4P2RA

Crystal structure of the 5cc7 tcr in complex with 5c1/i-ek
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
180
structure length
180
Chain Sequence
b'IKEEHTIIQAEFYLLPDKRGEFMFDFDGDEIFHVDIEKSETIWRLEEFAKFASFEAQGALANIAVDKANLDVMKERSNNTPDANVAPEVTVLSRSPVNLGEPNILICFIDKFSPPVVNVTWLRNGRPVTEGVSETVFLPRDDHLFRKFHYLTFLPSTDDFYDCEVDHWGLEEPLRKHWEF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class II histocompatibility antigen, E-K alpha chain
publication title Deconstructing the Peptide-MHC Specificity of T Cell Recognition.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 33
structure length 180
sequence length 180
chains with identical sequence F, K, P
ec nomenclature
pdb deposition date 2014-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00993 MHC_II_alpha Class II histocompatibility antigen, alpha domain
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4p2rA02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 4p2rA01
4PJDA 2R4RH 1T21B 3T1FA 1PVHA 2DMKA 2AQ1A 3SDCC 1A4KB 2EDJA 2FATH 1A3RH 4Z8FL 3H0TA 1NFDE 1WISA 5CP3H 2R2HB 5E2JA 1FNEB 2NY0C 3C87A 5IQ9B 1VFBB 1B0RA 2JKXA 2D4FA 4JFFE 3QRFM 1LO3L 3TO4C 3X3GH 1NCUA 1VGKA 2YPKA 3TFKD 3QCUL 3T3PF 1T7VA 4KMLB 4KVNH 1ZHNA 4QF1A 2VLJA 1NLDL 1JWUB 4M6NH 2G60L 3BPCA 2MSPA 5E9DA 3DHMA 1B6DA 4MAUL 1PG7L 5HGBB 5DC0A 2FNBA 2VL5A 4U3HA 2R8SL 5IMOB 2XYCA 1R3JA 4JFQB 3D0LA 3RZCD 2XXCB 5B3JE 3TZVC 3TBVA 2DLGA 3VXSD 2FO4B 3PWPB 3KLDA 4XRCB 5C0CA 4IJ3C 3T0EA 3SO5A 1F4YL 3QULA 5IR1A 2DYPB 1S3KL 3ULSA 3QHZL 2D7OA 1A6ZB 5I15H 1F3DJ 1E6OH 1QSFE 4DGVL 1HIML 3EYQD 2XWJB 4LIQH 3DX8B 2A9NH 4DUXA 2B0SH 5DWUL 2IH3A 3VXRB 2CK0H 2NXYD 4WGWB 4NNXB 5IFAL 5EU6D 1KLUA 4OFIA 3IKKA 3WXVH 4UU9A 3JWDL 1D6EB 3B8SA 4TUOB 3GGWA 4KUCD 5EU5B 4U1GC 1NMBL 4LNRA 5D2NA 4WVRA 4YZFE 3QXUA 4MLSA 5CP7B 1RV6X 5KSVB 1EO8H 1MCKA 5DJ6A 4JFZH 4PLJD 1ZT7B 5MHSD 1CXLA 4JFPB 1EV2E 4XTRD 4XBGA 2W9EL 1IFHH 5ETUA 1TJIL 1F4WL 3IDXL 4ONHA 3ULVC 3NACH 3RVVC 1MH5A 1OL0A 1FVDA 5T3ZE 3Q6GH 1KPRA 2IBGA 5C6TL 3U7AA 4P9MH 3GJFB 2YKLL 5B21A 4X6BA 3FQRB 1ED3B 3ZDYE 2YZ8A 1AD9B 1S78D 1FSKC 3QIUD 1RMFL 1MFNA 1I8IB 1INDH 4OTXL 1PQZA 5HVFB 1IM9A 2AJVH 1NPUA 2HJLB 4JRYB 3BKYL 3TJHD 1NANI 3VE0A 2A6JA 5CD5C 3VGBA 3EOTH 3UTZA 4MZ3A 3KXFB 2VDQL 1K8IB 2HT3C 4ODWA 1FZOA 3MRNB 2EIEA 5CINL 5B38G 1DLFH 3RKPA 3LH2L 4RFNB 5DJDA 4ZMAT 2X4SA 3MV7B 5JW3L 3W9DB 8FABA 1P4IH 3FO1A 3HPLA 4X5WB 4TTGA 5DEFB 3B2UC 3AMLA 5L8KB 4F15C 3O4LE 1I1AC 1JYXA 4U6YB 3EBAA 3L9RA 4KRPB 4XCFH 2ZUTA 1VFMA 1AI1H 2IPUG 2P5WB 2X1PA 5T5FL 1I3GL 3OR7B 3SQOL 4PJ5E 3LV3B 1MJ8L 5J1AA 1KTLA 1N2RA 4S10A 4X5XB 3KYNB 3BW9B 5F70A 3BH8B 3MBED 5GRVL 2DQCH 1I7TA 2ZUQC 3R1GL 2HJFA 5EIQA 2X4OA 5KVGL 4TNVK 2ICWJ 1SVCP 4FXGA 1FL3A 5DJCB 4FP8H 3VI4E 4Y2OA 2QR0B 4IOIB 4NO3B 2UWEA 1ZEAH 3K1DA 1HKFA 4WV1C 1R3KB 3B9KC 4P2OA 5T3XL 1OQXA 2H8PB 3NIFF 1I4FA 1VPOH 5F97E 3TT1L 5EWIH 2GSGB 5CIPH 4IRZH 3INUL 3VG0H 3EUUA 4U1SB 3QUYC 4JGUA 3EGSB 3IGAA 3O6FC 4MQSB 4QOKD 5I71B 3FONB 3UYOD 4JO3L 4P23C 1A9EB 3THML 1CBVL 4QY8A 1TZGL 4LHQB 2ZCKL 5EZJA 3P2TA 4YO0A 2NY7L 4TUKL 4PJEE 2R0KH 1RZIB 4LHUB 1DBML 4APQB 3ROOA 1AGCB 5E6ID 5IEHB 3PQYD 5IMKA 4CL7A 4MXWL 4PV8B 4NRXB 1AQKL 4UI2A 2A73B 5I0ZA 3W2DL 1MJUH 3C9NA 4ZFZB 4DN4L 2ZSVB 4NQVA 5AYUL 2A1WH 1J1OH 1JNNL 3NFNA 2H2SD 1AO7A 3BEWA 4CJ0A 3RGVA 5KW9L 2PETA 4HT1H 2GFBA 4Y16C 1MFEH 1GAFL 4NGHH 3VXSE 4IHOA 2QLVB 5TQ0H 5BW7A 3FT3B 1E28A 4KFZC 1E4XI 2GHWB 4LASH 3M8OH 4M48H 1U6AL 3N9GH 3OXSA 4CRPA 1DBBL 4QXGH 3CDGA 4AK1A 5A43C 4HJJH 4ZO8A 4X7EC 1CFQB 25C8H 4H20H 1P7QD 5FUOH 1WZ1L 3MRMB 2VABA 4JO4H 3ARUA 5JORB 4J3TA 4V2BA 3WXWL 2DD8L 4NWTL 4LGPB 1C5CL 1DEEA 4L3EA 3PGCB 4FQ2L 5IVXE 1RIHL 1HDMA 4PGCA 3ARFA 2H26B 2AI0L 3G5XB 2BNUB 4FFWD 3VFOA 5E2VL 3FQNA 2ITCB 3C60A 4X9HA 3U1SL 1OAXH 3G5ZA 4NT6B 1QKZH 1CLCA 1FFPB 3LEYL 5ILTH 1FE8H 3L3OA 1MVUB 3VFWA 1MRCH 4BQCA 1I9JH 1I7ZA 5D1XB 1PEWA 3RNQA 3OX8B 3CMOL 2WM0A 3O4OC 2IMNA 1DBJL 4HWBH 4NWUL 1T3FA 3TWCH 3HE6C 2B1HL 2R9HC 3CD4A 5DQJB 3GJEB 2BNQD 3AS1A 2ZWLT 2J2ZA 4HPYH 3GSNB 4X80H 2V5MA 5C09E 5ID1A 1JYWA 3WE6A 2GT9B 3SY0A 4F57H 1XGUB 3QUXB 4QO1A 5HHPB 1HSBB 3DV6A 3LZFH 4GMSH 4KI5F 3QZWG 3RWCA 1IC7H 3PUCA 2LVCA 1R5IA 2EYSA 1B2WL 1UEYA 1P4LA 3FHAA 3DRQB 1ZWIA 2R8SH 4UQ2B 3IS1X 4ZTPL 5EU4B 4FOMA 3NPSC 1KIRA 3C2AH 1K8DA 3D48R 1UA6H 1JPFB 4PB0H 3HZMA 4ZFOL 4AIXA 4HMEA 1BFOB 4FZEH 4D9LL 1MCFA 5A2IH 5ISZE 4G9FE 4X8JA 2Q20A 4P5TA 4ODSH 5IJKC 1Q9OA 4Y5YB 4BZ1L 2EDLA 2D7PA 1EEYA 4ZFGL 1IZJA 3GMNA 4EVNB 1A1NB 4NQCA 2HRLA 1WAAA 4PJEB 3CZFA 4JY6B 5I74B 4HS6A 4WNQA 5F6IC 1T03L 3RIAF 2YMXH 3IAGC 1BVZA 4NKDB 4L8SC 3QQ4B 2KQNA 5LG1A 3RUGA 4RMTA 2CXGA 2NW2A 2V5RA 4LPWA 4JREC 1CLZL 1B88A 3NCYP 3QR2A 3QCVL 3MRLB 3P9MA 1XGRB 2ICEA 5DMIL 1KBGL 2XRAL 4G43B 4U7KA 4JDZB 3PGFH 4X83A 1X5FA 1NMBH 4XPFL 4B50A 5ACZB 1CDUA 2PO6D 4P2QD 1EK3A 2OL3B 4KROC 1QR1A 3SO3B 2ZG2A 1ZLUH 4D9RE 1OP5K 1GGUA 2WUBH 1T2QH 3IJYA 1U8LA 2NTFA 3KLAB 1TJIH 4EI5D 3OJVC 1C8PA 2DQGL 5GZOC 4Y5XB 2RCSL 5CD3A 4O2CB 3EIFA 4PJGA 4PRHA 1G9NL 4P3CH 5DVNA 3GM8A 4JJHA 5E8NA 1NBZB 3PQYE 4LVNB 1AC0A 3R06A 4IMKC 3SGDI 3D69B 4N0UE 4F58L 4X0KA 3FZUC 2C4XA 5DHVA 2LE9A 2DQFB 5D7IF 3SDXF 5GRJH 5EC2A 3CXHJ 4PJFB 4JPIB 1HZHL 4MHHI 4MB5A 4XBPB 4XWGL 5BRZA 4PREA 1INEL 2A0LD 1YMHA 3PABA 5FO7A 1RUPL 5MI0C 1Z6JT 3N1MC 3WMSA 3ARDB 4K7PX 1K4CA 4NRYA 5F96H 4FS0A 1FG9C 1I3GH 5A3IC 4KJYA 4UUJA 3LD8C 1H0DA 4M4PA 4KDVA 4H1LG 4NZJA 4PRID 4ERSL 1EAPB 4LPUA 4QWWC 3NFSL 3VWJC 1P5VA 4G9DB 4ONFL 1CXKA 5D1ZC 3B5HA 3OAZH 1UVQA 3EOAA 3M17B 3R1GH 4MA1C 5I8OL 4HUWB 4QXUL 4WUUD 5I1JH 3IDYB 2WQ8A 4OF5A 4JRXD 4NPYA 3BO8B 4ORZC 1YEJH 3GHBL 4R2GD 2ZCHH 2IANB 5C09B 2C7UB 5EU3A 5C0JB 1F45A 4FFYH 1DQQB 2F15A 4RAVA 2AXFB 3GSXA 4X6DB 1KJ2A 3O6LL 3HS0B 4RMUA 5MERA 3X13A 4RAHA 1D5MB 1HXYB 3Q0HA 1GGBH 4YHNA 3GK8L 3FAXA 4QXTB 4Q97A 1BAFL 2EKSA 1J7VR 2CLZA 1HINL 1RULL 3L6FA 5JOFB 5ITFA 5BXFB 5M94B 3EJZD 3E2HC 3ULUD 5ISZB 2AGJH 4G9FB 4PRAB 2ZCKH 1RZKH 3DGGB 3JWNC 3QG6B 5D71H 3REWB 3SKNA 1CT8B 1HILB 3F58L 2BNQE 5C3TA 5I8KH 2AV1B 4R0LC 3CCHA 1RZJL 1GIGH 2HP4A 3QFJD 3PWUA 4ZS6C 1ZLVK 4YJZL 2EIBA 4MXWH 4DCQB 3LEVH 4XNMB 1SVZA 1CIDA 1CF8L 3IU4L 4ZDHA 5CJOL 4KQ3H 1FGVH 5FB8A 4HKZB 3O2DA 3VI3E 4Y1AB 2DQUL 4KAQH 5HHNB 1YEGL 1TNMA 1JNNH 2VLJD 2DMBA 4P46A 4YXKL 4UOW1 4A6YL 2PKDA 5I1EL 5JXAH 2R0WH 4PJIB 3MO1B 5JMOC 3MUGB 4NQDD 3BP6B 3QI9A 4QKXB 3RI5F 2OR8A 3JV6B 2OSLB 4HXAH 4L29A 4CMHB 4ZXBB 3S3JA 3KNBB 4L3CA 3EYFB 3V6FA 1R3HB 3S5LA 1KTDA 4JQXA 5C0CD 1J18A 1YPZA 1Q9WA 3D2UD 4K94C 1KSRA 5JQ6H 4XBEH 3WXWH 1AD0A 4NDMB 4DOHB 4HKBB 2MCPH 2Z8WC 3QG7H 4ELMB 4GKZA 3O3DA 5J89A 1TTUA 4TNWF 4N0UB 2R1XA 4NNYA 3FQXA 4WWKD 3V52L 3QDJB 1ROWA 3NA4A 4P2QE 2ATKA 3HMXA 2WLZA 2YA1A 4I0KA 1ZXQA 3KYAA 2QEJA 5FGSA 4AM0B 5IGXL 5DUPL 1FP5A 4TVPH 4WDIA 1YEDA 3DVNB 1KXTB 2VISB 4U1GB 3ES6A 1U3HC 4O02L 3L1OL 3S37H 3A6BH 1HHHB 1LO2L 3EDFA 5KVFL 3V0VA 5L2KB 5HGAA 1DBJH 2EECA 2F58H 1QQDB 4OLXL 5CJQH 4IRSA 1TTFA 4EDWL 5F7LB 1FVEB 3UBXA 3D3VB 2ZOKB 2W92A 1PSKL 1MFDH 3IFOB 1NCCL 4KU1A 5DJXA 2JB5L 1FNSH 1ZA3B 2DI8A 5LGHL 2HTKC 5EO9A 1NMCB 3WJLC 1RK1A 2J8UF 5TH2B 3BXNA 4XMPL 5F88A 3DOSA 32C2A 1XGYH 4RMRA 3WUWB 4JY4A 2JCCF 3MLSL 5DO2D 3QIWC 3VU2A 4F8TA 2ESVB 2VLKA 1HQ4B 2XNAB 4F2MB 5D6CB 1T5WB 5B39A 2HJKA 3U4EB 3U9PL 3L5XL 5AZEH 5DQ9A 2PYEB 5DJYB 3IXAB 5HI5D 4PRIE 2J6EA 2VN7A 1Q94B 3DO7A 3DXAB 1I8MB 4GS7C 1Z0NA 2Q1EA 3CVIL 2FBJH 2Y07L 4JRXE 1T6VN 2DTSA 1M7DB 1G7IA 3WIHL 2B2XL 2KZ1B 3MLWH 1U58B 2ZUSA 1F6LL 3QCVH 4LSQH 3TO2A 3CJJA 1HKLL 3O8XB 5IHUH 3UTSA 2ED7A 3SDAB 5EPMB 4WW2C 3SDCA 3WUZA 2OBGA 3VFPA 43CAA 5KVDH 1ZANL 2CQVA 2CUMA 1FZKA 2J4WH 3OKLB 2X6MA 3KDMB 5F7KC 2CKBA 5IROC 2Y23A 3B8YA 1BIIB 4PJ7F 4P2OD 3U0TA 1A7QL 3Q5TA 4PJDE 5K9OA 3ULUE 1CICC 1NCNA 5H2BB 3DX6B 5J6GB 3SKMA 5IM7A 1X5XA 3F7VB 1X9QA 4HLZH 5AG8A 1NAMB 5ENWA 5GJSL 4KQ4H 3C5ZC 4MYWB 1U8HB 3OKEB 3W0WA 1MY5A 1TVDA 2CGRH 3ZT7A 3DSFL 1F6FB 3OHXB 3TT3L 1ZAGA 3RQ3A 2VLJE 5D70L 4XWGH 1CLYH 3WNMA 3RX5A 2XACC 3TZVA 4Y2DA 2AJXH 2VXQH 4PS4L 4LCIH 5E9DE 2H32H 4QT5A 4JANB 1U2CA 3ZE0F 5INDB 1KPVA 3UPRB 3KPNA 3UTTB 4KDWA 5SWZA 3QO0A 4L4TA 4NKIL 4YAQB 5TF1L 4HGKC 3RL1B 4LLDA 3QO1A 3AREC 4NN6C 3T0AA 4OCXH 5GGSY 4YBQC 1UB6B 1DANT 2F74A 3QQ3B 3VXRD 3X11B 1GGTA 2WBWB 4NSKB 3MLVH 5C0CE 5F7YC 4D0CA 3T0EE 3RVTC 1YN7A 4D0BA 3RGHA 1XF1A 2WQRA 4JM2C 5FDWB 3QUZC 5KVMC 2FR4B 1QEWB 2VIRA 1PEZA 3SPVA 35C8L 1F58H 3V5KA 1A6UL 3IKCA 2C9AA 2XICA 3MLRH 4U33A 5MP6H 2QTEA 4XWOD 2R56H 3GI9H 4I0PB 3O6LH 3ZTNL 5IFJB 5JPNA 2EIDA 3HLAB 3WSQH 4JKPH 5DK3A 3SDYH 3H7LA 1YEHL 2OP4H 2FZ3B 2UUDH 1NSNL 1HOCB 3SKJH 3GK8H 1R0AH 3ARFD 1S5HA 2ERJC 3ZSSA 3MLTB 5CUSL 5INCB 3N1QC 5D2NE 1QR4A 3BUTA 3C60D 4KHXH 3LQAH 2VXVL 3CDYA 2E9JA 4PJBF 1NUFA 1TZHB 4PRPA 1F2QA 4RFOH 4Y4FB 3MRRA 2X42A 2R0ZL 1G7QB 2XT1B 4WUKL 5EBGA 4PJ9C 5T1MA 1SYSA 1Q9KA 2UZXB 1VCAA 5FEBA 2F54A 2Z8SA 4WCYL 1PAMA 4KRMB 1UH4A 3DRTA 1RJYB 4L8BB 4J3OC 3S7GA 1S7WA 4KRPD 3U0PA 5FKPA 1I1AA 3S35L 2YXFA 4HV8A 3ZDXE 2RAMA 3B2VL 1C12A 2V2TB 1HHIA 1J1XH 2L7JA 2VE6B 2IADA 4I8DA 4ZS7H 1QSEB 3L3KB 1IGML 2X10A 2FX9L 1A7NH 3WDHA 4Z7UF 4FZ8L 1LE5A 4Q6YA 3RVUC 1E4XL 4PJDB 1ZLSH 4M7KH 1A0QL 4LU5H 3VDBA 3OJ2C 1JK8A 1AGDB 1FH5H 4OZFA 2OXHA 3E6FB 5DS8A 1Y6MR 1CGSL 2X09A 2X4NA 4LLMB 3GMOA 1KN4L 4MNGB 3ZYZA 1MLBB 4XH2A 3B9KA 4NQCD 4F9LA 1GGIH 2YPKB 1A7RH 1LK2B 1XT5A 2W91A 2C4FT 2GK2A 4L8CA 4YHOL 3P11H 1PZ5B 4K8RL 4HGMA 1ZHNB 5DFTA 4OD2B 4M5YH 5JLZA 4FQCH 3KS0J 4UV7L 3O6FA 5DD6A 1NL0H 2UWEE 2JELL 3BPCB 4RCAA 4XI5D 5E9DB 4P23A 4UT6L 4GXVH 1YY8A 1A7PL 2OXGA 3NA9H 3ARGB 3JV4B 3F7YA 2D2OA 2H3NB 1H3TA 2R0LH 3L1OH 3TGXA 3TNNA 4LSTL 2A9MH 2E8YA 2VXTH 3N1FC 4XVTH 4JCLA 2WWKO 1SBSH 2DWDA 4P3DB 2Q3ZA 3T0EB 3QEQA 5F44A 1ZSDA 3QULB 4PRHD 2BOCA 4Z18A 1UENA 3ULSB 4X4XA 2R4SL 3PP3H 4XP1H 4XVUC 3DMMD 2QQNL 3OPZH 2PTUA 1AY1H 4MD0A 4WJ5A 1HYSC 4B7LA 2VYRE 4RMQA 4OLZL 2E7MA 4P2RB 3QEUB 1NUGA 4Y16A 3BPNB 2OI9B 1DUYB 1F11A 4FMFA 1KLUB 4MAYB 1RVFH 1J8HA 1FCGA 1V3JA 2VDMH 4UU9B 3ARVA 5BRZD 1AO7E 4FQHA 4HUKB 1EXUA 3GGWB 3LN5A 1LEKA 4WIQA 1C5DA 1OY3B 4LNRB 3BKCH 3BDBA 5FM8A 4UTAL 5D2NB 4K2UH 4RAUA 1T83C 4Y19A 1HK6A 5HGDB 3AM8C 1TETH 4J8RB 5K9QI 2VLMD 4NHUA 1WEJH 4NM8L 2FJFA 2I60H 5DR5L 4MJ2A 2J8UA 3HAEH 1JE6A 1FJ1A 5DZLA 5IMLA 1JN6A 1MAMH 3QDGB 5FCSH 1MH5B 1BM3L 1LEIA 5FYJU 5BQ7A 1DLHA 3X3FH 1KPRB 4PBWD 3LS4L 1HHGB 3LPFA 3RPIB 4LKCA 2WSKA 1M6OA 3MLYH 3RTQC 3TYGL 1J86A 5T1LA 1OGAA 2XI9A 4P99A 3V4UL 4YX2L 4PB9L 1DQMH 4FQLH 3G5YB 4ZPVA 3H7BB 1D3CA 1IM9B 4L3EE 2J3SA 1AR1C 3SKUD 4Y4KB 5JDSA 3VA6A 5JIPA 3UTZB 4NQUA 4M4RA 2C1OB 3GKWH 5GGUA 3GO1L 4QHLA 4GRWF 1FZOB 2OYPA 3IAQA 3BP5A 5CZXC 1LDSA 1T1WA 3VGAC 1OVZA 4QTIL 3WJJC 3FFDA 4FABL 5EH1A 3KPMA 5DJ8A 1WF5A 4ZTOL 3L9RB 5FA4B 3WV0A 5KN5A 4CAGA 4C83A 1YEIH 4URTB 5FUZL 2E7HA 3DV4A 5HD8D 4NYLB 1DQJA 2E3VA 3DECA 4QCIA 1IL1B 3LIZH 4F33B 5I1KL 1U3JA 3NIGF 1S9KC 4L4VA 4LRNL 5ALBH 5I1IH 4HQQL 1GZPA 4J3VA 4F7CA 1UGNA 1T22A 2X4OB 1F90L 5DC4B 1YNLL 1Q0YL 2UZIL 3PG2A 4UINH 4HIXH 5DGRA 3O0RH 3SJVA 5JR1H 3K7UA 1I7RA 3KPQB 1PLGL 5IJKA 4GW5A 4P46D 4M7LL 4XPGL 2AAVA 3V6ZB 1QBBA 3BGMB 2IFFH 2ADIB 4NC0B 4QHUA 2NYYD 2ZZUT 1GGCH 3NABH 3VFGL 5ICZB 4S1DC 4MQ7A 3MRIB 4YEEA 3QXDA 3AU1A 3QAZC 4L8SA 4LSPL 3FB8A 5HGHB 3WLBA 2VDRL 1I3RA 3HE7B 4YQXH 5KOMC 3TA3B 3T08A 4MHHG 2A74B 2ZUVA 3NPZB 3PDGA 1DJSA 4NQCE 1WAAE 5E56A 4L8DA 3LB6D 2J8HA 3IFNH 1U8JB 2GJ6B 4JFYA 1OARH 2DM7A 1SHMA 3P73B 3OBAA 1J10A 3RUGE 4EOWH 3DIFA 5J9PA 3JV5A 4MD4A 4TSAL 5FYLH 4TUJB 1FN4B 5IUSA 2XTJE 1YEHH 4MVBD 4OJFL 3C9NB 5ALCH 1AO7B 4UT7L 3VFRB 3LQZB 3HB3C 4F80A 3RGVB 3UJJH 3WKNA 4OF0A 2Y72A 4NRZA 3O9WA 3RL2B 4Z77A 4M62L 1W8OA 4IMKA 3OXSB 4G3YH 4PJGE 4PRHE 3GSUB 1NH6A 1EMTH 1NGXA 4PJCF 4WCYH 4ZQKA 3ZE1F 1G6RH 2D9QB 1CD9B 4NKMB 1DEDA 1KTRL 3CSGA 4UOW0 1OAKL 2AK1H 1IVLA 5DEGA 3QUMH 4HWEL 5CIPB 2MOVA 3S35H 1VERA 4LLVA 4L3EB 5EZLA 1MCIA 1AXIB 1NJ9A 2BERA 4HHAA 2FGWL 5IBTL 2I9LA 1HDMB 3FHQA 4PGCB 2XFXA 1G7HA 3PHQA 3VFOB 2IF7A 3QJFA 5I2IA 1N8ZA 2EEAA 4LP5A 3E3QE 1UACH 5GGSA 2PCPB 3S36L 2VLME 1KCRH 2QADC 4JM4H 4OCYL 3BN9D 3EYUL 4J3SA 2V7HA 5EIIA 2OTWB 3VFWB 3ME0A 1IC1A 2HT4D 3S8WA 3RNQB 1IM3B 1CGSH 3T0BA 2HMID 5L88L 2R2CA 1YMMB 3T0WA 1JNLH 5AAWA 4P48A 4OZHF 1E27A 3ZKXC 3K46A 2PW2A 3MR9B 4K8RH 3PHSA 4FTVA 2VZUA 2X4QB 5ID1B 3WE6B 4J6RL 1UM5H 2EC9T 3C09C 3MYJB 3K81A 3CH8A 4NCC2 3ROLA 4HAGA 5FYJE 4GH7B 5D96B 3DV6B 4KK8C 5GGVL 1NCDL 2P42B 3MACH 2UY7A 1U93A 3M1BB 1IGYA 1P4LB 2EYRA 4OI9A 3SDCD 2QSTA 5C2BH 4RGOL 1KIRB 4R0LA 1K8DB 1S7QA 2NY0D 5AUMA 2WWMC 3WFBH 3HZMB 3UJTH 5GS0H 3GUTA 4XCCL 4NHCL 3TO4D 2P49B 4Y1AD 1WBZB 3QNZB 1AP2A 4P5TB 5TE4L 3FQWA 1WWBX 4R4FH 5EFIB 2X41A 3UP1A 3V7AG 5A16A 2NY3C 3ECBB 2VC2H 3FT2A 2FH8A 2RR3A 3UBXI 3OXRA 1LD9A 5FF6A 4EN3A 3CZFB 4JPKH 3RWIB 3RWEB 1H15A 1H3VA 3W0WD 1YYML 4QEGA 4CADB 1J05A 3ARWA 2XA8L 4I2XA 4LCCB 3RUGB 2NW2B 3HZVA 4BA8A 4WU7A 2XTJB 5BS0B 2ICEB 4GRWH 2YS4A 4YK4B 4GG6A 1BZQK 2BOBB 3TZVD 3FRUB 4DK3A 5GZNC 3K2UH 4ORGA 3FQTB 1Y6KR 5B22A 1U2HA 4XMLL 2XOTA 1KXVC 5AG9A 1N0LA 3IDMA 3MCLH 5D1QC 3L3HA 1IGCH 1QD0A 2XKNA 3BPOC 4BSWA 1FAKT 2ZP0T 2CDGA 4LKXA 5HYSG 4OIIL 3QA3B 1BX2B 3HC0B 4NFDA 4M93C 1MF2L 3QNXB 3FMGL 4AIZB 3GZKA 4U1JB 4Z0XB 1N5AA 3UC0H 1A21A 4FMKA 1YPZE 3KPRD 2UV3A 1A9BA 4LQFL 4GMTH 1Z9SA 2YUXA 4L1DA 3ET9F 5FHAL 4PLNC 5HXMA 4X7TB 1QFUH 4M1DH 2BY0A 3BH9A 2BMKA 4H8WL 3MRGA 4R97C 3O45A 5E6YA 5J11C 1J0KA 1KENH 1T1YA 5A40E 1FFOA 1KJVB 1FZMB 3CDCA 1IRAY 2L0DA 1U3HA 5L2KD 3I9GL 2X70B 4CMMB 4DGYH 5FKAA 3STZB 4CN1A 4ISVA 4DTGH 4DVBB 2HT2C 4ZUSB 1I9RH 5SX5K 5HYJA 3P4NB 5HHOB 5LCVL 3FB7A 5DHYA 3ULVD 4LSSH 3RVVD 5I19H 2FJGA 5MENA 3VMPA 4NZTL 5F71A 4HCRL 1MNUH 3VRJA 1IAOA 1DQLL 2VMFA 4NRYB 3BP7B 4OLUL 5BV7L 4JFOA 4PRPD 5FCUL 1NDMB 4G5ZH 5BZWB 1RUQH 3OB8A 1I7UA 1BWWA 3J7HA 3WJLA 3OKOA 4WI4A 3BE1H 4CU8A 5CD5D 4EUPG 2NY2C 2EIZA 2FL5A 3EOAB 1U95B 5F9OL 1A6AA 2YD5A 2HT3D 1YNLH 1Q0YH 2VAAB 4OZGA 2UZIH 2GAZA 1CFSB 5EU3B 1QO3B 5D8JH 2PYED 5CJ8A 1SYVB 3GSXB 5C08D 1I1AD 5GIRA 2YN5A 1PLGH 1XIWC 3GMRA 2KH2B 2FB4H 3QHFL 3GMQB 3L7EB 3TBYA 1MHCB 2VLKE 4JY5L 2FDBP 1F3JA 3NFPB 2ITDA 3CFDA 5K33A 2EKSB 4HIEA 3PNWB 1WIPA 4M7ZB 2VQ1B 1Q8MA 1WFTA 2DQJL 3NCYS 4PG2A 2OTUA 3L6FB 2J5LC 1FZJA 1U8QA 1OAUL 2BDNH 3ZKNC 2OLDA 4LAQL 1K4DA 1DR9A 3GI8L 3DVGA 1EUTA 2JE8A 5C8JA 1SMOA 2WP3T 4HUNB 4WW2A 3CCHB 2ZUXA 4C58B 5AZ2L 3NGBB 3MGOA 3MV8A 4QHMA 4R4NC 1C7SA 1DZBA 3B9KD 3KPLA 3GHEL 4WO4B 5FHBL 4YFEA 5L9DH 1FBIH 2DBJA 1WBYB 5GRUL 3UX9B 3DVFA 3FTGA 1W72A 3B5TA 1CICA 3UTSE 2OQJB 3HPJA 3QUYD 3O6FD 3HNSH 4XP9H 5FGBC 4NZUH 4P23D 1JZ6A 4AENB 1KJMA 2O5XL 1FCCA 1HHKB 1KF9B 4W4NA 4MA8H 2ZNWA 2MWCA 2ID5A 2CJUH 2HVKA 3QEGL 3QI9B 5C6WH 2FIKA 5IBUB 4Q9RL 4L29B 4HKJA 1A3LL 4NO2A 5IWLC 4PJHF 2G2RA 1AIFB 3RWDA 3P9LB 4HWNA 5C92A 5IBLC 3S5LB 2FEEI 5T1DH 1UQSB 4QGYA 4MDJA 2DQEL 5I8CB 1KV3A 5F7UA 6FABL 3PV6A 3W0WE 1CL7H 1OAKH 1AD0B 4QYOA 5IB5B 1JP5A 2UVEA 4M9OA 3FKUS 5LJYH 3QXVA 1MAKA 3O3DB 2VDOL 2X4RB 1JF1A 4NNYB 2WINB 3AREA 3T4YA 2YWZA 4CW1A 4M6MH 1C5BL 3FQXB 3GIVA 2NY4B 4GAJH 3RAJL 1ZVHA 4Y16D 3GSRB 3T8XB 1TQCB 1B4JL 3IDIA 2JB6A 1MAJA 3MRFB 1OT1A 1GOGA 1CFVL 2CRYA 4OFKA 1SEBA 3MV9A 4GAFB 5SWZE 4L4TE 4NCC1 1K5NA 4JO2L 1W8NA 1P4BH 4XP6L 4JM2A 4OCYH 2QSCL 3QUZA 1RIUL 4KMQA 4Y19D 2WV3A 4O5LH 2Q8BH 4OFVA 1JTTA 3ES6B 1ZVSB 1YECL 3MMEA 2H45A 1WTLA 5IESL 1QYGL 4M1GH 4DKFL 1XCTA 4PRBA 5CSGA 3TIDB 1MHEB 3DPBA 3LKPB 4I48B 4B7IA 1I9EA 3S96A 5F89A 4R4BB 4IRSB 4OQTH 1A22B 2IPKA 2HKFL 3AAZA 1UZ6E 3U4AA 2Y25A 43C9A 5T1LD 1OGAD 5EUOF 3O3EA 1TVBB 4OLWL 4K3GA 2Y6SC 4ONGL 3TCLA 2VUOA 3ZTJH 4Z7QE 3EYQC 1MCJA 2XQYK 2QQLL 4P4KC 4L9LC 5EO9B 1N6QL 3BXNB 3BZ4B 1FC2D 5EIVA 3NIDE 1L7TH 5IIEB 3VD4A 2Z4QB 3ULVE 3DX9B 1K6QL 5CJXA 2NXYC 3I6KB 4GAYA 5KTEL 4OZHA 2VLKB 1DBKH 3DBXB 4PJ9A 4YC2C 1URLA 1IKFH 5AWNH 5E99H 1CFTB 1J0HA 2HJKB 5EORH 5ESQA 1Y18B 4PRPE 3HE6D 1ND0A 3MFFA 1WSST 2R9HD 5EN2A 5DZOA 2Y36L 4TSBH 4LGRB 4O58H 3BHBA 3MRBA 4TULL 4YIQA 4KJQC 4WW1A 1LP9A 1VA9A 5DTFB 4N0FB 3BD5A 5KAQG 3IXTB 2DLFL 3RA7L 2F54E 5K9KA 1BOGA 4JHWH 3RRQA 1G7IB 4L4VD 2VAJA 1EX0A 4D0DA 4Z7OE 1T80A 4PLKC 3VXTB 4DFHA 2AJZB 4HGWA 4MJIA 2AK4A 1L0XA 3O2VH 3TO2B 1NC2A 3AY4C 5GRXG 4GUPB 5C0BB 4F8QA 5KSAC 5LGJA 5D7SL 4JAMA 3UTSB 1ORSB 4LVEA 3SJVD 3SE8L 1RFDH 4NJAH 4YBLC 4PJ8C 2FLBT 5LQBH 1KEGL 4U0RC 3PL6B 5FYKU 5EZOH 3GSWB 4U1LA 1KB5H 1B0GA 3QEHA 5K9OB 3ZKMC 5TJWK 1KEMH 4D9QD 2WBKA 1BJMA 4OV6F 2ARJQ 4PGBB 3VDCA 2AKRB 1CD1A 1YJDL 1PG7X 4EXKA 5ENWB 3IETB 1DE4A 3O6KH 4GKSB 1V7MH 1JBJA 4U7SA 2Z93B 2AJYL 1ADQH 4FQPA 4NM4H 2VDKL 1I9IH 1JUFB 5D7JB 1F6AB 1X4XA 4DEPC 1QRNA 4F7PA 1TTGA 3VFNA 4GRLC 4KROD 5K9QG 3TJEH 3JSSA 2DJ4A 1Y0LA 1NFDF 4Y2DB 1T04B 3ZYIA 1ZA6B 5E2WH 5JPMA 1CZ8H 1PY4A 5GZOD 1T1ZA 3T2PA 4K8RC 4N0RA 2G5BB 3KPNB 3MUZ1 3QO0B 4L4TB 1DN0B 1MI5A 5TDPB 1KIUA 3MRPA 3ARRA 1FLRL 5D7IB 3SDXB 2K3TA 4WI5A 3IF1B 2UY6A 3IJSA 3TNMB 5BZDA 4ZUUA 2HFEB 4QRUA 2ZUYA 3QFDB 4D0CB 4G7VH 3FZUD 3QEQE 2B1AL 2Z91A 5C0AA 2DBLH 1LO4L 3IS0X 3OKYA 1VEPA 2W1NA 1CDGA 1U8NB 4JGJA 3VFVB 5KOVC 2FCBA 4JLRB 4H88L 3UJIH 5B3JF 5A2JH 5E8EA 1YZZA 1NGQH 1T83A 5DRWB 3AM8A 1FO0L 4KZDH 3HRZA 2AJUL 2R69H 4OFYA 3QIBB 3U9UB 2LQRA 3QDGD 3BQUB 3CAFA 4JO1H 1ZHKA 4YFLF 3O3BA 1J8HE 1MWAH 5FM5M 3CFJB 4Q58C 4FQXC 4JG0H 4U3CA 5A3ID 1S5HB 1YEKL 4GQ9H 1E0OB 4ZOCA 5F7HA 4JJ5A 3EAKA 4Y19E 4E9LA 4Y5VC 2DQJH 1GZQB 4QWWD 3RTQA 1MCOH 2H2SC 3DURA 3VWJD 4PRNB 5D1ZD 1NCBL 2EDQA 3TPUB 2OR9L 3S9DB 2J8UE 3MRRB 3MRJA 1RUKL 4MJ4A 4MJ5A 4WTXA 4OLEA 2W9DL 4XPTL 3D87B 5T1MB 4PGDB 4O4YH 9CGTA 1SYSB 2H32B 3JTTB 3KPSB 5IFHH 1QLFA 4NZRH 1QA9A 4YZFF 1WJ3A 2XN9E 2Q6WA 4FXKB 2V5SA 1JWSA 2AV7B 3DRTB 4K3JL 4FN0A 3W9EB 1S7WB 4FNLH 5SX4I 4YPGB 4KH2A 1KIQA 5FKPB 3LKSB 3TN0B 4MJ6B 1N7ML 4WEUD 4XGZB 2F5AL 2AP2A 3B83A 3KYMA 5E4EC 3NAAL 4P9HH 3P9WB 3DI3B 4JZJC 1A6VL 1HHIB 2G75A 1MHHB 4XXCC 2APTA 2R23A 2VH5H 3NMEA 1MCPL 1LNUB 4N0CC 2RQ8A 3U36B 1LE5B 4Q9RH 2WNGA 3WS3A 3QZWA 5GJTH 1EGJH 4AEFA 4AYFA 4ZS6D 4U31A 4ZO9A 4KHTL 2LU4A 3L3GA 5F7DA 2PW1B 3EOBA 3MREA 5F1IA 3VRIA 3X14B 1JK8B 4ODHH 1YEFH 5GS1B 3VRLE 4OZFB 4HS3B 2C3WA 4HBCH 5DJ2A 4FQJL 2DQIL 2FX8L 4IEFB 3VJ6A 4KUZH 2X4NB 2O5ZL 2VDOH 5AD0B 2NY3B 4NQEA 3DUHA 4I3RH 1C5BH 1NUNB 3FOMA 3OZ9L 1OB1A 2NNAA 4PJHA 1PGRB 5JLZB 3SJVE 3FOLB 5DD6B 1HH6A 4HF5L 5IKCB 3UO1L 1JMZA 2B20A 4XX1E 1V05A 3VXNA 3KWWA 5H35A 5I1LA 2QBWA 3F7YB 5FIEA 1D5BB 4XNUH 3MNVA 5I30H 1YN6B 2RBLA 4HG4K 4ZFOA 4QRSA 15C8L 4D9QE 3VI4F 4K71C 1UG9A 3TNNB 2X4UA 4GXUN 2CIKB 3ILPA 1GGYA 4PV9A 4BKLB 1ZMYA 2DWDB 3BPOB 1L6XA 4XNXH 1ZS8B 3ZE0E 5E08L 1ZSDB 5D4QA 2OL3L 4CKVX 4IOSD 4YDKH 2YK1H 5FYKE 3R8QA 1X4ZA 4YEFA 3T2NH 2E27L 4FQIH 3R4DA 5J12C 4JFXA 3VXUD 4DQOL 3GRWL 1BJ1H 2F53A 2EE3A 3JWOL 4WHCA 3U46A 1GC1L 4MMZC 3BD4A 4PG9A 1FC1A 1RHHA 2BP3A 3KHOA 3TBSA 1DSFL 4HG4J 2XWBA 5EUKA 2P46B 1SMAA 3GJFH 1BZ7B 4JKWA 5DDHA 1TJHH 4YHIB 1BVLB 4UBDD 1LK3L 4R90H 4WGVB 1UJ3C 4FQHB 2DRUA 1MCDA 4D3CH 5HYJD 4NO5A 4XNZB 3L5WA 3VA2C 4RAUB 4U6VH 3D25B 1B0WA 5HHXH 5EUOA 2WANA 1JTOA 5MEND 3E8UH 4TPRH 3U2SA 1Z9LA 3DVIA 4ZUWB 4Z7WA 4CDHA 2J8UB 4HKXB 4XC3L 1FJ1B 3FCTB 5IMLB 4CVXA 2DJSA 4MNQB 5DFWH 2JCCB 1LEIB 2R1YA 3U7WL 1KN2H 1XF4B 1PKQA 4Z78A 2HTKD 2Z35B 1TQBC 4OCRH 5C71A 2WBJC 1RZGA 4LKCB 1XGQA 2VDNL 1M6OB 2WIMA 2XN9B 4G6KH 1GOFA 2ICCA 4LLWA 5J06A 5GGQH 3QIWD 4HWZB 4ZPVB 1G1CA 1XCQB 3MZGB 4H1LA 1CXIA 1DCLA 1MHPL 1FYTD 1M1SA 5CWSB 3SCMC 2Z92A 1TJGH 3IJHB 1H5BC 4XCYA 4S11A 3FN0H 3ARBB 1IC5L 4PTTA 4XNQA 5JDSB 3UPAA 1N5YL 4H26A 1HEZA 1T6WA 1ZHBB 3IDJA 4FG6C 3RIFK 2AEQL 5F1OB 4PGJA 1OPGL 4QHLB 3O3UN 1BF2A 4RBPK 1YMMD 1L6ZA 4M61A 4ZNCD 4HUVB 1IGFH 1CGVA 1MFCL 3UBXG 3Q5YA 5E8PA 3U0WL 3FFDB 3KPMB 2IPTL 4P5KA 1FNHA 3I75B 5IVXF 3PWVB 1R6VA 3QISA 2RFXA 4WHYG 3RKDC 4V1DB 4WHTB 1KT2A 4KUCF 4QCIB 2VERN 3CLEH 1CU4H 4OB5L 5TDOB 1FIGH 3EO0B 1LO0H 2BZDA 2HFGH 2PR4H 3IU3B 2PXYC 5CEZE 3MXVL 3W5MA 4A2MA 4OBSA 1JHLL 4Z7UE 4NQSA 4PJ7B 1KC5L 4V2CB 4F7CB 2HRPL 2BSTB 4YNYA 3DX7B 4FTVE 3HG1A 5IQ7L 2FD6L 4GG8A 3CFIC 4HK0A 3MV8D 1MQKH 1TCRA 4M43H 5TE6L 4ALAH 1D5IH 3I84A 1PD6A 3VGFA 5DRXB 1OTSC 5IVZA 5D93C 3D9AL 4OI8A 4J4PC 2IAMB 3ZDZE 3U83A 3BFOA 5GPRA 2BSED 1D7FA 4EZMA 4XCNB 2X1OA 4GJTB 2JJUA 5F7EL 1A4JA 4YBHA 3CXDL 3C5ZD 1MSPA 5CGYC 1F00I 3BT2L 1AXSA 3I6LE 1N3NA 2Z31C 4E41D 3EOYG 3FB8B 2E7LA 3H9HA 5JHDB 2VITA 3MLXH 4HFWA 2VO5A 3EJZC 3S88H 3V2AR 3WDJA 1XH3A 2VL4A 4R6UA 4S0SD 5E4IA 3O2WH 5FV2A 4I2XE 4NUJB 4HUUA 3V8CA 5D1QA 3KJ4B 5T3ZH 2XQYG 3HNTH 1M4KA 3TF7C 4YXHL 4ZFFB 4HJGB 1U8OA 4A6YA 3BP4A 4YBQD 4BZ2H 4R7NA 4CN6A 4GG6E 5FECA 3QRGL 1R5VB 4OAWB 1W0WB 4N0YL 4UDUB 3WFCL 4N8CH 3RVTD 2NY1C 3OSKA 2BRRH 1JGEA 4AL8L 4U6XA 3O9WB 1X7QB 4JM2D 1EJOH 2K7PA 1UCBL 2R29H 2VSCA 5ITBL 3QUZD 4Z77B 4LEOB 4S0TD 1XF2B 5CILL 1BFVL 1CE6A 1JGLL 3ZLQC 1O0VA 2ICWA 4LDLB 3VD7A 5T1KA 5F9WB 2R2BA 5ICXA 5IB3A 5I1DB 2DQTH 3N1PC 3A6CL 1XR9A 3HZKA 3CK0H 1ORQA 3O81A 5I18H 3LRHA 2NMSA 3BISA 4QRRB 4HUXB 4PJBB 3V4PL 5TPWH 4F7EB 1CS6A 1DTUA 4RMWA 1RU9H 3G04B 2YRPA 2DLHA 3LMJL 3VG9C 2XFXB 1T7XA 3GSNH 4E0RA 2VLRA 5HYJE 1OSPH 5LXGH 2Y5TA 4H8WC 4K55A 2RHEA 2EXWD 3P30H 3FL7A 3TBWA 3FFCB 5MENE 5HY9A 1KTKE 2EH8H 5EU7C 4ZAKC 1N64H 4X6CA 5IW1B 2FX7H 4KHTH 1QFHA 3DTXA 4U1KA 3CFCH 1X5KA 5I75C 3VCLB 2FEEL 5CCKL 4S1SL 3MJGX 4PY7A 1LO5A 3RJQB 2XZAL 3VWKC 1F8TL 5FGCE 2VWEC 5BV7C 4PGEB 2GYSA 4Z7UB 4ZSOA 3ARZA 1UWEH 4AEIH 3B3IB 4TRPH 4AH2A 3LOWA 2GY5A 4XP4L 5ESAB 3MV11 4YHZH 2HFFA 2W9LA 4X7FC 3VMNA 4P49A 3ROLB 4UAOB 4MJID 2P24B 2AEPL 3AFLA 4YDJB 3RVUD 3WUWG 1ES0A 2P5EB 4GSDH 2QQQA 1JPST 1IGYB 4XMKH 4QTHB 3PJSB 1AHWA 1FNAA 2PN5A 1XGTA 1JGDB 2EYRB 3WFEL 4OLVH 2ORBH 1IC4H 15C8H 3ESUF 5GHWH 5DJZA 1EA9C 3DGCR 4RGMB 4LAJH 4YWGH 3KPTA 3QUMB 3BKML 4LL9A 2GCYA 1G9EA 3EFDH 3FQWB 1NDGA 3LCYA 3QT2A 2DAVA 5A16B 2VDPL 4LCWD 5JIKA 3WKML 5HI5C 4KVCH 3WIHA 2HVJA 3O11A 4LSUH 5GGTA 3OKMA 5FF6B 4EN3B 5FGBA 4B5EA 3MV8E 1H3PL 4JFHE 3S3SA 3IDUA 1NGPL 3NZHL 3AS0A 3BPLC 3D1MC 1QRND 1BEYL 4GW4B 3I85A 3TVMC 1NC4B 5L8LB 5IWLA 5C07A 5DUMH 2A83A 4OZIA 1R3IL 4K3EH 4ORGB 5T3XD 5IB1A 2DI9A 4XPAL 3FO9A 3Q3GA 5LWYL 2X7LA 4F7MA 3OGOE 1RZ7L 3VI3F 2A6IB 2VQTA 5IK3A 4XVUD 4JHBA 1HYSD 4JN2B 2NY4D 1JHKH 4P9HC 4LLUB 3HI1B 3VW3L 1QRKA 4AMKH 5IHBA 2AABL 2E6PA 5JIIA 3IFPA 3G6JA 3SEPA 5DD3H 2OR7A 3GSQB 1KGCE 3MRKB 3WFHB 1D5ZB 4UV4H 1CIUA 4NZDA 2CDEB 4YUEL 3BH9B 5B3NA 1NKOA 3RY4A 1B3JA 2HKHH 3QUKB 3GSOB 5IB4B 2QHRL 3Q6FA 2Z8VC 4NFCA 2Q8AH 1JNJA 3CVHL 2K9UA 2EE2A 1A1OB 2OMBA 2A77H 5FKAB 4ODTH 4MSWB 1QHOA 1MIEL 2R2EB 3IRZA 4OFYD 3L5IA 5DVMA 1OP5H 4DK6A 4DN3H 3VFUA 3WO4B 1MFCH 1W0VB 3MV9E 5L0QB 4HC1L 1PFCA 1ZKAA 4QRTB 5JW4R 2FJGB 4OSUH 5TFSH 4KC3B 3OJDA 3RNKA 3K4ZA 4NN7B 4R7DB 2AEIT 1FRGL 3RTQD 4QHNA 1FIEA 1TENA 3ABZA 4M5ZH 1G6VK 3H3PL 2X4TA 1OM3H 1I7UB 3FO0L 2Y06L 1T7ZA 4N1HB 1AQDA 1UT9A 1JNHB 3DETC 4GRWB 4L9LA 4Q2ZA 3T09A 4AQOA 2OK0H 2PF6A 1AR1D 2CUHA 1IBGH 1IGIH 3BZFA 1AFVL 4NC1C 2AEWA 1OAQL 3I6GA 1A6AB 5EU6A 4MB3A 3UCRA 1EEZA 3BDXA 4X4ZA 4HDIA 1SEQH 4WFGE 2BJML 4BK5A 4CJ1A 4PGZA 1Z2KA 3GIZH 4F9PC 5CZXD 2OZ4L 2APVA 4JB9L 3RZWA 1VEMA 4YDIH 3U6RB 3SQBA 4Z7NE 5I17B 5E5MB 5TQ2H 1AR2A 4JHAH 2Q3AA 4Z76B 3QNYB 1IEAA 1VENA 2F19H 4OZHE 5CSZB 3HMWH 2FSEB 3MRQA 2AXJA 1EHLL 2C26A 5C0RL 3OKDA 4HIEB 3AXLA 2WUCL 1EVTC 1PG7W 4TVPD 1ZGLA 2APXA 1HNGA 1DL7H 2Y7QA 3LS5L 4OD3L 1FZJB 1U8QB 1UM6L 1FPTL 1R5WA 5SWSB 1JGUL 4BK4A 4N8VG 1LP9E 2FRGP 3AY4A 1Z5LB 4XVJH 4KTEH 1ZHLA 1CLOL 4Z95L 5C8JB 5DYOA 5E2UH 1JZ5A 4LQ1A 4LF3A 1T4KA 5D6DC 4RFNC 5FAAA 3KPLB 4NQED 5D72L 4MJIE 2AK4E 4I18B 3AS3A 3WHXB 4YGVB 4MCYA 4X8XA 3A67H 3IVKA 5DURB 2HN7A 3L7FA 4X7SL 1IAIH 3HPJB 4S1DD 3BAEL 3H42H 1UB5B 1JV5A 2DM2A 3QXTA 1JIBA 3WL9A 1FV1B 3ELAT 4S1RL 4I4WA 2VDLH 5BO1L 1ETZB 4DUVA 3B9EA 5C7XL 4XNYH 2HVKB 4XCEA 2DQHH 3PDDA 2I07B 4HEME 4H5SA 1UKTA 4NO2B 4OCWH 1ZLVH 4UQ3A 1FL6A 4GRLA 1FDLH 4M7JL 4MDJB 1S9XA 3C6SB 5J4MA 5C0GA 2DF3A 1A14L 1SY6L 1ACYH 4PJDF 3ULUF 2DKMA 4XVSL 2MPAH 1YJDC 1QRNE 3IDNA 2XZQH 3MRCA 4ODVH 1YDPA 2F53D 1N0XL 3HB3D 2YEZB 5C0FB 2H6PA 4CW1B 1YQ2A 4Z0BH 1Q72L 3GIVB 1MEXL 4MQXC 4O2EB 2GITB 3IDIB 3MOBH 4PJCB 2JB6B 2VSDA 1NMAH 5F1NA 5T3XE 1EIBA 3AUVA 3T1WA 5I71C 4BFGA 2X9YA 1BGXH 1FGNL 3LAFA 1UC6A 4U1MA 4QOKA 4HH9B 1MI5E 4HIHB 2F5BH 2Q76A 1MELA 5DQDH 2R4RL 1KFAL 5ANMB 4X9BA 4APQC 3MMEB 2FATL 1A3RL 4HUMB 2B4CH 3AS2A 2M8XA 2YC1A 2GEEA 4R8WH 1XCTB 5C0AE 1UADC 1L0YA 3UTPD 4X6FA 5EBWB 1X5AA 1UXWA 1CXFA 3CLFH 3MJ7A 3VD9A 5DF0A 2W60A 3X3GL 1K2DB 2HA1A 4H25B 43C9B 1CDYA 5L8JB 4KVNL 4X7CC 4BELD 2P8PA 3MJ9H 3MLZH 4Y5VA 1F3RB 2VXUH 3V5HB 2O93L 1V7NH 2QADD 4M6NL 1OWRM 4MA3A 5JA9A 3P0GB 4I1NB 3BZEA 1A6PA 2X1WL 4GAYB 1QHPA 4OZHB 4OLYH 5GRVK 1MRDH 4P59H 3V95A 2VZSA 3S4SG 4UOJA 5DK2A 4KKAC 1BLNA 2IQAA 4ZO7A 3LPGA 5B38B 1EFXB 3TLRA 3WIIH 4WW1B 5JW4M 3GMLA 3QDMB 4ODBD 5I15L 2YN3A 5E00A 1E6OL 5I8EB 5KS9A 4J3WA 4JZJA 4JKKA 4KK8D 4LIQL 4WFHE 1S9YA 2A9NL 4XXCA 4B41A 2B0SL 3U7YH 1NAMH 2CK0L 4XAWH 1E6JH 4KZEL 1J87A 3MJ8A 3HG1D 2AK4B 1KCSH 4YDVA 1NC2B 4OD1H 3WN5B 4O51A 4JAMB 3WXVL 5CBAB 4N9OB 2FWOA 1MRFH 4RNRA 1NCWH 1WLHA 3ZT5A 2XKSA 2R1WA 5D1XC 3CFKA 1MREH 1NGYB 4JFEB 5E94B 1QLRB 3OQ3B 1EEQA 1EO8L 2NY3D 4JFZL 1G7LA 2EH7H 4S2SA 3QEHB 1IFHL 1IEBB 5GS3A 3ZDXF 3NACL 5DD5H 4NKOB 1A8JH 1I85C 3Q6GL 1A6TA 1CE1H 4ZOEA 4P9ML 5HDQH 3QUXC 1NLBH 5HD8C 1MLCA 5HHMB 3C08H 4W70A 3S34H 1KCLA 2CLVB 4NQEE 1INDL 3L3IA 4R96A 3SDDB 3NN8A 2AJVL 1G7PA 5GZND 4F7PB 3VFNB 4RWYH 2AJ3A 4PJHE 4LBEA 3EOTL 1BBDH 3DJ9A 3D18B 3K3QA 5ID0B 3LHPH 5EOCH 5D1QD 1Y0LB 2IBZY 5HPMA 5IVNA 3TP4A 2A38A 4BZYA 2FBOJ 2BCKA 1DLFL 4C56D 1NGWA 1J1PL 3OR6A 1P4IL 2X1XR 5KZCD 2R39A 3OKKA 4NN5B 4Y5YC 1MI5B 3CPLB 2X89A 3OGCA 1A6WH 3A6OA 4XCFL 1LE9B 5IP4A 2GKIA 5I74C 4AIOA 5F7WC 2UWEF 3BYTA 2M26A 2DDQH 1WCBA 5C9JB 2J1KA 2ZUWA 2Z91B 1N26A 1P2CA 3E1F1 5T1KD 2DQCL 1WICA 1YY9C 1UJ3A 2GTWA 1ACZA 3GDBA 3L3DB 2HT2D 4GKNA 2F53E 3QDAA 5E8EB 3MYZA 4FP8L 4P4RB 4I5BB 3TC9A 5E2TH 1KB5B 5DHXB 5HPOA 3SO3C 3TIEA 4AEHH 3HRZB 1S9WB 3CNKA 1ZEAL 2NX5A 2MQ0A 1ZHKB 4OFPA 1WBXA 2HLAA 4MNQD 3RPKA 2BY1A 3BJLA 2E9IA 4I77H 1GC1C 3KG5A 4Y5XC 1OSZB 5HJ3B 1VPOL 3SE4A 4EI5A 5EWIL 4IRZL 5EUOE 3VG0L 3RIAK 4KJPD 2V7NB 1CFBA 2WBJA 6CGTA 4UTBH 5CAYB 3SKOB 4YHPA 4LVNC 3WIFB 4XT1C 3NZ8B 1FPTH 2NY2D 1ZT4B 5LKNA 5DVLA 1T66C 4Z7WE 2ZSWB 4LK4A 2EXYC 1CN4A 3MRJB 4G80A 1D6VL 1I3VA 3EYOA 4MJ5B 2CIIB 2GTZA 3UTPE 1H5BA 5HTSA 2I25N 4GBXB 1PKQE 1VDGA 4JPWH 2R0KL 3W39A 2FYYA 3RBGA 2QHLA 4S1QH 1FNLA 3ULUH 4XZUA 1XIWD 4WFED 4HSQA 3PWNA 1BD2A 1NGZB 1BQUA 1PX3A 1Z9MA 1OP3H 5DK0B 5FUCE 4CUCA 3F5WB 4EIZC 2YD2A 3L5HA 4UT9H 2VZOA 3ARDC 2A1WL 3LKRB 1JPGB 1BQHB 4U3XA 2H1PH 2HTLD 2NXZB 3P4LA 3BYYA 4HT1L 3ZKND 1OGTA 1MFEL 4NGHL 2R23B 2JIXB 5TQ0L 5L2JA 3DARA 4NOBA 4LASL 3M8OL 4M48L 3N9GL 3OAYH 4DKEH 4QXGL 4F7TA 1U8MA 3IDYC 1IQWH 4EI6A 5KAQF 3OB0K 4HJJL 4M7JH 5F7DB 3EOBB 1S7RA 4R4ND 25C8L 3K2MC 4H20L 4WUUA 1IILE 5FUOL 5F9JA 5D7LB 2EDNA 1MWAB 4JO4L 2C5DC 4TOYH 1U8PB 3DUUA 3LKQA 4CDGC 1P9MC 5MEQB 4Q9QH 3AVEA 3K8MA 3HG1E 3MGTA 1D9KB 3GBNL 4GO6B 4JFDD 2HG5A 1JI2A 2I9TA 4PJHB 5SWQB 3SGJA 2IMMA 3LEXB 4G8EA 2OJEA 5B8CB 2Z31A 2EYTB 3KS0H 1HH6B 4G8GB 1FGNH 4PRDA 4BH8A 3FRPG 4FFZH 1YC8A 1OAXL 4KK6C 5C07D 1GL4B 1QKZL 2CD0A 3RDTB 4DZ8A 1AKJB 4JQIH 5IBLD 5D9SB 3VFSA 5EC1A 5I1LB 4OF3A 4OUUA 4ENEC 1KFAH 5ILTL 1KULA 4RX4A 1FE8L 4Z5RB 3PXJA 5I1AB 4NBXB 1MRCL 2YBRA 4IIQB 1I9JL 3QFJA 3L95B 1T0MB 2Y1VA 4HWBL 3SGEI 3TWCL 2W65B 5LAXA 4JZNA 1JRHH 3MPCA 4GFTB 5HYSA 4HPYL 4X80L 4K9EH 2MKWA 3ALXA 4IDJH 4HZLB 4GAGH 4F57L 1BBJA 3LZFL 2E6QA 4GMSL 4U4BA 3TBSB 1IC7L 3WEXA 4NQDA 3I50L 4CMHC 1WAAF 4ZXBC 5ICYB 1OWWA 4MCZB 4NNPH 1KNOB 3PHOA 3C2AL 5D7KD 1UA6L 3D39A 2P8LA 3H9SB 4Q0XH 5EUOB 3RUGF 4PB0L 5B4MC 4LPYA 1A02N 4FZEL 5CJ5A 3BRGC 2DMCA 1HHJB 3L3JA 3S6CA 3D2UA 3P4MB 4E42A 2BXZA 4Z7WB 4ODSL 3OV6A 3LKNB 3KAAA 5HVHB 7FABL 4BH7B 5C3LD 4CVXB 2Y6SD 1QUNA 4ZUVA 1VACB 2UUDK 1HXMB 4QRPB 3S36X 2DWEA 1GRWA 3FB6A 4P4KD 1BF8A 1C08B 4WWKA 1SJHA 2I5YL 3EFFA 3FFCD 2YMXL 4MDIA 4EDXA 5DRZA 4KZEH 4OCNC 3REVB 4LNVA 2DTMH 1TVHA 4NP4H 2KDGA 4PJGF 4RGNB 4PJXA 3MA7A 4Q7DA 4XCYB 5IEKA 3PGFL 4PTTB 4EUPA 2HYMA 5GSRB 1HEZB 4M1CC 3IDJB 2ENYA 2VLRE 1UYWH 5EO0B 1I3UA 3V4VH 4HCRA 4KJQD 5DD1H 2C1PA 3P0VH 4WU5B 2WUBL 1T2QL 2WMPA 3ARXA 3UTOA 1LEGB 4PP2B 5EZIH 1DBAH 1T2JA 2AJSH 4X6CE 1G9MH 4XHJC 1CDJA 4M3JA 1CGWA 5FM5O 4PLKD 4NO0B 4P3CL 5CEYA 1I1FB 2B8OT 4WFEE 3C6LB 1NMCC 5KSAD 3FT4B 1D5XB 2O5YH 4ZSOE 4NQSB 4P3WA 5GRWA 4YNYB 1S7XB 4NCDA 5GRJL 3U4BH 4PJ8D 5FOBA 1FNFA 3D0VA 1TCRB 4LVOB 3EYVA 3DI2B 5IVZB 5F9DC 1DUZA 1IQDA 3ZKMD 1J1PH 1MCCA 2VXSH 4DZBB 2QSQA 2EEBA 3OTTA 3TBTB 1A4JB 1AGFB 1WVZA 3W11C 2XXMB 4LLYA 2Q86B 1NAKH 5KSUB 5F96L 3UAJD 4MD5A 1JPSH 1CR9H 5K9JH 3CGTA 3BWAA 2HFTA 1NFDB 1XF3B 3U30B 1NC4D 5FA3B 1S5IH 4N1CA 3GBMH 4G8FA 5IHZB 4C59B 4C55A 4GRLD 3WFDH 4JFFB 1BPVA 1T21A 3O8XC 2YPVL 5I1JL 2YPLD 3SDAC 3BSZH 1KXQE 1A4KA 1YEJL 2ZCHL 3ALPA 4FFYL 4RZCB 4HUUB 2BVPA 4K8RD 1Z0MA 2NW3B 1FNEA 4PUBL 2KQMA 2GJZB 5IQ9A 1L7IH 4A6YB 3BP4B 1Z9OA 3GBLA 5C07E 4R7NB 2YOCA 1T89A 4OM1H 1WQVT 5LBSH 4OZIE 5FECB 1GGBL 5KG9A 4FQQA 3PWLB 3PP3K 4R26H 1KUMA 1JGEB 3MQIA 2HWZH 4GLRI 1D6VH 2AGJL 1VSCA 1QOKA 1CE6B 1RZKL 1SM3H 5IB2B 5D71L 2DL2A 1ZTXH 4L5FH 5I8KL 1QSFB 1GIGL 2B5IB 5GGRB 4MX7A 2XZCL 3G6JE 1UWGH 2FO4A 1ORQB 3LEVL 2VB5A 4PD4J 4IM8A 4IRJB 4XRCA 2ILLA 3MNWB 3RU8H 4FQXD 4KQ3L 1FGVL 1AE6H 2ATPB 4KAQL 1MCBA 4R3SB 4IS6B 1YPZF 2XWJA 5JXAL 2IQ9L 3RVXD 2R0WL 5EOQL 3MUY1 2Y5TB 1F2XK 4K7PH 3VXRA 3N85H 5CMAA 1FL5A 4PTUB 4NNXA 1LDPH 3WFZA 1QVOA 4HXAL 3IDGA 2X5PA 4X6CB 4ZUTB 1DVFB 4TUOA 4JE4B 5EU5A 1DQDH 1CGXA 2BNRD 4F9PA 5ADOH 2JJSA 4U1KB 4HIJB 4KK9C 2YD1A 5KSVA 4Y0GA 2P44B 3KPPA 5JQ6L 4XBEL 5T33H 1IGTB 1ZT7A 4I0PC 4JFPA 4ZPTA 2MCPL 1KIPA 3QG7L 2YSSB 5GXBB 5EU6E 1PYWB 3GBNH 1F02I 4YHKH 2E7BA 1RQ5A 5I9QB 4PR5B 1FORH 4N0CD 3VH8G 3GJFA 3RFZC 3IYLW 3FQRA 4CNIB 4Y4FC 1ES0B 3K4DA 3HZYB 5MHSE 1I8IA 1AHWB 2NY6B 2Z9TA 4JRYA 1WWWX 3O4LB 5EG6C 1T5XB 4TVPL 5J6HA 1O5DT 3KXFA 2CLRA 4UMGA 4I3GA 1K8IA 2EDRA 1VFAB 3S37L 3A6BL 3P4OA 5D6DA 3CSYB 4PJ5B 2IG2H 3W9DA 2F58L 4L3AA 5DEFA 5CJQL 1NKRA 1GVIA 2HVJB 4X6EB 3OJMB 2P5WA 1UWXH 3JTSB 4LCUB 1MFDL 4G6JH 2EZ0C 1FNSL 1TPXB 1V3KA 4LSVH 1WFOA 4X5XA 5HDBE 3KYNA 3BW9A 3RWGB 3I50H 1XGYL 1E4KC 3QXWA 1P1ZB 2A83B 5DHVH 5KVEH 1BVKB 3O6MH 1QFWM 3Q3GB 1G0YR 1JYVA 5AZEL 4K7FB 3G9AB 2QR0A 4IOIA 4NO3A 4XXDA 5I16B 1RIVL 1T20A 2X89D 4N9GB 5J7CC 1R3KA 7FABH 2VKWA 1BP3B 2H8PA 1C16A 4DVRH 1OCWH 3WD5H 2GSGA 5IOPA 3VXMD 2FBJL 3STLB 4HBQA 1ONQB 2I5YH 3EGSA 4YHMH 5FK9A 4ODXB 8CGTA 3MLWL 1XF5B 5C1MB 4I13B 2CRZA 3OG6B 5DRNA 5J0BA 12E8H 2ADGB 4LSQL 4OGYH 2HLFC 3RX8A 1U8IB 2DICA 3ARGC 1L9NA 3OAUH 2IBBA 5IHUL 4G8IB 3EJYD 1RZIA 5I0DA 4LHUA 4APQA 1CQKA 1AGCA 1JMXA 3BIKB 3WHE1 5IEHA 5KVDL 2J4WL 5FOJA 3KYKL 1ZV5A 3CXHK 2NX5D 1T0NA 4PV8A 3RZCB 4NRXA 4QOKE 5DMKB 3VXSB 3T0EC 3IB4A 1CYGA 3OJDB 2PTTB 3UZQA 5FYJH 1JFQH 1MJ7H 3GB7B 1KJ2H 1T1XB 1BQLH 2LVEA 2WBJD 3P0YH 2YUZA 4QHNB 2AXGB 3CH1A 1IT9L 2DM4A 5IG7B 5TF0A 1NEZB 2A6DB 2C3VB 3DMMA 4TSCH 1CFNB 4KQ4L 2BX5A 4NQXB 4Q2ZB 3BPNC 3SCMD 2OI9C 3FT3A 2CGRL 3QPXH 5E24E 2MCG1 5LVEA 4MAYC 3MODH 4FG6D 3UROR 1S7VB 5EU6B 1EEZB 1FO0A 2RB8A 4KKCC 1CFQA 1X5YA 1BD2D 5IVXB 1CLYL 5D2NC 4KJWC 2AJXL 3X12A 2VXQL 4LCIL 5JORA 2NY5H 3D85D 3DUSB 3FAWA 1K3IA 2M2DA 2ZUUA 4OM0H 1IEAB 3RKDD 4GRMA 1UZ6F 2O61B 4X98B 3O2DH 4OCXL 3AXLB 1QFPA 2PXYD 3G5XA 2VZVA 4Z7QF 4LEXH 2BNUA 1DDHB 1ZGLB 3MLVL 2ITCA 1HQRB 2XQBH 4N68A 1R5WB 4NT6A 3NIDF 5H37H 1QBML 3ULVF 1MCEA 2D7QA 2BRQA 5EO1B 5E8DH 1FFPA 3QIUB 5JO5A 2YPVH 1OTSD 4Y4KC 1II4E 3NBNA 4J4PD 3MX0A 3UDWC 5DJAB 4PBVC 3KPOA 4EEEA 1F58L 5GISH 3AC0A 3LRGA 1T4KB 4LF3B 3MLRL 5D1XA 4ZD3H 1NCAL 5MP6L 4PUBH 5KSBA 4PJAF 2R56L 3GI9L 4CGTA 3L5JA 4MCYB 3WSQL 5I66B 4JKPL 3SDYL 3IVKB 3T0XA 2OP4L 3L7FB 5DQJA 3GJEA 3SKJL 5CGYD 2N4IA 1R0AL 4FQ1H 2Z31D 1JCKA 1JV5B 5HHMD 2VR4A 1QG3A 4ODUA 1M71B 4KHXL 2GT9A 1OOAA 4I4WB 3LQAL 1XGUA 1FAIH 3QUXA 4Z7OF 3R0NA 5HHPA 5HSFA 1A7OH 1AJ7H 1HSBA 1KB9K 1P53A 3SDDD 1R3LB 4RFOL 1FVCB 1F4HA 5EOTB 4RX4D 3HMXH 4H5SB 5C0EA 4UQ3B 4UQ2A 2OJZH 3PDOB 3MBEB 4WI7A 3UYRH 2XZCH 1QPPA 5F72S 3CFBA 1JPFA 1CL7I 4O00A 3LN4B 4M02A 4QNPE 1BFOA 3AROA 5CHNA 1J5OL 3NCEB 3BESR 5BMFH 1G9MC 2GSIB 1FFQA 4Y5YA 3MRHA 3B9AA 4G6MH 5FM4A 3NH7L 1I8LC 2NY1D 4J1UA 4EVNA 1E4WH 1MFAL 1A1NA 1KB9J 4DFIA 4PJEA 2IQ9H 4JY6A 1BFTA 5K59E 4KXZH 4Q6IA 5EOQH 1J1XL 2Y9RT 4NKDA 2BVQA 4ZS7L 4Y4HB 4QOKB 1A7NL 3HE7C 3VXOB 3TA3C 1XGRA 4G43A 2Q7YB 4JDZA 3D39D 3F6IA 5C0DA 4M7KL 1ZLSL 4LU5L 1H3WM 5ACZA 1YNTA 1FH5L 3O3AB 5HYEA 3MZTA 2OL3A 3HC4H 1FFNB 3MCKB 3PV7A 3PWJB 5E6IB 2YC1B 3PQYB 5M7QA 4LFHD 1U3YA 2BFVH 3BEVB 4DAGH 3KLAA 3GRWA 2W60B 5E1AB 1GGIL 1A7RL 2J6EH 2ZG3A 4Y8DC 1RUMH 3P11L 3P77B 4BM7A 4M5YL 4FQCL 3RGVC 1U0QA 1NBZA 1NL0L 1U92B 4MA3B 2NX5E 3SOBH 5HVGB 5E5RB 4ZAKD 4GXVL 5I1HH 3R0MA 4GBXD 3D69A 2N1KA 3BZEB 3NA9L 2DQFA 4YGAB 4Q74A 2D7TH 1QFWL 4PJFA 4JPIA 4UBDC 3DO3A 2R0LL 1TFHA 1S8DA 2VLLB 3VWKD 5DK2B 2ZKHH 2KPNA 2A9ML 2VXTL 3BVNA 4XVTL 1P7QB 3EO1A 1BLNB 2IQAB 1SBSL 2EDHA 1I1CA 4LCYA 3K8LA 3QWRD 2CKBH 4H0IA 4G6FD 3MNZB 3NCJH 4XP1L 3OPZL 4JZOB 1AY1L 1BD2E 1MCWW 4ELKA 1NBYB 3QJHB 3QPQC 2NLJB 2XG5A 3UYPA 1B9ZA 1IAKA 1KG0B 4UIMA 1EAPA 2V9TA 3QH3B 4BQ9A 2QQKH 4G9DA 4YDVB 2IH1B 3C8KB 1WFNA 5CGTA 5DA0B 5IT2H 1RVFL 4HUWA 2VDML 3BO8A 5D7LD 1WV7T 1G7JB 2IANA 4OV5B 3BKCL 4K2UL 5C0JA 2R1WB 3TPKA 3T77B 4KTDH 3CFKB 4HK3J 2ADJA 2MHAA 1BECA 2AXFA 1TETL 1ERNA 1HWGB 5F3BB 4X6DA 4XB8A 4S2SB 1RIVH 1WEJL 1WC7B 1P9MA 2I60L 1D5MA 3RWFB 4AEEA 4RQQA 1HXYA 5HHQA 4LMQI 4OBRA 1MAML 1MCSA 5ADPH 3CZJA 2FEDC 4QXTA 4WUUE 4Y88A 4WENB 2BNQB 3X3FL 4Z7VF 3MLYL 3TVMD 5D96C 1AKJD 4HFUH 5F1KC 1DQML 4FQLL 4PRAA 3DGGA 3QG6A 3V7AE 5DSCB 4CVUA 2ZJSH 3REWA 1CT8A 1HILA 3CFEB 1IGJB 3QDHA 2AV1A 3VRLF 3HAEG 2WWKT 3GKWL 3KYKH 3HCVB 4DCQA 4XNMA 4HH8A 1S7SA 1NGWB 4RFEB 4F3FA 4HKZA 4P5TC 4JN1H 3FO2B 3TO4A 3OKKB 1B4RA 4Y1AA 2FH6A 3BIAX 5HHNA 4AY0A 3MROA 3OGCB 1YEIL 4MNHB 3E6HB 1IT9H 4WI9A 3ULVH 3QFJE 4IMLB 2RJMA 3LIZL 4PJIA 4LSRH 3MUGA 5ESVB 5CEXA 4LCCC 2YHGA 1ZOXA 5ALBL 5I1IL 2XTJC 3JV6A 2OSLA 1XZ0B 1UKSA 4WWID 3G5VB 3I2CH 4I3SH 4ZXBA 3KNBA 4YK4C 3PWPD 1LHZA 1R3HA 2H9GB 1Z3GH 1MFBH 1VADB 1UM4H 4RIRB 4UINL 4HIXL 3RIFF 3VGGA 3O0RL 2PO6B 4P2QB 5JR1L 2DYPD 4NDMA 1AGEB 4HKBA 4ETQB 4ELMA 4LSDA 5J13B 4NQDE 1FYHB 5A2LH 2UVFA 2UZYB 2BVYA 2H2PC 4OF8A 2IFFL 5HYFA 1NBVH 5LGKA 4EI5B 2OX5A 3D39E 1GGCL 3NABL 3H3KA 1HSAB 3QDJA 3DETD 1F4XH 3EYSH 1MCNA 1H3GA 3HR5A 4YLQT 3CUPB 5CGMA 3KPRA 4RGND 1QBMH 5TE7H 1LVEA 4YR6B 4YQXL 3N1GC 2CUIA 4AM0A 2P43B 2D0FA 5DC9B 2J8OA 4LARH 4MLIA 4MXQC 2FYYB 5TDNA 1L9MA 1V8HA 4OIAA 4FFVC 3IFNL 3MBXH 1YEEH 1YUHA 3C8DA 1HHHA 4UNVA 1OF2B 1OARL 3PWNB 5L2KA 1NCAH 4EOWL 1K85A 4OZFH 4HK3N 5FYLL 3GSVB 1N59B 4JVPA 4PJXE 5I76B 1FVEA 5ALCL 3D3VA 3IAPA 5T5NF 4AT6B 5CEZL 2JF1A 2CK2A 4OKVA 3IFOA 4DW2H 5BVJB 4EXPX 4P57B 2GK0A 1ZA3A 3Q1SH 3UJJL 3IFLH 1RAMA 3FB5B 3AMKA 4JRYD 5L2JB 5TH2A 2ZCLH 2VWEE 1VEOA 4MXVE 2EXWC 2HH0H 4OQ1A 4PJAA 4PRIB 3WUWA 3KXFD 4YHYB 1U8MB 2ESVA 1A1MA 4G3YL 4J3XA 5F3HB 1X5ZA 2XNAA 4F2MA 1MCWM 1T5WA 1BIHA 1EMTL 1OAZH 3MA9H 4OI7A 1QNZH 2IALB 4WUUB 3F12B 3MV7D 1G6RL 4JRXB 3U4EA 2L4OA 4R2GB 1J5OH 2PYEA 1GHFH 5DJYA 3IXAA 2AK1L 1AXTH 3QUML 5C08A 1DP0A 3NH7H 1G84A 2P5WD 1MFAH 4N5ED 3DXAA 3SN6N 1I8MA 3RWJB 2HG5B 2I9TB 1YYLH 4I9WD 5FO8B 4M7ZC 2YD7A 5IMMA 2D03H 1M7DA 2OJEB 2EO1A 4M03A 1XAUA 3VD3A 2BVTA 4D8PA 2GUOA 1U58A 3T4AB 2EO9A 4E5XB 1UACL 1NCTA 2DJUA 5EBMB 1KCRL 3MXWH 3WBDA 4HAFA 4JM4L 3O8XA 3T1FB 1QFOA 4L4JA 1QP1A 3SDAA 5L6YH 3LDBB 3F7QA 1WGOA 2NY5C 3H0TB 3RY5A 3OKLA 4RRPG 3DNKA 3GMPA 3NGBC 3KDMA 3ZDZF 3QFJB 4Q9BA 4LVHB 4WO4C 1B0RB 4H0GA 3IT8D 4PPTA 4WV1A 1JNLL 1VGKB 4HS8H 4ZO6A 5H2BA 4MQXD 2WW8A 1J0YA 3DX6A 5J6GA 3F7VA 4QF1B 2VLJB 4MGXA 3VGHA 3QUYA 1UM5L 3QBTB 4HD9A 2ED8A 5F8QC 3BGAA 4Y89A 4N8PA 4W81A 3MACL 5HHVH 2KUTA 1M05A 3QI9C 2YRZA 4LHUD 4APQD 2VL5B 3OHXA 1QFWH 2B7DT 1CTNA 4JPVL 5C2BL 1YC7A 4DGIH 1R3JB 1BHGA 3D0LB 3TV3H 2P8LB 3TBVB 4YDLB 3WFBL 3UJTL 3MLUH 5GS0L 1Q1JH 1GYAA 5C0CB 4XC1L 4DJMA 4J7RA 4R4FL 5IR1B 4GG6F 3UTTA 1CK0H 3RL1A 4YAQA 4K3HA 2VC2L 4XP5H 4ZUVB 2NY4C 1WWAX 4JPKL 2DWEB 1TQCC 3QCTH 3QQ3A 4KY1H 4NSKA 4WWKB 1SJHB 1NEUA 1RZKC 4NIKB 2IH3B 1MJJA 1DQTA 3CVHA 3GNMH 1EVUA 1TVHB 5FDWA 3MA7B 5IEKB 5T3ZD 4KKAD 2FR4A 3WLWC 1QSVA 4YPJA 4HC1A 3K2UL 3VXRE 3KLHC 5DJ6B 3MCLL 4K7PY 1IGCL 4I0PA 5IFJA 4XBGB 1OW0C 1CDIA 1RZ8A 4TVSa 2FZ3A 4IRSC 5ETUB 1HOCA 4UB0H 1ZGLP 2AW2A 4ONHB 1MQ8A 4PP1C 1FVDB 5DUBA 3HA0A 3UC0L 4GMTL 3KR3H 1TZHA 4X6BB 2BVOA 1F4AA 1QFUL 2D0HA 4UZGA 3WHE0 1PQZB 4M1DL 4GQPH 1G7QA 2OZ4A 1LQSR 4N8VA 3VE0B 2A6JB 3ZHDA 1KENL 2YWYA 2X40A 5D1XD 3SE9H 2AQ3A 4DGYL 3JXAA 2CMRL 5FYKH 3Q2CA 4DTGL 4ODWB 1HCFX 1FNGA 4Z7VA 5DJDB 1I9RL 2X4SB 1DUZB 1RJYA 3QP3A 8FABB 3FO1B 3HPLB 3HE6A 4LSSL 5I19L 4KI5C 4JRYE 4QRQA 1MNUL 4OZGF 3KXFE 3HI6H 3QUXD 4AG4H 5H94A 2V2TA 1RUAH 3VDAA 2VE6A 3NCMA 4G5ZL 1RUQL 4YHLH 1QTYT 4KMTL 1QSEA 1X5HA 5J1AB 3L3KA 1KTLB 1N2RB 5HDLA 1PDKA 1SBBA 5I73B 3BE1L 4O9HH 1I7TB 1CVRA 3QQ9C 1E4KA 5C9KA 2R15A 1U9KA 2HJFB 1GPOH 2P5WE 4FXGB 1FL3B 5L7XH 2EE6A 4O2FA 1X4YA 1AGDA 2C3XA 4I9WE 4X7DC 4K23H 5D8JL 3PL6C 2BVPB 3E6FA 1WTGT 2UWEB 4LLMA 4MNGA 1F97A 1MLBA 2FB4L 5E5UB 1OAYH 4P2OB 4WW2F 1K9TA 1I4FB 1LK2A 2BSRA 5KG9B 1PZ5A 4FQQB 1X5IA 1P7KA 4OD2A 1IAMA 1JJUA 4WY7H 3IGAB 4JG1H 5C0IA 3WO3B 4FHBD 5IF0A 2BDNL 1YY9D 4M6OH 4QY8B 5D7JC 5EZJB 3ARGA 3JV4A 4YO0B 3GJFK 1BWMA 2H3NA 4HXBH 2VN4A 3ROOB 3U48A 1SY6A 4MX7B 5IMKB 1KYOK 4Y2DC 1S9VA 3HRPA 1BQSA 4P3DA 2EKJA 5L9DL 1FBIL 3RWHA 4FRWA 4LPXA 4NQVB 5CEZH 4U49A 3NFNB 3BEWB 1BJ1J 1JL8A 3HNSL 4XP9L 4NZUL 1T66D 4OFDA 1F42A 4P2RA 2EXYD 3QEUA 4MZ2A 2GFBB 4IHOB 4OGXH 1JYNA 4OT1H 3MOAL 4MA8L 1E28B 5CMAB 1FL5B 1DUYA 2CJUL 4JDTH 4UILH 4MAYA 2M1KA 1QVOB 3CDGB 3IDGB 1KYOJ 2GW5A 5AEAA 4ZODA 4U1HA 2ZPKL 4RA0C 5F9AC 5CP3A 3ETBF 5T1DL 3UTQA 5HBBA 5HGDA 3S4SA 2VABB 4WI3A 3KPPB 4J8RA 1CL7L 4YE4L 4ZPTB 1Q0XH 4JM2F 3QIBC 1RURH 4RA3A 1KIPB 3BQUC 3ARDD 1DEEB 3QDGA 3PP4H 1YQVH 4M6ML 5BRZE 3A0OA 4NJ9H 4GAJL 3ARFB 1HHGA 1JWMA 3RPIA 3FQNB 3UXFA 3TH4T 3ZL4H 3C60B 1IMHC 3EW3B 3G5ZB 3G5YA 3VWJA 3AB0B 3H7BA 1JZ4A 5D1ZA 1P4BL 1WCQA 2IAND 2MMXA 5C09D 4Y4KA 3L3OB 4X9FA 5J6HB 3KJ6H 4O5LL 2Q8BL 2CLRB 3T2QA 3UDWA 4KGLA 2C1OA 4YXLH 4XPBH 1I7ZB 3P4OB 4Z7NF 1XEDA 2XV6B 4M1GL 5JW5A 5E0QA 2DQDH 1T3FB 4G7YH 4K94H 5D2LA 2W0FA 4HPOH 2BY2A 4OQTL 5FA4A 3TN0C 3GFUA 1W2KT 3HTLX 1JF6A 1MOEA 1OTUC 2NQCA 4NYLA 3SY0B 1IL1A 4KK6D 4F33A 5ISZD 4K3DL 4G9FD 4BSJA 5A2FA 5KSBE 3RWCB 4WI8A 4G6AC 1LP9F 4ENED 1R5IB 1I1YA 3RX7A 2EYSB 4X4MA 1L7TL 3V6OC 1ZWIB 4JPVH 1ITCA 1DBKL 5IV2A 1IKFL 5AWNL 5E99L 5JW4Q 5EORL 5GS1C 3WNLA 4XC1H 2IGFH 5CBEA 2GY7B 2KKQA 4XXDB 1S7UA 2ADFL 3KPQA 4TSBL 4EBQH 4X8JB 4O58L 1Q9OB 3ZTJG 1T20B 4F9LC 3V6ZA 1EEYB 3BGMA 3GMNB 1I8LA 1C16B 2ADIA 3LQAC 3HC3L 4NQCB 5IOPB 1IE5A 5ICZA 5DLML 4HS6B 4WNQB 1T7YA 4Y4HD 4JHWL 4JR9H 3MRIA 4D9RD 5FK9B 5HGHA 1O7VA 3VGDA 3HE7A 2O26U 4ZXBD 1P7HL 5DRNB 3TA3A 2X4PA 2A74A 3P9MB 4UIKH 3O2VL 2XWTA 3HUJA 2EE9A 3T3ME 1QBLH 5B4MD 1YA5A 4HLJA 1U8JA 2LTQB 2GJ6A 1RFDL 4NJAL 1DFBH 1T0NB 1Y6NR 1QR1B 3P73A 5LQBL 1YNKH 3N0PB 5EZOL 3Q48A 2WAHA 4TUJA 1FN4A 3IJYB 1KB5L 1U8LB 2NTFB 2JJTC 5F21B 1R24A 3QDJD 5IW3A 1KEML 4UDTA 5CD3B 4PJGB 4PRHB 1GJIA 3CH1B 3VFRA 3LQZA 1CDBA 3DMMB 3O6KL 3VXUA 1V7ML 5E8NB 4TQEL 2BSSA 2FJHA 3O41A 1RZFH 5CKAA 4HX1A 3RL2A 2V17H 3R06B 1ADQL 4X0KB 4NM4L 5DHVB 1I9IL 4M1CD 4FA8A 1A5FH 5EC2B 3GSUA 4PIRF 4W6WB 1FO0B 2CRIA 3TJEL 2CMRH 4XNZC 5BRZB 4PREB 4NKMA 3X12B 4KPHH 3GMMA 1YMHB 5E2WL 2YD8A 4LFHG 1CZ8L 5MEOA 3D3VD 3PABB 5FO7B 4XHJD 5CIPA 3H9ZA 1KCVH 4GRMB 4JKLA 4W68A 4PJFE 2VOTA 1K4CB 1W72H 2X44D 4KJYB 4UUJB 1H0DB 4KMTH 3G6DH 5I6XB 4KJPC 4G7VL 1INQA 2ESVD 2PCPA 2DBLL 1EPFA 3RVWC 4D94A 1UVQB 3QIWA 5ERWA 5JO5B 4LDOB 3ARBC 4NPYB 1FYTA 2X2YA 4LPVA 2OTWA 3UJIL 4Z8FH 3KPOB 1NGQL 4U1IA 3WDIA 1IM3A 4NFBA 1XR8A 4RAVB 2X9WA 5KSBB 4KZDL 2BVUA 1X5LA 5HVWA 1KJ2B 3DYPA 2R69L 5MERB 3W11D 3X13B 1IAII 1YMMA 1LO3H 3DXAD 4JO1L 1T2XA 1BQHG 1MWAL 5E6ZA 3MR9A 2EDBA 4YHNB 3QCUH 4JG0L 3K4AA 1RD6A 4GQ9L 2IANE 4F37F 2X4QA 4ODUB 3MYJA 1ZT1A 2CLZB 1NLDH 1M7IA 1MCOL 2G60H 5ITFB 4X6DE 4IOFC 2HTLC 5JUEL 4MAUH 1C7TA 1PG7H 3M1BA 3O8XD 3FRPA 5D5MF 3SDAD 5C0EB 2LFGA 3LY6A 3SKNB 3CX5K 1F13A 4KKBC 4O4YL 3ARSA 1KPUA 3PWUB 5IFHL 3CFBB 4NZRL 2XTLA 3SBWC 5IROA 1RI8A 2IAMC 4ZDHB 2W07A 5CHNB 1WBZA 3QNZA 5FB8B 1EFQA 1F4YH 3H9YA 4LRIC 5EFIA 4FNLL 1S3KH 3MRHB 3QHZH 3ECBA 3QWOA 2E9WA 4J1UB 2FIRT 3KHQA 4P46B 4DGVH 1HIMH 5HYIA 1VHPA 3RWIA 3RWEA 4P9HL 3C8HA 4Q6IB 4CADA 5BVPL 3C5ZA 3BGFB 5DWUH 3ZO0A 3MOAH 2BVQB 1X5GA 2VH5L 4LCCA 3CX5J 5IFAH 4E41A 3DHJA 4Y1AE 5BS0A 5GJTL 1EGJL 3JWDH 4ACPA 4L3CB 2ZPKH 5C0DB 2BOBA 3FRUA 3V6FB 2CR3A 1KTDB 1YNTB 4UNTA 4PJIE 1TCMA 4ODHL 1YEFL 3FQTA 4HWBA 3OF6D 2FHBA 1YPZB 1Q9WB 2YRLA 4HBCL 3FJTA 4YE4H 4ZNEA 3UTTD 3KJ4C 4KUZL 2W9EH 2W38A 4GKZB 3QA3A 3ZHKA 1BX2A 1F4WH 3HC0A 3IDXH 2R1XB 3QNXA 4AIZA 3AGVA 2CH8A 4I3RL 4U1JA 1C1EL 1P84K 4Z0XA 5C6TH 3MGAA 3TEUA 2YKLH 1GXEA 2ATKB 4HWUA 4DOHE 4OIBA 3O9WC 4X7TA 4ELME 1RMFH 3CC5A 1T0PB 4OTXH 4OF6A 5EA0L 3BKYH 2XY2A 4WDIB 1YEDB 4XNUL 1KJVA 5I30L 4KK9D 1FZMA 1L0QA 3QDJE 5F9WC 4CMMA 2X70A 2VDQH 1S8DB 3STZA 2GIYA 4DVBA 4I0PD 5CINH 3V0VB 3FN9A 3BVNB 3LH2H 5HGAB 4ZUSA 3EO1B 3KPRE 3P4NA 5JW3H 5HHOA 2C3HA 4XNXL 4LCYB 1P84J