B 3VDBA 4PJIB 4JFOA 3VCLB 2J6EH 5D7KE 3VI4F 3B2VL 2A74A 5I6XB 2JK5A 3QFDB 5CGMA 4Z7OF 1YY8B 1DBAL 4P3CH 3NH7L 4QHKI 3ZT7A 4NOBA 6FABH 4F3FA 1MFAL 3RBGA 2IAND 4YO0B 3O0RH 1ZANL 5DJYA 1R5WB 3NZHH 5KOVC 3VFTA 4PP1C 5CIPA 2HA1A 3T0ED 3TYGL 4Y5YA 1X5XA 2GCYA 3PWPA 4H88H 3G04B 1QRND 1N2RB 2I25N 2P5WA 4LAQL 4LCUB 2AXGB 4WGVB 4XHJD 3KYAA 5IHBA 4MLIA 1CBVL 4W4NA 1A9BA 1AKJA 3U7YL 2ATKA 5CS7A 1INDH 2VDRL 1T6WA 2VXQH 3SGEI 3P77B 3VMPA 1A3RL 3PUCA 5DJAB 3IDJB 4IRJA 5ICYB 3NAAL 1QFWL 2CO6B 2FX8H 1EHLH 1C5DB 4ZG1A 3ZTJH 1OPGL 4JPVH 4BQ8A 1G6RH 2XNAB 3VRIA 3UJIH 4QHLB 4UQ2A 3O2DH 3Q6FB 1KIPA 2FBJH 1YNLH 5CZXC 5CEXB 4Z0BH 4XBEL 5IW1B 2X44D 5F7FA 5DF0A 4N0UB 4WFFD 4LLDA 3GJFA 4EUPB 4OGAC 5F7EL 3UJTL 3EGSA 1XGTB 3L95B 1I1YA 3UTSA 1T1XB 1UCBH 5C92A 4J7RA 4OCXH 4YBQC 1QSEB 3LPGA 5HGDB 3PG2A 4S10A 5EIQA 3WUWA 3PJSA 4LLYA 4TVPH 3OKKB 4I0PA 4G42B 3LD8B 4G6FB 1T5XA 3P73B 4DVRL 3DX9A 2YEZA 3QFDA 2IMNA 5K59F 2P45B 4U6VL 3OHXA 4PJ5B 3HPLA 4BK4A 1LD9B 4L3CA 4P9MH 2QR0B 4OB5L 3TV3H 3QXVA 4KMTL 1GSMA 5DJ2A 3SOBH 3KPLA 3L5HA 4UOJA 2ESVD 4LCCB 4LHUB 4O2CA 3TN0C 4NKQB 4OGXL 3TO4C 4QRPD 5DO2D 2ICWJ 3H42L 4KDTC 2I07B 3DVIA 4JLRA 2GT9A 5TE6H 5HDOA 1WIOA 1R3KA 4N90D 1RZJH 3ZKXC 1AE6H 4RNRA 1FFQA 5TF0A 3QH3B 2O61A 3X13B 4K55A 3ROOB 3GSWA 4E0RA 1IM3A 1JGUH 4QRRE 1FVEA 2VLRD 2EH7H 5MERB 2F54A 3BW9B 3EDEA 1U6AH 1K8IA 3OX8B 3RVUD 1IC1A 1OTTD 2BFVL 4X4ME 1NAKL 3T77B 4EQ3A 1N7MH 3RWGA 4JFED 3UPRA 2R1XA 5IJVB 4G6JH 1UA6H 4JHAL 2R1WA 4KUZH 1ZGLP 2JB6B 2J8UF 1TJGH 4HK3N 5LBSL 3DETC 4WNQB 1E0OB 2FJGB 3BSZH 4Z7WB 1XCQB 2ESVE 4G9DB 5F7DB 1KNOA 1RK0B 2GSIA 5JW4R 3FT4A 2WQRA 5GZND 2VR5A 5AAWA 2PTTA 3LRHA 3TBYB 3RVVC 2NY1B 2FZ3A 4ZUVB 2YUWA 4XNUH 1PZ5A 3WBDA 3G5XB 5HVGB 4FFVC 5INDB 1FYTD 2CIKB 3QNXB 4QRQA 4PRDB 2IBZY 2CGRH 4GRWE 3IXAA 3GZKA 4C83B 3PABB 5FA4B 4GG6F 3MNZA 5C0EB 5I73B 4FQHB 5GGTH 4ODWA 3G08A 4HF5L 1BP3B 1PEWA 4A6YH 2GKIA 5IFJA 5DJZB 1DBMH 2IPTH 1EBPA 1SVCP 4E42A 4ZAKD 5BW7C 1TZHA 5CCKL 4WFEE 1LO5B 4YDVA 1MCQA 2E7LA 1YYLH 3JVGC 1KELH 4LQFL 1MFEL 3S36X 2P7TB 5CZVH 5SX4I 1IJ9A 4DOHB 4EDXA 3QIWC 2ZUTA 1AQDA 2DD8H 3KXFB 4K7FB 3WNNA 2WUCH 1CD9B 4UT9H 3F58L 4EDWH 2HRLA 1WISA 5DQ9A 4JVWA 2R0ZL 4PJEB 3EJZC 1VCAA 4MDIA 5CEZL 2A6DB 1YYMH 4JVUA 4IOIB 1KCSH 1R5VA 4CMMB 3S37H 3GMRB 5T1KB 3W0WB 1GZPA 2AV7A 4ZAKB 1YNKH 3SO3C 1XGUA 5F7DA 2W9EL 5EULV 4F37F 3MO1A 4RX4A 4TRPL 2P8MB 1NDGA 3H3PL 4NO5B 4M1CD 1D5MA 4QXTA 4ZO6A 4HKBA 3CDGB 4S0SD 2RGSA 1I75A 2DM3A 5CGYD 3IXAB 3EDKA 5EUKB 3PABA 3WJLC 3J8F7 5SWZB 3MRHB 5D7LB 2XZZA 5I66B 4PREB 5IK3A 4KXZH 1BJ8A 4AG4L 4ONFL 3LEYL 1D6EB 5F9JB 3SBWA 1IEAB 4OZGB 1G7PB 1LEGB 1ZS8A 3B5GA 4NCDA 2M8XA 2Z8VC 2VSDA 3SKJL 4E42B 4JM2F 3EO9L 2AK1H 3NPSB 1VGEH 5JHDE 4NKDB 3JV4A 2W65A 4EUPH 3KPSA 2CR6A 3MUGA 1EBAA 1A22B 2D0GA 5F1NB 1WUNT 3MR9A 3MLUL 4M1CC 7CGTA 3WIHL 1F00I 4TOYH 3BP7B 2YZ1A 4MAYA 3WNMA 4K7FA 2OQJB 2ZSVA 3OKNA 3NPZB 4LCIL 1QA9A 4TUOB 5DJ6A 4UAOB 1U9KA 2VB5A 3D85A 1FL3B 2JTDA 5D1XB 1DQML 2HVKA 5ADOL 1JIBA 4PJFF 3VXUE 1AFVL 7FABH 1JF1A 3G5VB 1A1MA 4BZYA 5TGBB 2JB5L 4KMQA 4U7SA 1K3ZA 5T3XD 4UINL 3I75B 3JV5A 1LP9F 2APBA 2QV2A 3O4LB 5FIEA 4X6CF 4FXLA 4PJBE 2D7TH 3DX6B 1X5YA 1OW0A 5GGSA 1F13A 4HKBB 4AM0B 2J4WL 4X4YB 1LO2H 1WBZA 2Y9RT 2G2RB 3MV01 1P2CA 1ZLVH 2ED9A 2P5EB 4J8RB 2Q87A 1T20A 3HZMB 4AZ8A 1Q9LA 3B5HA 4MA8H 3KYOB 4P4RB 4Z7NE 3MBXH 1MHCB 4X8XA 2C3HA 5D7JC 3SDAC 5LXGH 1UZ8B 4OZHF 1C7TA 3UMTA 2WWMD 3ES6B 5FHBL 1ZSDA 2FB4L 1CDYA 1IGML 3GRWH 3NCYP 5H94B 2XWBA 3GNML 3KR3L 4KRPB 4Z0XA 3MOBH 1A14L 2E27H 1DE4B 4JGUA 5FYKE 5C0BA 2DQGL 2PYEB 4NKIL 4ISVA 4PJ7F 4MAYB 3FB5B 1KBGL 2HKHH 2VTFA 2OQJA 3VFVB 1XF5A 4JFOB 4AENA 4Z7QF 4OZIA 5CD5D 4KVNL 1OB1A 4PB0L 5FM8A 1PKQA 3DGGB 3QUMH 4PLNC 4IRZH 4F3FB 4IJ3B 2YC1A 3IFNL 4HWBL 1ZWIB 5GS0H 3EJYD 2HLFC 5MEPB 1QP1A 1OSZA 2EH8L 3G5VA 3GUTB 1CE6A 4MJID 5C0AA 3SDAB 2XKNA 3RWJB 4DK6A 1A1NB 3ULVH 1YECL 1GPOL 4GT7A 2HAZA 3U9PH 4IDJH 3AS2A 5CJQH 2IADB 1WV7T 2IQ9L 2CK2A 2XACC 1UJTA 1QSFE 4NDMB 3L5WA 2EICA 4MNQD 4QWWD 4Z7VF 5C9JB 5J1AB 3K4ZA 2Z8WC 1MCKA 5BZWB 1E4WH 5DJXB 3L3GB 2VL5A 4JHWL 4OCWH 1C5DA 3QFJD 3DROA 2AJYH 3DRQA 2DLEA 4TSAH 4TVPD 4LMQI 3AXLA 4GAJH 1HCVA 4M5ZL 1SEBA 4YHML 3VRLF 3QIUD 2P8PB 3BPCA 5IG7A 1A0QL 2X4TB 4G5ZL 4S2SA 4HCRH 5KVFL 3IS0X 1QBLL 1WF5A 4OZGE 4MJ5A 1UM6L 4WEMB 1KLUA 2CKBH 3O6FD 1KCRL 1MJ7L 3W9DA 2Z8SA 5SWQA 2Y06H 4OF3A 1ZA6B 5C08E 3CFCH 4N9OB 4NBYB 2VQ1B 2ZCHL 4DTGL 3AAZB 4ZFFB 1BX2B 5J9PA 3RVWC 1OHQA 1XF2B 4NRYB 4NQEE 3MPCA 3WV0A 5DD0H 3FJTA 1GOFA 4IDLA 4W6YB 1U8PB 3BP4A 2AJZB 1RIUL 3G9AB 5BOZG 3SDYL 5IESH 2WANA 1QSFD 4GKZB 3BZFA 4IJ3C 4C56E 3RWJA 1CL7I 4NQEB 4QXUH 1F6LL 2FD6L 4L9LB 3O9WB 4G6AD 3MCG1 1URLA 4TSCH 3JSSA 4WV1C 1R3KB 1ZA3B 3QRGL 1CI5A 3WHE0 4DOHE 3TT3H 5HGHA 1QPPA 2DKMA 1RIVL 4X6DE 3LKPB 1OP5H 3GO1H 3M1BA 3M8OH 2D7MA 4APQB 5KS9B 5IQ9A 2F54B 3ZDZE 1L0XA 4YDIL 1FL5A 5GPRA 2C1PA 3H9HB 4L3ED 2BOBB 3IDMA 4ALAH 3VW3L 5C7XH 4I5BA 1K6QH 2YA0A 4PJGB 1MFDL 1ZT1B 2CUHA 3IVKB 4GW4A 5E2JA 3HNVH 3MBEB 4M02A 3DNKA 3GMLA 4G7VL 4JY6A 2MNUA 5KTEH 1JHTA 4S1SH 1NMAL 3ZT5A 3GKWL 1UWEH 4MWFA 5J1TC 2V2TA 3OAUL 3P3YA 4NQED 5D1QA 5JOFB 1IILE 1NFDB 1SEQH 4ZSOA 2OM5A 4XHJC 5FO9B 1UEMA 4D0BA 3L7EA 3IXTA 5AYQA 4RGMB 4CVXB 4JE4B 5EBWB 4MVBD 1LEKB 5AUMA 4KTDH 4L4VA 1KB9K 1FHGA 2ADFH 1HOCA 1Q8MA 1TZGH 1T03H 5EO1B 3Q5TA 5FK9A 4R4NC 2KQNA 1JMZA 1SYSB 3MRGA 1S9WB 1XH3A 3GMNB 4JFYB 4Z7WE 1JGEB 4HJGB 5HYJD 4P2RB 5IB4B 3VI3E 1B4JH 3BZFB 1RZKC 3S36L 4BH8A 2GCYB 2JJSA 5DVOA 2VUYA 4HV8A 1IC5L 1F11A 3BO8A 1OT2A 3BUYA 2LAGB 5DJZA 4PY7B 2DBLL 3HZKA 1QYGL 3L1OL 3V5KB 4PGJA 5LGKA 3U36A 4YBQD 3QDJA 4PTTA 5FV2A 3LPWA 5JMOC 4V1DB 4KROC 3MOAL 3PWJB 5FGCE 1CYGA 4FN0A 4L9DA 2EKSB 3LZFH 1M71A 1IE5A 4U6HB 1VGKA 4PR5A 3D3VB 4JFDE 2P7TA 3BKJL 5BJTA 3TESA 5K9OA 2FECL 1GGIL 1NCBH 1I9IH 3CSPA 4GW4B 1FJ1B 2W1NA 4XC1L 5JIKA 2BC4B 1U95A 5KJRL 3HG1E 4LCWA 1F4XL 4ODTL 4JEGB 3HMXH 2MOVA 4EUPA 1JGVL 4PJEA 1Y18A 4NQCB 4OLVH 3L95A 1NCAL 4JN1L 4TNVK 5HPOA 5CINL 5FO9A 3LEXA 5KVDL 3FQXA 1MLCB 3AB0C 4HUNB 4IM8A 4Q9RH 4TULL 5B8CA 3D9AH 4HFUH 3ZKMD 3FONB 1BJMA 1IC4L 2BCKB 3CMGA 5TE7H 4K23L 2J6EL 5DXWA 2YBRB 3B2VH 4OGAD 5EZOL 2ADGA 3CXDH 5GRVL 5IF0A 3ARFD 2V5TA 4CBPA 3TN0A 5DRNB 1CDGA 1H8NA 4M8QA 5E7BA 4JFFB 4U1IB 5FUZH 1ZANH 1Q1JL 1OAZH 4GXUN 2AXFB 1MHEB 2HMIC 3L9RA 1T1WA 1J5OL 4NM8H 3LN9A 3UAJD 4JHZA 2R2BA 4JFXB 2ENSA 2X42A 4JB9L 3ARDD 3IETA 4LSRH 2GT9B 3CX2A 2OSLA 1MCRA 2XTJD 1H3XA 5E9DD 2Z93A 2DKUA 2OXGA 3QFJB 4RGNE 3T3PE 1WFNA 4I48B 1A3RH 5IFAH 1EIBA 3RWFB 3V95A 4U1SA 1CS6A 1QFWH 2CLZB 5GXBB 2FX8L 5C0FB 3L3HA 5ACZA 1HZHH 2HJLA 4LLWA 3V6ZA 1BFVL 5DLMH 2OJEA 4LBEB 3VFSA 4BSVB 2HJFA 4XPAL 3AVEA 1EEZA 2HTKC 1ZLWH 4MD4A 5M94B 1GGCL 3WEXA 1YN6A 3WE6B 3RGVD 3TCLA 3VXOB 2Q6WB 1NPUA 3NFNB 3MGTA 3K1DA 4XZUB 2EC8A 2AV1A 1XGYH 3MLSL 1IAIL 4NQVB 5CP7B 3MRPA 1SJEB 3MJ7B 3FO9A 4G8GA 2AK4D 5FOJA 4NNYB 4HIXL 4YGVA 3QG7L 2GJZB 1EX0A 5GJSL 1WEJL 4KUCF 4OAWA 5F96L 3KPSD 3FN9A 3LQZA 3D0LB 5A2LH 3MV7D 3OKEB 5AZ2H 3PWUB 5DDHB 1MI5D 4Q2ZB 2Q76B 2NTFA 3FMGL 3KYKL 3F7QA 4G9FB 2X9WA 3REWA 1N5YH 4QRQB 3EOAA 2R1YB 1RV6X 2ZKHH 1I85A 2FCBA 3L9RB 4R90L 3BPNC 3E8UH 1I1AC 3DTXB 3RQ3A 2HFEB 4WU7A 3H42H 3RVVD 3TBWA 1V7MH 3MRFA 4K94L 5TE6L 3IFPB 2VDNL 3QDME 2AK4B 4Q0XL 4UT7L 2LU7A 3D2UB 1MCBA 1LP9B 1PLGH 4NRZA 3F6IA 1HQRA 2VKWA 1J88A 5FM5O 1KYOK 2XWBB 2I9LB 1JWUA 4ZTPL 4OCRH 1MIML 2VYRE 3U46A 4HLJA 1U3HC 1TPXC 3QEUA 4RRPA 4MD4B 2UVFA 1AXSB 3KPSE 4WRLA 4HIEA 2HKFL 4YHOL 1MWAA 4GH7B 1OGTB 3MRKB 4XZUA 4XCYB 1AHWA 1G9MC 5MP6H 4GG6B 3P4MB 1TJGL 1TCRB 1KT2B 1HSBB 2ZOLB 4PJAF 2BVOA 3Q6GL 1MJUL 5GRWA 3ELAT 3C5JB 1G6VK 4JG1L 2V9RA 4RX4D 4AIZB 4W6XB 4QHMB 4XAKD 2NY2D 3CMOL 2DICA 3O3BB 4IIQB 3WS3A 2EDJA 3O6KL 1K5NA 2P8MA 4XVUC 2PR4H 2EKJA 3RA7H 1OF2A 2X4RB 5IMLA 3SE8L 1A7PH 1YJDH 3FZUC 3I02B 4RQQA 5T3XL 5IVXB 1M4KA 1FH5L 4PREA 1FYTA 3DROB 5C0RH 3MCLL 4C56A 3BT2H 3INUL 1ZLSH 1CT8B 1PQZA 3P0VL 4BKLB 4KXZI 5I8EA 5A16B 2OP4L 4NO3A 4FXGB 1UH4A 3WLWD 3CCHB 2X4TA 4S2SB 4P3DA 3AY4A 1YNTB 5CCKH 4QF1B 3MRDA 4FP8L 3B9KA 1XZ0A 4Y4FD 2FJFB 2VZUA 4O00A 2I9LA 1T1YA 2A1WH 2M1KA 4Y88A 4KK8C 4KVCL 5CZVL 5FUOL 1JZ3A 5D7IA 4H1LA 4Y4KD 3U9UB 1RULH 1P69B 3VFUB 3T09A 4G3YL 1ZXQA 4C54A 5MEQB 4JRXA 4I2XB 4UT9L 1WFOA 4M03A 1Z0MA 3LB6D 1ITCA 4ZDHA 2NX5B 1MVFA 1NKOA 4MCZB 4FQ1H 3D0VA 3HTLX 1BQHB 5ID0A 4M6AA 1DUZA 1GVIA 4FQXA 5EU4A 3C2SA 4FFWD 1QNZH 1A6WH 2GQHA 3IDIA 4MJIB 3V5HB 2R8SH 1K5NB 4Y4FB 3EZJB 2LAAA 5TH2B 3VXSE 1ZA3A 5T1MA 2YKLL 1DDHA 1PX3A 1HNGA 4WWKC 3T04D 4UQ3B 1M7IB 1D5BA 1RJCA 5KSBF 1O5DT 5HHOE 4EVNB 2AXJA 3ZDXF 3NCEB 2OK0H 1WZ1L 4HG4J 3TJEH 4YFLF 1ZHKB 4ONFH 3WLBA 4CVZA 3UTTB 4PRAB 1KCUH 4JRWA 3VRJB 2FIRT 2X4PB 5T5FH 3Q6FA 1JBJA 5CEZD 2NZ9D 4JRYB 3EO0B 4LLVA 3GMLB 4PJBF 5DTFB 5DMKA 4JO3L 1IRAY 2V2XA 2R39A 1T80A 4LLDB 3G6AA 3L5IA 4CAGA 2BVPB 1S7WA 1G7MB 3QEGH 1MEXL 2E7BA 3WUWG 2FR4A 5DQJA 4XNXH 3P0YL 3BKYL 2XICA 1NAMA 3FOLB 3ILQD 4YHPA 4RDQF 3WIHH 1DUYA 3WIIL 1G7IB 3DYMA 3PJSB 4KJWD 2MCG1 2VZOA 5ISZB 3BUTA 4LCIH 3VXRE 1H8OA 2HN7B 1SYSA 3NIGF 2WP3O 3DUSB 4Z7VB 2O5ZL 3UTTD 2BXYA 2QQKH 4XMKL 1SY6L 2ICCA 1MLBA 4XWGH 3H0TA 1MY5A 4HFWB 3AREC 4K2UL 4ZD3H 5EA0L 4Z6AT 4D2NA 4XMLL 3UO1L 3VXQB 4UNUA 1FG2A 1L6ZA 4ZUSB 3HZVA 4LGSB 3B8YA 4PS4L 2F74B 4CVWA 3LKQB 1LP9E 2R4SL 2VLRB 2GTZA 5FUCC 3RNQA 5C9JA 3MRNA 3A6BH 5I1HL 2J7LA 4OD1H 3MLXH 4PRIA 2D9CA 3UROR 1YC8A 1LO4L 4U31A 4BZ1L 2W91A 4R9HA 1UKTA 2YUZA 5C2UB 1OL0A 4NCC2 1QKZH 4QWWC 5K93A 1E4KA 2OX5A 5HI5C 1P7HL 1RD6A 3OGOE 2DDQH 4G9FE 2IPKA 3H9ZA 1IGMH 1TXKA 4TYUA 1GGYA 4Y16A 1P4LB 5BRZA 5C8JA 1GIGH 2JKXA 2IANE 3F7VA 2A0LC 4KKAC 3SJVB 4JFEE 5I1KH 4PJCA 3GK8L 5C0BD 1I7RB 2JJTA 2YPLE 4YDKH 3CC5B 2JE8A 4X6CA 1W8OA 3RWIB 2IBZX 2CSPA 2ICEB 5I8CB 4X4ZA 1Q38A 2AJZA 1YEDA 4XP9L 4LNRA 1KB5H 1N8ZA 4MZ2A 5EU3B 1MSPA 4FQJH 1NBZB 4XCFL 4JDTH 2W0LA 1F6FB 4UTAL 3G08B 1GPOH 5EU5A 3SO3B 2QQNH 5EG6C 4GXUM 4HK0A 1OAYL 2ATKB 4XH2B 1FAIH 2VXUH 1OP3K 3ZKMC 3OB0K 5EO9A 1MAJA 4W4OA 2NY6D 3MYZA 3S88H 5FO8A 1RZKH 3N9GH 4MQXD 2B4CL 3V0AC 3L3HB 1VFBA 2HJLB 1D6VH 4OTXH 2AJYL 2BOBA 3BHBB 3IDMB 1EEZB 1JZ5A 4Z18A 3LV3A 1ZLVK 1PGRB 4MNQB 3T2NL 3GSNA 5BOPA 3ARWA 2R2EB 3FRPA 3MRQB 4F7TB 4R6UA 1KJ2A 4HGWB 5JLZA 1G7QB 2WBJC 1X5GA 1KCRH 1MJ7H 5H37G 4Z77A 2BX5A 4QY8B 3ZKND 3T08A 2UUDH 2VLKE 4ODXB 2JJWA 1TVBB 1VFAA 4L8BB 2DRUA 2H1PH 2JELH 1OLZA 5F6IB 1A4JB 3ARBC 1FO0L 5BS0B 1HHKA 4LMQE 5B8CC 4R2GB 3C87A 3N1FC 3WFBL 3RWIA 3LKSB 3EYQD 3N1PC 5CJOL 1WLHA 1B9ZA 3JWDL 1N0XH 1UM5L 5EZIH 2OMBA 5IP4A 3C09B 3MRJB 4POYA 2XXCB 5IB4A 1GAFH 4JFFD 2EYTA 1EFXD 1IZKA 5SWZA 1RUPH 4D8PA 1A6TB 1A7RH 5HHXL 4R4ND 3O2WH 4LKCA 1CU4L 1VACB 3BH9B 1DQDH 2CXGA 4TTGA 3TO2B 1R3LB 1ES0A 1UGNA 5DA0B 4WWKB 1ONQA 2AJSL 4M48H 5DZOA 5F1OB 5B3JE 4HXAL 5E1HB 4UB0L 1U8MA 4ENED 4R8WL 4QTIL 2J8OA 2W65B 2XFXA 5FO8B 3M8OL 1FFRA 1NGWB 1B0GA 1U92B 3VGAC 3ZSTA 3UTPE 5E08H 1JHKL 1U8KB 3U46B 4X7CC 4GMSL 3BP7A 1N6UA 4P2RE 3NGBB 1MCSA 3V6FA 1AGCB 5KVEH 2XWTA 3MYJA 4HLZH 4U1LA 3BN9C 3VXNB 3WHXA 5IJKC 1WWCA 4CW1A 4Z77B 3AM8A 3E3QC 3MJGX 4IHOB 5CEYB 4I3RL 3VG0L 5HHOA 1JZ6A 3IDNA 3MACL 3WCYA 5DC9B 3LKSA 5LGHL 1KJVB 1VHPA 5IF0B 3HE7D 4GUPA 2GI7A 1BAFL 3PWPE 1KEGL 3U82B 2LQRA 2VUOA 2GITA 2IAMA 1M7DA 1MFCL 1D3CA 4OZFG 4C83A 3PWVA 4J2XA 3WSQH 2Y25A 4HHAA 5F7NC 4HPYL 3RWDA 3I6LE 3JTTA 5E5MB 4OFYA 4GJTB 1KEML 5F89A 4RFNC 1HHHA 1XIWB 2H26B 3FFCE 1G9NC 2YWYA 4IOSD 5IEHA 4BSWB 3GSNH 4G8FA 4QOKE 4NO2B 4XBGB 4P3DB 4UBDC 3QO1B 1IGCL 3ARGC 5GS1C 4DAGL 4DN3H 2NPLX 3MOAH 2KH2B 1IGJA 3LQMA 2VDML 3HI5L 2DTSA 2BSSB 2PKDA 8CGTA 4I0PC 1FPTL 5J7CC 1QOKA 4X80L 4LOUC 5D7IB 3JV6B 3VI4E 1DN2A 1BREA 4HWUA 1AQDB 1F3JB 3KXFA 1GC1L 4ODHH 4GLRI 1LE9A 1U3HA 3GIZH 2BHYA 1A5FL 1ZTXL 3HMXL 1S9VB 3MV7A 2DQUL 4ZDHB 4U33A 1QR1A 1S3KH 5D71H 4XAWL 1VEOA 4HUWA 5CINH 5GGVH 4R4FH 1MCWW 5CSZB 2IPUK 3U4EA 1I3GH 3JWOC 4Y1AE 4X6EA 4XP6L 2VSCA 1KGCD 1CXKA 3NA9L 4WHYH 1S7XB 4L5FL 3GHBL 3OKEA 2X7LB 3OXSB 5C6WH 1E4KC 4LAQH 4UIMA 4L1DA 3TVMA 1EO8L 1GOHA 3VA6A 3CSBA 1WZKA 2ZUUA 3GDBA 5B3NA 5FUZL 2VDRH 3QNYB 1FVCB 1ZHLB 3HCVA 4JZOA 2MHAB 3OF6D 3OGCB 1YEIH 4P23B 4MXQC 4WEBH 5C09D 5IBLD 2DJUA 1CTOA 2GAZA 3DRQB 1AC0A 3JTTB 3FQNA 5KW9L 3HLAA 3GSRA 3SCMD 3KYMA 4WUUE 3OKMA 3DIFA 3E6HA 5T3ZD 5DFVC 3T0EB 1RHFA 4NRXA 4HUUB 2P49B 4B41A 3HFMH 5F7EH 2MKLC 4M6NL 5HHNA 3UJTH 2EDBA 5JXAL 5C07A 3WFHB 3W9DB 4IMLB 1AXTH 4N1CA 3O6FA 1UCBL 5C9KA 1BD2A 5F7MC 3DBXB 4U1MA 5E00B 2D7NA 5KG9A 1N4XH 2BZDA 2RCSL 3SE4A 4MXVE 1IARB 3QI9A 3QIBC 4YHZH 1AGEA 5GGTA 1YY8A 2BNQE 3RZCB 3VGEA 3RKPA 1BFOB 1U8PA 5IB3A 4P4KA 5L2JA 5E2TL 4U1KB 4HIXH 1MLBB 3MX0A 3MRBA 5KSAC 5F96H 5TGBA 1DP0A 4X6EB 3CFJA 3MQIA 2FYYA 3TO4B 4JFEA 2H32B 1YC7A 4X9BA 3NABL 3CZFB 3A6CL 2YPLA 3QNZB 1MFNA 4P99A 1CR9L 1U3YA 3RKDD 2P24B 4AIXA 1UKQA 2A6KB 2FSEB 4XP4L 3VFGL 5IHZA 3RWHB 5K9KB 4M1GL 5ESVB 5E8EA 1NKRA 4AM0A 1DQQA 2VLRA 4E5XB 3RU8L 4TNWK 4KMLB 3C60C 4RA3A 4K8RH 1RURH 5CJXA 2GW5A 4HIJB 4IS6A 1A7NH 1SJHA 3FOMA 3GHEL 3GMQA 4NN5B 1I8KA 2LU3A 3MROB 2W9LA 1T20B 2P5EE 3QDJD 1UXSB 1D5XA 3F6LA 2I5YH 4QHLA 5A16A 3UPAA 1NAKH 4PJHB 2EDFA 4FZEH 1MJ8L 4Q0XH 1N7ML 3C08L 3CCHA 2BY0A 4J3VA 1UA6L 5EFIB 1KC5H 5GS3A 1QO3B 5JPMA 2UZYB 1WITA 4ZFZB 3LS5H 3RKDC 3BQUD 4LSVH 2ARWA 3U6RB 5FO7B 3JV0A 5HPMB 4LEOA 1BZ7A 3F7RA 4JANB 4MMZC 2WWMC 4X8JA 3RIFK 3D25B 4K71B 5E8DH 5KOMC 1HXYA 4W81A 4YHOH 1J18A 1YMMB 4NNXB 3BMWA 3PGFH 4XNUL 4X83A 1BFOA 2YC1B 2VIRB 1G7JB 2Y23A 1A4KB 1DUZB 1BMGA 4HUKB 4OFVA 2AEIT 4OI9A 4RGOL 1Q72L 2FYYB 3M17A 3DSNA 2BY1A 5GGTL 1H15A 3AGVA 1NCTA 1BQLL 4HF5H 3QJFB 3I3EA 2MWCA 2P5ED 3ARBA 3UPCA 1IM9D 4JPWH 4KI5E 5BXFB 3BPOC 4GMTH 4JZNA 4WCYL 4M7KL 1KCLA 3U2SA 5A1AA 1IM3B 2AGJH 2R69H 2BDNH 1KELL 4J23A 1MFEH 1M71B 3CU1A 4U6HA 5JHDA 3GJEB 4QRSB 4LIQE 4HG4K 4KC3B 4F15B 2YPVH 4H0GA 2P8PA 4WFHD 4XC3H 1IQWH 3RNKB 3TYFA 4AEIH 4LLVB 5KBNC 4MQTB 3BZDA 2X4SA 1P4IH 1A1OB 2H8PB 5CEZH 2QSQA 1YYML 2YSSA 1JGLH 4Y5VC 5KSBE 4Y5YB 4HKJA 4WO4B 4HC1H 2AJ3B 3TA3A 4DVBA 5B8CB 3QA3B 4KKLD 5D2LA 5DURD 5MI0B 2HLAB 4AT6A 2ADIB 1AKJD 1TDQA 3RX5A 3ULUC 4LSPH 4LCUA 1H3VA 4NBZB 3MLZL 4ETYA 2F53B 4TRPH 1L7IL 4AEHL 2HN7A 1GGBL 4F58L 3QXAB 4Y2DD 1C7SA 4NZDA 1KCKA 3MUHL 4PD4K 3CVIL 2A9ML 1EA9C 1R5WA 3WFZA 4WI7A 5DVLA 4KI5D 5KSVB 3QR2A 3ZE2F 3ARDB 1REIA 4JM4L 3QDGA 3VFPA 3HC0B 5DI8B 4GXVL 4JY5L 1T21A 4E41B 4AG4H 3W5MA 4R7DA 3K46A 4WTZA 5CEXA 4NC1C 1IM9A 2Q8AL 4GQ9H 4I77L 1K2DA 3NTCL 3EO9H 2GTZB 4WJ5A 3NN8A 5IB5B 3U2SB 3ULUD 5LVEA 5DZNA 4O9HL 3O9WC 5K9JL 5BZDB 2OK0L 2P1YA 5HJ3B 3T4YA 2UZXB 1XAUA 3LEVL 4PJXF 3FB7B 5T5FL 1HIMH 3QHZL 3IVKA 4FQIL 5EU6D 4PB9L 4QRTA 4D9LL 3D39B 2D4DA 2VXSH 3Q5OA 1KPUA 5F7KC 1HINH 2YD8A 3BFOA 4APQC 1U3JA 3C60B 1XGTA 5E8NA 3VWJA 5ADOH 3WO4C 3DYPA 2F5BH 3BDYL 1AGBA 3QO0A 2NXZD 3RUGB 4LCWE 5F9WC 5DS8B 1NUNB 1DBKH 4U7MA 3AU1B 4XVSH 1CFQB 4F37K 1LQSR 2Q76A 1NDGB 1Q9KB 4KY1L 4NO5A 4XB7A 4Q6IB 4UIKL 2O5ZH 2ZCKL 1PJ9A 3REWB 4S1DC 4IMKC 3BPLC 3NIGE 5DJ2B 3BZEB 3OWEA 4MS8C 4LNRB 5D72L 1P5UA 3KPRA 4X0KB 4LL9A 4OZFH 3S6CA 4LRNL 5DJDB 4Z7NF 1DFBL 3UJJH 4XMLH 2AJUH 1R3JB 4APQD 3T1FA 1LO0H 3HC4H 3WXVH 3BQUA 2B2XH 4M6MH 4Z7UF 3RWGB 1T7XA 1HHHB 2H26A 4JFDD 3MBXL 4NHCL 4HBQA 3N85L 3RFZC 5HBBA 2UWEB 4RNRB 4XBGA 1CLYL 3G6DH 2JB6A 5FYLE 2V9TA 3QDJB 4NO0D 3QAZC 4NQUA 4OD1L 4D0DB 3MLXL 2HFTA 1VFBB 5FDYA 3QIWA 4BZ1H 1JZ2A 3ARYA 1A14H 3KPTA 4J4PC 5ESAA 3LS4H 2HG5B 1FJ1A 2XY2A 3SO5A 2NY6C 3RAJH 1I7TB 1DL7H 2QQQA 4PJ5E 2DDQL 3ARXA 4HJJH 3PWLB 4JJ5B 4KVNH 1NGXB 4PB0H 3BGMA 1QR1B 4RRPG 1V3MA 1HSBA 2R9HD 4HWBH 4ODXA 3PP3H 3TIDB 5CSZA 1NGYB 3GSQB 4U49A 3C5JA 15C8L 3P40A 2Q3AA 5FYJE 5I1KL 1KNOB 1F4YH 2C26A 2XQYK 4KRPC 5E6IB 3CDFA 4WENB 1RZIB 2QADB 3QEHA 2EYRB 4GRMB 2YD2A 2FZ3B 3TF7C 4MAYD 8FABB 1CD0A 2XN9B 3PXJA 1CIUA 4OCSH 2J2ZA 4NQSB 4NN7C 3KPRB 4GBXB 2OS7A 1MFBH 4JPIA 4DKAA 3N06B 1FZOB 3MNWB 5C0AE 2XZQL 4CNIA 2A6JB 2DI8A 3BN9D 3EYQC 5HHMD 3L6FB 1CLZL 1AO7B 2K3TA 4JGMA 5I1GL 3TH2T 3D3VD 4OZGF 1S7VA 2VXUL 2B4CC 4MDIB 1DVFB 1ZHNB 1FE8H 3RWFA 5E2VL 1UM6H 3V0VB 3N9GL 2B4CH 1MRDL 1SBBA 3HRZA 2CKBL 5H94A 1HNFA 1D6VL 1FZKB 2Y5TA 3X17A 2H2PD 2HJFB 2DMCA 3OKDB 4MNGE 2AJXH 2ED8A 4TSBL 3S4SA 4QYOA 2ZP0T 2WSKA 3FO1B 4OKDA 2E6JA 3DRTB 5GRUL 4XBPA 4Y19D 2X09A 3K8KA 5BMFH 3BJ91 2RAMA 1BVKB 3DWTA 1K8DB 4I0CC 3ARRA 1MHPH 3D0VB 1HKLH 1RJLB 1FDLL 1EZVY 1R5VB 2PXYA 1RJZB 5JW4Q 4IHOA 2YS4A 4L4TD 5EU4B 2JELL 3ZE0F 4X7DC 2QHLA 2DM4A 4X7SL 5E70A 3GB7B 1LEGA 1G7PA 3KPPB 1HHGA 3OZ9L 4Q2ZA 4P46B 3SBWC 4X6DF 1LGVA 3QQ4A 2F58H 3DHMA 3FRUA 1UM5H 4PJBA 3KWWA 5I75B 2DWDA 5DJ0A 1R24B 2IH3A 5E9DB 4YHLH 3GO1L 1OGAE 5BS0D 3TLRA 3IFLL 1PY9A 1RUPL 2IH1B 4RSVA 3GMQB 1SJHB 3FOMB 1EERB 4PJFA 4ZYKB 1I8KB 3TPKA 3LOWA 2FH6A 4P23D 2HT3C 3O3DA 3AXLB 4ALAL 1IEAA 1Z9OA 2AK4A 2ZG1A 2ZJSL 5ADPL 1NFDF 5EBGA 4HIIA 3WL9A 4S1SL 4LPTA 1OAQL 3G6AB 5CILL 1UWEL 3MUGB 5L0QB 2Z9TA 1CDIA 3FN0L 4PV9B 3O3EA 3WDHA 4ZNEA 1OAUL 4PJAA 2R0KH 4TN9A 4CADB 3NACH 3C60D 4CMHB 4DZ8B 5KVEL 4Z7WF 3FFCB 5DHYB 1MI5A 1BWWA 2BVUA 3MV7B 2PN5A 1OSPL 3ECBA 2BK8A 1RK1A 1JPTL 1I1RA 1KT2A 3I2CL 4EBQH 3ZE2E 2ZOLA 4GG8B 4C57C 4F9LA 3RZCD 4YX2L 1WAAA 4LU5H 2XNAA 4FFYH 3VRIB 3BPNB 2YMXH 1HDMA 2VH5H 4KZEL 5FB8A 4O2FA 3UBXB 5CZKA 4TUKH 1BPVA 2DQCH 2DBLH 1BF2A 2VLLB 5D2NA 2H9GB 3QNYA 4RDQG 5T5NF 1Z6JT 2QHRL 5L6YL 5DHVH 3FO0L 5KS9A 1QRNE 4ODVL 1W72B 5ALBL 1G0DA 2NXYD 3H3KA 4AENB 3OKMB 3IU3B 3JWOL 1QBBA 3MRMB 2P48B 5FXCH 4PGZA 1ED3A 4DN4L 4ELKA 3GIVB 3DXAE 2HFGL 1EK3A 3W11C 3L3DA 4NJ9H 3TBTA 5DK2A 5I1CH 5IW6A 4DN3L 1INQA 2OTPA 4LHUA 4O2CB 4M7ZB 1HEZB 2FWOB 4PG9B 1XFPA 5DMIH 5HY9B 5KVDH 1GC1C 4XCEA 3KPRE 1SHMA 4LPWA 4NNPH 4Y89A 2N56A 3QFJE 4RGNB 5FOBA 2XN9E 1JHLH 3HUJE 3X11A 3P73A 1YUHA 2Q8BH 2OZ4L 1A5FH 1ZTXH 1P1ZA 4OZHE 3V8OA 1XH3B 4XMPL 1S3KL 3RZCA 3QXAA 1TIUA 2ZPKH 5FGBC 5DVNA 4GG8A 3WFEH 1RFDL 5F1KC 1ZWIA 4PBVC 5EU6A 3D18A 3MRBB 5HYSA 2C7UB 3S5LB 4Z7UE 4ZPTA 4FQQA 5L2KE 3GHBH 2CKBB 4R97B 3HI1A 2A6KA 3GBML 3VJ6A 2A9NH 5IT2H 3F5WA 4N5UA 2VLLA 3LRSA 4KKLC 1E4XH 3L3JA 2X4OB 1ADQL 1TNNA 1JGDB 3QIBA 4X6DA 4LFHG 3QJHA 1D5BB 3W9EA 4N8CL 4WEBL 5A2KH 4X98B 5JR1H 1HZHL 4PJ7B 1E28B 3BW9A 1B4RA 4LPYA 4WW2C 5DLML 1ZHKA 1NFKA 2B1HL 3KJ6H 1OVZA 2KL6A 4NM4H 1EJOH 3DOSA 5K9OB 3SGDH 3Q0HA 3T77A 3OKOA 3PL6A 1EEQA 2FNBA 3MXWH 4QRRD 2R1WB 2W60A 4PJ8C 4UOW0 5FYLL 1IGIL 4QY8A 5IV2B 4S1QL 3DV4A 1AXTL 2G5BB 3QG7H 3BEWB 2FL5B 1WEJH 1DUYB 5EBLB 5JUEL 5EC2B 3IB4A 1JN6B 5TJWK 4EN3D 5C09A 1FSKB 1AKJB 1EXUA 4PJEE 5FYKL 3X3GH 1P9MC 4X7FC 1PBYA 5DQDL 4ZUWB 2IWGA 1I9EA 4YXKH 3TN0B 3MRJA 2P43B 2PW2A 5GRJL 3GSUA 5ESQB 4G8GE 5GSRA 2NLJA 4UDUA 2AXFA 2ZKHL 1W0YT 1C16A 5F88A 3BZ4B 4NFBA 3NABH 5JZ7C 5IQ7H 3QUXA 3V4VH 1I7UA 2VDKH 3IETB 4K94H 1TJIH 4DW2H 2F74A 5J6HB 5DQ9B 2C4FU 1IEHA 3E0GA 4QRPB 1A6PA 3CFKB 1TZHB 2EO9A 2PXYC 4K8RL 4NN6B 2E6PA 4X98A 4G9FD 3JWDC 5C0FA 5J8OA 1K4CB 4X7TA 1VFOA 3HAEA 2RR3A 3TA3C 2DQDL 3W2DH 1BVZA 1E27B 1VADB 3KPMB 2W0FB 2YK1H 3ME0A 3BJLA 4F7MA 3GJFH 4I5BB 4R7NB 1AD9A 5EN2A 2BOCA 4LKXA 3K3QA 4RIRB 1CWVA 1P6FA 3QQNA 4H0HB 3CD4A 4NC2B 3HE6A 3PL6C 4PYGA 4KKBD 4W68A 2XKSA 3LS5L 4KGJA 4R3SB 2NTSP 3DV4B 4FFZH 5IMMA 1MJUH 3PWNB 1A7OH 1FYHB 2DS4A 2NY1D 2AJ3A 4G8GD 1GZPB 1JRHH 3SJVA 2ZSWA 1D6EA 4Z7UA 3VFMB 1TENA 5HI3D 35C8H 1TJHL 5F9OL 4NOFA 3P0GB 1B6DA 3GSVB 1RI8A 5C0IA 4Y16C 3ARPA 4ZS6C 2Y4SA 2AEPL 3CDGA 1H8SA 3H9YA 1MREL 1NFIA 1YEGL 4V1DA 1A7PL 4I1NB 5IEKB 3DYOA 4GRLB 5T3XH 3DI2B 5C07E 4YWGH 3IU4L 1BQLH 5C0RL 4QNPF 1J1PH 4LARH 5F89B 3QUXB 1U95B 2HH0H 4PJ9A 4M7LH 4HK0B 3QB7C 1MAML 4Y4HA 1QA9B 1IQDA 4CJ0A 4JPWL 4MSWA 4JKPH 3NN8B 1DVFA 3KAAA 2NY4D 2UZIH 3X3FL 3R1GH 4PV8A 3I6LD 3PWJA 3DURA 1UB6A 5IVZA 3RUGF 4MD5B 1CFNA 5FHAL 1S5HB 3PNWA 4WV1B 2BCKA 2E7CA 4NC1E 4BH7A 1T89C 4G8EA 3JV6A 4OF0A 4L29B 4M5YL 1WSST 1B0WA 2B5IC 3VU2A 2MMXA 1BJ1J 5H35A 5CWSB 5FCSH 4NT6A 3W0WD 3F12B 3RL1B 3WFCL 4H0IA 4LVOB 4RGND 4HUWB 2HVKB 1DANU 5IMMB 3MNZB 5C0EA 1U8LA 1KCVH 4RFNB 1JZ8A 3S97C 1I1FA 4HC1L 4ZO8A 4CUCA 1A1MB 1DBJL 2DIAA 2ICWB 2YUVA 1PEZA 4Z7UB 2R4RL 3TM6A 5I17B 4C58B 2D9QB 3B9KD 3AU1A 4UNTA 1PYWB 5JMRA 1KFAL 3K74B 5C07D 1L7IH 4NCC1 4F58H 3FFDB 3IF1A 2YKLH 1KN2H 1CVSC 2CLZA 3WFDH 5JW3H 2A9MH 4JRXD 2PTVA 3SKMA 5IVXA 4GXVH 4HAFA 3WN5B 3TJEL 1ACZA 2FBOJ 1KCUL 2Q8AH 4BQBA 2NR6D 4HGKC 4AH2B 2I9TA 1JK8B 1ONQB 3ULVC 4Y4HB 3HNTL 4BFIA 5F7WC 1RZ8B 5DJ8B 3DUHA 1KJMA 5F70A 5JOPE 5K9JH 5DT1H 2V17H 5C07B 2IFFH 4PRBB 4XNXL 2AW2A 3X12B 4ESKA 3F7PC 1E6OL 3MMEB 3D0LA 4I8DA 3SPVA 4BQ6A 1PAMA 1CGSH 2J3SA 2DQFB 4PJXE 5JIPA 5LQBH 1IAOA 3CDCA 1I9JH 2R29H 4U05A 1HINL 2N1KA 3SCMA 1A8JH 3BGMB 2AV1B 3FQRA 2R1YA 3CFEA 3TO4D 2JCCF 4XMKH 4OIIL 4P4KB 5L2JB 4PGEA 4HW6A 5T3ZL 4YGVB 3MBED 4HJ0C 3RIFF 3VXME 2NW3A 3ZHLA 3LSOB 4JRXE 4LVNB 3OJDA 4NZTL 4NPYB 4U1HB 2X5PA 2XRAH 4P2OC 4XVSL 3FAWA 3LAFA 3D69A 3DX7A 5GHWL 1NBVH 4KY1H 1LEIB 4YK4C 4UIKH 4MGXA 5GIRB 1WT5A 1II4E 2EIDA 3B4NA 4YEFA 5ISZD 4MQ7A 2AQ2A 3BH8B 4NQSA 4AK1A 4LVHC 5SWQB 1EEYA 3MNWA 4ZPVB 5IBTL 1W72A 1TVHA 1HN1A 4YDLB 1FFPA 3RWDB 5E5RB 4XP5H 1C5BL 5ITBL 5F97E 3IFPA 2KQMA 1SEBB 3N85H 2WW8A 4PPTA 3MBEC 4R0LA 2YHGA 2HFFB 2ENYA 1LP9A 4NRZB 2NY7H 1RZFL 1Y6NR 1Z9LA 2PYED 4MJ5B 4LLMB 1HI6A 2WIMA 3AREA 1CK0L 2WAHA 2VQUA 3KPOB 4QRUB 4XNQB 1JF1B 4NBXB 3S35H 2Q7YB 5I8KH 2XQBH 4K9EC 2NY3C 3CVHA 4LK4A 5IJKA 4QHMA 5D1ZA 1NSNH 4XCEB 4M7JH 2HP4A 1I8LC 3I75A 1BZ7B 5E99L 4X8JB 2AXGA 3S3PA 4NQDE 1G9EA 3DRTA 4PRHE 3MCKB 4PRID 4NYLA 2AEQL 4YUEL 2Y72A 4HJJL 1MCPH 1QBAA 3CZJA 3FRPG 3PP4L 2KBGA 4AEFA 4OT1L 4OFYD 1TTGA 5H8DA 1G7JA 3SCMC 4HKXB 3KLDA 1U8QB 3QUZC 1YQ2A 4CN1A 5EOTB 5LWYH 1NL0H 2WUBH 3VD7A 1UFUA 4FOMA 5FUCE 3TH3T 4XCNA 3LSOA 5DD5L 5L88H 4ZOCA 3O45B 5L0QC 4FQJL 3QCTL 2EDWA 4QCIB 5HYQA 5C09E 2XZCL 4GW5A 2ARJQ 4TNVF 1C08A 1EAJA 5GIRA 1OAYH 1DANT 5ANMA 3L3JB 3UDWC 3ZTJG 3E2HC 3EGSB 1NANH 1RU9H 3RNQB 1NGPL 2IGFH 12E8H 4PUBH 3GEWB 1UKSA 1DE4A 4HT1H 1T1XA 4PRIB 3ARFB 2OI9B 1Q9WA 2ICWI 32C2B 2DJ4A 3GJEA 4QRSA 4YH6A 3SGKA 1SM3L 2CDEA 1KV3A 1FLRH 4MXQD 1YNTA 1NMBL 5IHUL 1BQHA 2VDPL 5ID0B 4KZDH 1OM3L 1V5JA 2DB8A 4L3EE 3UYRL 1DQLL 5C0AB 3I9GL 5I74C 3WHE1 1IGTB 4XPGH 1FFOB 3QA3A 3MRCB 4WW2F 1F11B 3BO8B 2D3VA 4O58L 3LIZL 1JN6A 2WZPD 1I7RA 2F19H 5GRUH 4U2ZA 4CMHC 5DMGC 3PDOB 1XGQB 2ZOKA 2O61B 1FP5A 3GI8H 1RK1B 3QQ3B 3HUJB 3GMOB 2PCPA 3JTSA 1JGEA 3VXPA 1NDMA 3UYOD 4Y5XB 1M7XA 2BY2A 4NZRH 5B4MD 4EVNA 3RY5A 3QUYC 4NSKB 3NFPA 3NZ8B 4QNPE 1VGKB 2NY0B 1JI1A 4OD3L 1OARL 1J8HA 3HI6H 2X4PA 1CU4H 3CZFA 4OIBA 2D7OA 3WD5L 2PETA 3U79A 1L0YA 1QPXA 2EDQA 1RUQL 5IBUB 2QSCL 4TQEH 1T4KA 3HZKB 3V5KA 4G6ML 1I4FA 3DJ9A 4UNVA 5E2WL 3HZYB 3OG4B 5L9DH 3WXWH 1MCOH 3PHQA 4N8VB 4R8WH 4YHLL 4ZFGL 4LRIC 5SV3A 2AQ3A 4Z8FL 3C9NB 3ULUF 3SDXA 4U6XA 2BERA 4P46D 3EOBA 2L7UA 1A2YB 1JHKH 3MV9E 2OJZH 5EBMB 1T66D 3VRJA 3H9SB 4JFZH 3KLSA 3VWJD 3ZYIA 1DQTA 4K3DH 3TT1H 1OTSC 4FABH 1WBYA 4M93C 3QI9D 5JO5B 2IALA 2APFA 4U1IA 4ZS7H 4Q58C 4W4OC 3O6LL 5I1AA 4GKZA 4FQHA 2P8LA 4GKSB 1NAMB 3FOLA 5CHNA 4I3RH 1JPGA 2VXVH 4JANA 3NACL 2N4IA 4L9LA 4JGJA 2CLVA 4LLQA 1HXMB 2B8OT 1BF8A 5TPWL 1N0LA 4EI5C 5KSBA 3L5JA 1D9KD 4TPRL 4MX7A 1BFTA 3HUJ