4P2RA

Crystal structure of the 5cc7 tcr in complex with 5c1/i-ek
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
180
structure length
180
Chain Sequence
IKEEHTIIQAEFYLLPDKRGEFMFDFDGDEIFHVDIEKSETIWRLEEFAKFASFEAQGALANIAVDKANLDVMKERSNNTPDANVAPEVTVLSRSPVNLGEPNILICFIDKFSPPVVNVTWLRNGRPVTEGVSETVFLPRDDHLFRKFHYLTFLPSTDDFYDCEVDHWGLEEPLRKHWEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords H-2 class II histocompatibility antigen, E-K alpha chain
publication title Deconstructing the Peptide-MHC Specificity of T Cell Recognition.
pubmed doi rcsb
source organism Mus musculus
total genus 33
structure length 180
sequence length 180
chains with identical sequence F, K, P
ec nomenclature
pdb deposition date 2014-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00993 MHC_II_alpha Class II histocompatibility antigen, alpha domain
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4p2rA02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 4p2rA01
2Y36L 3WBDA 4Q0XH 3JWOH 5C70A 5GS2H 4MHHG 3CZFB 5HJ3B 2MTPA 3TH3T 2LU4A 2H1PL 4JVWA 2PO6D 4V1DD 1WBYA 1FG9C 1Q9OA 4UQ2B 3RY6A 4Z8FH 3C8DA 3KYNA 1F4YH 3HNSL 1BX2B 5SWZA 5LXGL 2WWKT 1AO7D 4L1HA 1K8IA 2X1PA 4LQFL 4UINH 3KYKL 3S8WA 3GMOA 4S1QL 2CIKA 4PJEE 2Z4QB 4KRPB 4G80A 4ETQB 1I1YB 1KFAL 1MHEA 1OD7A 4AEFA 5C2UB 2C5DC 4MA3A 4S1RH 3ULVH 2XICA 3M17A 4R8WL 3RWHA 5DI8B 3CAFA 3TA3A 1FCCA 2ZCHL 4KROB 3DNKA 3HE7C 3F12B 5C08E 3FT4A 4DFHA 2F58L 1MPAH 1S9YB 2DQCL 3DVGB 4GAGL 4NJAH 5FF6A 4FFVD 1OB1B 5HVWA 1MJUH 3VWJD 5GPRA 3MROB 1K3ZA 4WI3A 5M7QA 5AEAA 1AD0B 2NY4D 4RFOL 4CKVX 1U6AL 4HLZG 2NX5A 2ICWI 5CBEB 5DJ8A 5KS9F 3VGGA 5BS0E 3U7YL 1A7QH 1EFXB 3SQOL 3I85A 4FFZL 1UZ8B 3LZFL 4LGSB 4ZFFA 1FVCA 2RQ8A 4PUBL 5I0DA 1BF8A 3HE6C 2IH3A 2MFNA 4CVWA 1PKOA 1T80A 4LEOB 4O00A 4ZNEA 5FYLE 4GO6B 3IDXH 1LDPL 2UZXB 3MFGB 1OAKH 4O9HL 4LP4A 3LMJH 1Q9WB 1XR9A 1WC7B 4OFYD 3LY6A 4ZUTA 4GXVH 5MENE 5F7UA 4OGZA 1R24B 3UBXI 1CTOA 1FZKB 4X6DE 3QZWA 4AM0B 5TDNA 1T21A 1MLBA 4OCRL 1QKZL 3D39E 4NDMA 2VITA 2HLAB 4XPAH 3WKML 3D2UB 1A47A 4PJ8C 3VCLA 4RIRB 3VMOA 1JF1A 2CUMA 4WENB 1YEJH 3T3PF 2PXYB 4QHMA 3RBSA 5JHDD 5FUOH 4KKAD 1RUKH 2WANA 3MLXH 2YPKB 1RURH 1CBVH 4OFIA 2ADFL 2X70A 5E4EC 4CDHA 3PHOA 1MJ8L 3MRFA 3RDTB 3H42H 3I75A 4QT5B 3ARWA 1N2RA 3ZYJA 4U1KA 1HH9B 1WWCA 1PZUB 5HDOA 3QDME 5GGVL 1J11A 4BK5A 4YHYC 1NL0L 4TOYH 4CGTA 4XBPA 1FL6B 3CK0H 3LVEA 4MQ7A 4Z76A 2O61A 1YDPB 2YC1A 3MUZ1 4LPYA 4QGTA 1RI8A 1VGEH 3NN8B 1R3KB 1HSAA 1RMFL 2DI7A 2NXZC 4MD5B 4PRDA 5TDOB 1VFAB 1F3DH 2ED8A 3GSWA 4GBXB 5ENWA 3S36L 2F8OA 1HQRB 3KPRE 1ROWA 3N85L 35C8H 5SWQA 5IOPB 1LHZA 2GEEA 2CLRA 3LKRB 3SDYH 1M05B 2HAZA 1VFUA 1I3RA 4LLYA 1QOKA 3P9MB 4OD3H 1CGYA 3L7FA 4YPGB 3TESA 1TETH 5ADOL 3FFCA 5DQJA 5FA3A 5C0DB 3PP3K 1MRDH 4DVBA 4EKXA 3BZEB 4G9FE 5IB3A 2DDQH 3DJ9A 4IRSB 3QIBB 2X4NB 4P2RE 2CGRH 3I9GH 1MAKA 1NGPL 1DQDH 3C2AL 4OZFA 1MUJB 4JDVB 2X09A 3S9DB 3MRKB 4L8DB 4U1LA 4GRMA 3OXRB 5DD0H 1UWEL 1IRAY 4Q6IC 5ISZA 4KK5D 3TZVC 4MCYB 4F7PA 4FMKA 1ZS8A 5DS8A 5IW1B 5J6HA 5DDHA 2YPLD 1EGJA 2WBWB 4EOWH 2JLLA 4DZ8A 3QUKA 1SJVA 3CFCL 3GMLA 4M7JL 5KG9B 1XGPB 5HI5D 1RV6X 4P46A 4NSKB 5I1LA 1TTUA 2VXSL 4JZNB 5BVPL 3SPVA 3RGVB 2BNQB 5JLZB 4LLQB 4LSUH 4FTVE 1RUAH 5HHQA 5BZDB 4I0KA 4Z7WB 2BVPB 4MSWB 5FV2A 4NQEE 1WGOA 3C08H 3BW9B 3VFTB 1AGEA 4OT1H 1AQKL 5BJTA 3D0VB 3DYOA 2J8UA 2ZOLB 3CFDA 3GSNL 5I8EB 3BKJH 1QO3B 2B4CH 1P4IL 3SKNA 5E08L 4HPOH 3BZFA 3R0MA 4P5TC 4OFKA 5CD3A 4HIJB 3NZ8B 1M7IA 2PO6A 2NY4C 4KKLD 4V1DA 3UDWC 1F2XK 3DRTB 3I50L 3G5YA 4TVPH 5EUOB 4OLWH 5CKAA 3U2SA 5JOPD 2VAAA 2X44D 2AI0L 3GSNB 1IL1A 1AO7A 4RZCA 2PTTB 1ZVSA 2VNCA 4N8VG 3MV8B 4FZ8L 4WHYG 4W81A 4HF5L 3FO9A 2F74A 3BD5A 3T4AB 1OVZA 5MI0C 2D7TH 1LP9A 2VZSA 2EO1A 5CP3A 2EDQA 3B9KC 2EEAA 2A83B 3U9UA 3U46A 2H32H 1WTGT 5I1KH 3V6OE 2DJ4A 1AGCB 2IQ9L 3BE1L 4M1CC 1DQJB 1LD9A 5C6TH 1AHWC 5DJZA 2XXCB 2NY6B 2H45A 4GS7B 1OSZA 1IAIH 2APVA 1NCUA 1UENA 2XKNB 1NCTA 3EYOA 4Q0XL 3JWOL 5IMKB 3BHBA 3KR3H 3VWJA 1E4JA 4Z77A 1S7TA 2XRAH 1RUPH 3PHSA 1A6VH 4MB5A 2O5XH 4X4YB 3OSKA 4Z8FL 2GJZB 1F4YL 1D6EA 1QSEB 1MOEA 1A21A 1FHGA 5DHXB 5DJ0A 4UINL 5CZXC 3S96A 4L3AA 1ZHNB 3MRHA 4GAYA 5CINH 5GIRA 1V05A 4HFWB 5F44A 4UIMB 4L8BA 3GFUA 4JREC 4P3DB 2ESVD 2AKRA 3ULVL 3EIFA 2Z35A 2R0KL 4S1RL 3WNMA 4OFYA 4ZOAA 2ZUTA 1FYHB 2H26B 3ES6A 1XF3A 4KJWD 1DFBH 1JGEA 2R1WA 3MRIA 3TN0C 4PV9A 4I5BB 1DUYA 1B0RA 1B90A 1C7SA 1MPAL 2AV7B 4NJAL 5SV3A 1DDHA 1H0DA 3CSBA 4N8CH 5INCA 1MJUL 2BVYA 3IFNH 1AGFA 2OM5A 4DKAA 4LIQE 1CFNB 4KV5E 1T1YA 1JNHB 4X9GA 3MREA 3AU1A 4JJHA 1A7QL 1UGNA 5E2TH 4Y2DD 3QWQB 3E6FB 5JHDA 1K4CB 2E9WA 4AMKL 2H6PA 4JCLA 5E2JA 2WAHA 1U3ZA 1NMCC 4TULH 3MODL 3EYVB 1WWBX 3PDOB 4OF0A 5I73B 1IEHA 1Y18B 1GGTA 2HKHL 3IDXL 3IDMA 5DQ9A 1OAKL 3V6ZB 3LMJL 1IKNA 4FZEH 1DUZB 1TDQA 3LQAC 2W0PA 5IW6A 3MLPA 2VDLH 3I3BA 4GXVL 3JV4A 4PJFA 4C56D 4JFOB 2HFEB 5GGRB 4AIZA 3QO0A 2VLRD 3U79A 3QXTA 5F93C 4UMGA 4LHQB 4XNZB 4XPAL 4QO1A 3X3FH 5GRUH 5DMKB 2P47B 4Z7OF 1S3KH 3UZVB 3BO8A 2IH1A 3L5JA 3FOLA 3RWGA 1YEJL 4ZXBC 5I0ZA 1I3GH 5FUOL 1FAKT 3MLXL 3DETD 3HAEA 1RURL 1CBVL 2F5AH 4NWTH 1AKJB 3HS0B 2Y1VA 3MRCB 5CJ8A 2XY1A 2X4QB 3DTXB 3EYFA 4J4PC 1NGZA 3L3HA 4U6VL 3GIZH 2HYMA 1KIPB 3L3KB 1R3JA 5IHUH 3ZKSD 2FSEB 4TOYL 3T0XA 5ITFB 1HINH 4URTB 4ZAKD 3CK0L 4G6MH 4XZUB 1V7MH 5D70H 2BZDA 2VQ1A 3BMVA 3FQUA 1VGEL 2WMPA 4OD2A 3K4DA 5C86A 1Q1JH 1C08A 5BRZE 1ZLUK 4RAUB 1RK1A 5F7FA 4L8SC 5F1KC 1UCBH 5KN5A 2P7TB 5CLWA 4G8IB 3PV7A 35C8L 3ZLQC 5FYKH 4ONHB 4I4WB 3H9HA 1JFQH 2YPLA 3SDYL 3QNXA 2NW2A 1KJVB 1Z0NA 2XFXB 2GSGB 4HX1B 2CR3A 4OD3L 5EIIB 3DX6A 4CJ0A 1A6ZA 1TETL 4X4MA 3UAJD 1KGCE 5MEOB 3NPZB 4LCCB 1MRDL 3ZE1F 5C0GB 3U30B 3ZDZF 4YNYB 2DDQL 5T1LD 5HHVL 2HMID 4W4OC 3BZ4B 2CGRL 3I9GL 1N6QL 3CVHH 2XY2A 4U1JA 1CF8H 1AR1C 4PJIE 1F6AB 4JM2D 1LE9A 3LN5A 1X5AA 4PJCA 3FB8B 3PWVB 3AMKA 5DD0L 2HVKB 3D9AH 2A9NL 4NQTA 1ZHBB 4YEEA 3PWPD 1WAAF 4JQXA 4IOFD 4U4BA 4QYOA 5EU3B 4PRAB 2A6IB 5D5MB 4WV1A 4EOWL 1HHIB 4CNIB 3STLA 5IVNA 2DQTL 2ZSVB 4QRTB 1KULA 1G6RA 2Y07H 1WIPA 2P5ED 2ICES 4L9DA 3K2MC 3GUTB 4LSUL 1TQBB 5JW4R 3VXPB 4R3SB 3C08L 3O0RH 1H3WM 4KJWC 2E3VA 4OT1L 2X1WL 2XWTA 4JLRA 5IIEA 2ZZUT 4X9FA 4OUUA 1TPXC 1EPFA 4JVUA 5C0IA 1IGJB 1P7KA 3HLAA 2D0FA 3BKJL 2B4CL 5I1CH 4HPOL 2NZ9D 1KCSH 2IBGA 3MV9B 1A9EB 3G5VA 1VACA 5D2NB 3L5IA 4WNQB 4TVPL 4OLWL 2B7DT 4NNPH 3QI9C 4M3KB 4KRPD 3IDGA 5EU4A 1Q8MA 5FA4A 4F80A 3VGAC 1NMAH 1JZ6A 3OKLB 4KTYA 3BIKA 3MLRH 5KVFH 1HHJA 1GIGH 5IV2A 5F9OH 5GSRA 2D7TL 3WV0A 4KROD 1PKQA 3E0GA 3JTSA 4NRXA 4YX2H 5HHOB 2ESVA 3IVKB 3RZWA 2XZCH 2EXYD 3HI1B 1KCKA 1S9WA 5I1KL 4OQTH 4Z7VE 2P42B 2J6EA 4PJXA 5C6TL 2XQYK 5I74C 4JKKA 1A7PH 4H1LA 4XCNB 1VFMA 4P2YA 5D93B 3KR3L 2XRAL 1RUPL 4HUXB 2YXFA 1A6VL 4O2EB 4Z78A 4R97C 2K1MA 2O5XL 1W0WB 1CCZA 3ZSTA 2UZIH 4JRYB 4Y2OA 5E00B 1U9KA 2CKNA 2DWEB 2WIIB 4YC2B 1S7RB 1EBPA 3C60C 1NBQA 1ZA6A 1AQDA 1OARH 4Y2DA 1IILE 1LQSR 3AS2A 1G7LA 2JELL 1Q0YH 4QHUB 2RR3A 4NBYB 5E8PB 2ATPA 4PG9B 5CINL 1XH3B 3VMNA 2A6KB 1RIHH 5ACZA 4PP2A 5IG7B 4GFTB 3RA7H 5EOQH 4KK9C 5BOPA 1E6JH 3QIWB 3D2UD 5MHSE 1DFBL 4AEHH 1OD9A 4LPWA 4C56A 5KSVA 1QSFD 4TSAH 1CYGA 4ZAKC 3G5ZA 2VLRA 4LOUD 3LS4H 2PXYD 2DOCA 2GTZA 1CICB 5TF0A 1SYVA 1MY5A 4XCYA 4OZGE 3QEGH 4CUCA 3PP4H 2IAMB 3BQUC 4XMKH 5HVHB 3IU3A 2XNAB 3QG7H 2XTLA 3STZA 1WZLA 1GGBL 5E2TL 5ESAB 3SCMC 2VN7A 2W59A 3M1BA 4TULL 4BSVA 3W9DB 4LSTH 3FT3A 3QEHA 3F7QA 4QCIA 1FE8H 3H3BC 1KENH 4X83A 4U31A 3RUGF 3OAYH 2RAMA 4OKVA 4EIGB 1T2QH 2VDLL 4DCQA 1ZT1B 4XRCA 5EOTA 5H37H 4LCUA 4GBXD 1ZAGA 3QQ9D 4JFHD 4ZAKA 4DKDC 3TBWA 1KLGA 3X3FL 3DROB 2VWEE 1J8KA 1P7QB 1S3KL 1CLZL 1TTFA 4L5FH 3T0VA 2ICEA 4P3WA 4D0BA 5L0QC 1PY9A 3TIEB 1MVUB 1P6AB 4G6AD 3HUJA 3DBXA 4KH2A 4Y1AE 1MY7A 1UH2A 5FM4A 4D0CA 2VL4A 2ADIA 1I3GL 1EVUA 3ZHLA 3NFNB 2ZCLH 3RIAF 2O26U 1Q9LA 5GS1A 2AK1L 3MV01 4NWTL 4IRSD 3QIBD 3N1FC 1YUHA 3H8NA 3VXOB 1XF2B 1YMHB 3GGWA 4UT7H 5ETUA 3LDBB 3GIZL 1V3JA 1FNEA 3FT2A 5EU5A 1KLUA 5BXFB 3MNVB 1EJOH 2J5LC 5T1LA 4ZDHB 5IHUL 3SY0A 4LPVA 4XTRD 4Y19B 1HINL 2P5WE 2P24A 5GGUA 3VI4E 4G6ML 1V7ML 2EDOA 3QISA 5D70L 2Z8SA 5DJXA 4JM2A 1FNSH 1Q1JL 3OKEA 2C3VA 4G9DA 4JKWA 4XH2B 3FFDA 5KANG 4F9LC 3QG6A 1UCBL 4X6CF 4WHTB 3MJ9A 1E4KA 3PWPA 1KJMB 2OTWB 1FNHA 1F4WH 3WIIL 4RAVB 5AUMB 3KDMB 5FYKL 1JFQL 1CXFA 2BNQD 4MXQD 4NKIH 5DZLA 4JKPH 3BI9X 3V0VA 3UX9B 4JO4H 2EDRA 4HMDA 4RCAA 2I27N 4KZEH 1B4RA 4U1IB 1TITA 2DWDB 3WLBA 2P5EA 2ZJSL 4HH8A 4A6YA 5C0RH 2X42A 3HR5A 3L3OA 4CAGA 4LRIC 4NM8L 2W65A 5CLTA 3CX2A 4YFLF 5HJ3A 3FHQA 3CVHL 1CF8L 3ZKMC 2QQNL 4NO3B 4MS8D 3D3VB 4ERSL 3IAGC 3IETB 5EUOE 1A6PA 1HXYA 1LE5A 4Y8DC 4ISVA 2AXJA 4RMSA 3UROR 5J57B 3CVHB 1ZWIB 5AWNH 3VDAA 3MV8D 3D9AL 1WBXB 4HH9A 2GTWA 1ZT4B 1GL4B 5CZKA 3B83A 4LPTA 2HN7A 1I1YA 5L8JB 1NGWB 2MMXA 3GSQA 1QQDB 4PGEB 4JY4A 3RWEA 1MCCA 3S4SB 3F7PC 2QSVA 2Y07L 2AXFB 4UB0H 2NY6D 2QQKH 5DFVD 1S9YA 3WD5H 3E3QC 1OB1A 3VFMB 3O0RL 2A73B 1ETZB 3MROA 3WSQH 4OCSH 1J18A 3WUZA 5TE4H 5D1XC 4WFHE 1AD0A 2P43B 3ESUF 5IFJA 1EBAA 5KTEH 1QSED 1QSEE 5IVOA 5CBEA 5GS2D 4WI6A 3LN9A 5GGTH 5I1CL 5FV1L 1KCSL 3BEWB 1UZ8A 2GY5A 4Y4FC 3SGKC 4U0RC 1EAJA 4GRWF 1K3IA 4JDZB 4NNPL 1NCAH 1CU4H 1MVFA 2XZAH 5AAWA 1NMAL 5EDXA 1WC7A 4Z7UF 5I9QB 3MLRL 5KVFL 5FKPB 3QNZB 1N6VA 1GIGL 1G7PB 1S9KC 2D9CA 4OCWH 4I77H 5F9OL 2I25N 4LVHB 3FQNA 1R24A 3H9SE 4ZFOL 43CAB 1S7QA 4HIIB 1FZKA 1B0GB 4YX2L 3ULVD 2PCPA 4AM0A 1KPUB 4I3SH 2XZCL 4I48A 3UTPE 1U92B 2XN9E 3OKNB 3EW3B 4OQTL 2HLAA 5GS0H 3D2UA 4TTDC 5F1IB 5D6CB 1JI1A 5D6DA 4RIRA 2GFBA 1QSFA 1QHOA 4KDTC 1CG9B 5BZWB 3FB7A 2PXYA 2R0LH 1BWWA 3MR9B 3LKQB 4O4YH 3JWNC 2YPKA 4NUJA 3TBYA 4PJAE 4JN1H 5AZEH 4KJPC 1T66C 2HTKD 2UZIL 2YD1A 2H2SD 3Q3GB 4JFQA 5LGJB 5I17A 4QT5A 1OARL 4CVXB 2F54B 3LQZB 3DOSA 1HH9A 1Q0YL 3BWUC 3T1FB 3LB6C 3T0EC 4NQCD 3C5ZC 3MUY1 3ZE0F 2FYYB 3RA7L 3WO4C 5EOQL 5GZOC 1E6JL 2V5YA 4P5MB 2D3VA 4AEHL 2NLJB 3NN8A 1RZIA 4MD5A 1D6VH 1ERNA 3DX7B 1MREL 3QCUH 4GBXA 1VEPA 4LU5H 4E42B 4KI1A 5IF0B 1MCNA 3LS4L 2OK0H 1SEBB 4P4RA 2GKIA 2ZKHL 4QHKJ 3QEGL 5DSCB 1T5WA 1M05A 3PP4L 4NQVA 4XMKL 1MFNA 3H9ZA 3P9MA 3SKMB 3QG7L 2O5ZH 4YPGA 4F15C 2Y5EA 5C0DA 2EZ0D 1H3PH 4PJDF 5F7WC 4R4FH 4ZS6C 5DFTA 1F42A 2C26A 4IRSA 3QIBA 1RJCA 2RB8A 2X4NA 4LSTL 1SQ2N 5DC9B 4QF1B 1FE8L 1KNOB 1KENL 3KHQA 2EH8H 1S5HA 1T2QL 5IP4A 5DLMH 2FHCA 3MRKA 2DLIA 3OXRA 4RWYH 5DD1H 5ESQA 4OLUL 2NY7H 3RWDA 2K9UA 4U6YB 3RHWK 2GSIA 4L5FL 2CRMA 5KSAD 4LAQL 3VW3H 5I15H 1D9KB 3PHQA 4DN4H 4G8GB 5KG9A 1G9EA 5E6IC 3MUJA 2D03H 4NSKA 1NCWH 4UBDD 2W60B 2ZCLL 2BNQA 5IK3A 5JLZA 5DMYA 3G6JB 3MOAH 4LLQA 3DURB 4UOJA 5DEFB 5BZDA 2ZPKH 4Z7WA 1E28B 3QUMH 2BVPA 3OKDB 4MSWA 3WO3B 3BW9A 5F3BB 3QCTH 5ALBH 2FX9H 4YFLI 1YC7A 4UT7L 4DUVA 3BDBA 2P46B 2D31B 4POZC 4G6FB 2ZOLA 1EJOL 4GG6F 2E6QA 5HHPB 5K9QG 3O6LL 1SM3H 1NCNA 3NZ8A 3F7VB 5IUSA 1CFQB 1MRFH 2JF1A 4OF7A 5IJKC 1QR4A 1WF5A 3MJ8A 4NN6C 1XF1A 1FNSL 3GSNA 1V8HA 1TZGL 2CIIB 1JGVH 2CLVB 2PTTA 3GI8L 3P9WB 3MV8A 1C5CH 2QKIA 3W39A 3EHBC 1DBBH 1F4WL 3GKZA 3T4AA 3ULUE 2CUHA 3QDAA 4NKIL 4JKPL 1ZGLA 2A83A 4S1DD 2VTFA 1XGTB 3SGDI 4FFWC 1C5DB 3MBEB 1A7OH 3O11B 1ZT7B 1ZTXH 1DQJA 4R4BB 4X99B 5C0RL 1OW0C 2XKNA 1FH5H 1D3CA 2XXMB 1UM6H 5HY9B 1MJ7H 1WK0A 3CUPB 1CDUA 1EJ6A 5IMKA 3MV9D 5CUSH 1OTSD 2VUOA 4TPRH 5D2NE 4JZOA 4X4YA 2GJZA 2Y9RT 1OAXH 1QSEA 2A2QT 4XT1C 1A6WH 2Z8WC 5FOBB 4RGND 5AWNL 4YHOH 4R4ND 1VHPA 1I85C 4P48A 5HI3D 4S1SH 2CRIA 4N9GA 4TVPD 1ZHNA 1RZJC 4DEPB 4HFWA 4H20L 1EEUA 1KPRB 1X4YA 1MIMH 5HHOE 4DZBB 4NC1E 4JPVH 4MCZB 3W9EA 2H26A 4U49A 4MJ6A 4UB0L 1BMGA 4AY0A 4I5BA 5JNYB 4IRZH 5I6XB 3DARA 2AV7A 3C9NA 3WD5L 4D2NA 3QEQD 4PGBA 3WSQL 4OCSL 5TE4L 2R0ZH 1CFNA 5JW3H 4JG0H 4K9EH 4XC1H 5KTEL 3U4EB 1V3LA 4JRYD 5FM5O 3X13A 5GGTL 5D1ZC 2LQRA 1TZIB 4LARH 4YHLH 3BKCH 1K4CA 2PN5A 4GXUM 1K5NA 4JFXA 1ED3A 4NN5C 2X9WA 4YDKH 5DHVB 1JZ3A 4UOW0 3EYVA 3PDOA 1CU4L 3V6ZA 1H9VA 1JWMB 1FL5B 1I1CA 2OCFD 3CFKA 1DUZA 2EEBA 3I02A 1M7DA 3QIWD 4OCWL 4I77L 3UZQA 4NQCA 2GI7A 1W8OA 3V8CA 5DO2C 4NC2B 3EDKA 4I3SL 1FGVH 2HG5B 1MCPL 4MQSB 3EZJB 3GMMB 1CICD 4JR9H 2LV4A 5GS0L 2YEZB 3C09B 5DMKA 5FUCE 2IAMD 3P4NA 1M6OB 5CJXA 4XP6H 5LVEA 1NDGA 3FN9A 4Z6AT 4ONGL 4O4YL 4LLDA 3OAZH 5IR1B 4JN1L 5M95B 5AZEL 3HS0A 3MRCA 5D96C 4NC0B 3OR7B 1E0OB 2H3NB 4JRXE 3VWKD 3VFGH 1JGLH 1T04B 3RWFB 3JV5A 1OPGH 2EDEA 2KL6A 1KIPA 3L3KA 1YN6B 3KYAA 3PGCB 5FHBH 1IQWH 4XNUH 1PDKA 4NO0D 3U0PB 1DP0A 1BFOB 4XZUA 5CS7A 2A74B 1A22B 5C3TA 3VG9B 4MNGA 1IAKB 4KPHH 1P7QD 1D6VL 1I7UA 1JPFB 5J8OA 3QCUL 5CP7B 1U93B 5E2UH 5I1DA 2CO6B 3RAJH 2OK0L 2GITA 2P7TA 1NSNH 4G8IA 1CGVA 4YDVB 1MNUH 1T89C 4ONHA 3SDCB 2XYCA 4I4WA 4NNYB 4HFUH 2XFXA 5KSAA 3VXSB 2WV3A 5EIIA 2O5ZL 4L9LA 5MEOA 4WRLA 2BMKB 4LCCA 2NY0C 5C0GA 3LEXB 1H3PL 4YQXH 1BREA 4R4FL 2VR4A 4S1DC 4Y5XB 2VZ3A 5DD3H 2EYSB 4O02H 4PTUB 4Y19E 4HK3N 2Z92B 1P84K 4HKZA 3REWB 2EH8L 1VESA 1NDMA 4YGAB 5DLML 2QL1A 1RULH 4GRLB 3K74B 5KS9E 3PWVA 4ZUUA 4RWYL 4OKDA 3QDGB 2VZOA 2NY7L 2FWOB 2IF7A 1RVFL 5EZLB 1YY9D 1LGVA 1ZHBA 4HS8H 1T5XB 2HT3D 5EU3A 4PRAA 3EZ8A 4N68A 5D5MA 4XI5C 3ZKND 1HHIA 1MFEH 4R96A 4CNIA 2Q7YB 3VW3L 5I15L 4DN4L 5HI3C 1P5VA 2CDGB 2R2CA 2ZSVA 1WICA 4QRTA 1ZLVK 2D03L 1NCWL 4AQOA 5FYKD 4NO2B 1FZMB 4MHHI 5E03A 2XTJB 4KUZH 3MOAL 3GUTA 1XGUB 4JQIH 1Z9LA 1DEDA 2ZPKL 3QHZH 4Z7QF 1IJ9A 3QUML 4E41D 3VD7A 1QFWH 4RAHA 3HI5H 1TVHB 3QCTL 5ALBL 3CDCA 3ZT5A 3D3VE 3LRHA 3KJ6H 3OBAA 4E0RB 1IGJA 3T65A 5JXED 3K8KA 3MV9A 1A9EA 1SM3L 4ZPTB 1MRFL 4KKBC 1DVFC 4S10A 4WNQA 4P4KB 1IAOB 3VA6A 2X05A 3MRDB 1O7VA 1JGVL 3IS0X 5B3NA 5J4MA 1JWUB 3MLVH 2V5SA 1BIHA 2BVEA 5EBLB 5F7KC 3V6BR 1C5CL 1JBJA 1DBBL 1FIGH 2M8XA 4OV5B 4RMUA 2UY7A 1P69B 3L9RA 3MA9H 3IYLW 1A7OL 1F3RB 5F7MC 5D7KE 5TH2A 3RQ3A 4XPTH 1UC6A 3QB7C 4FOMA 1HYRC 3MCG1 1FH5L 1CD8A 4ZUWB 3NTCH 2H32A 3QEQA 1UM6L 5D2LB 4IMLA 5EUKB 4QRRB 1MJ7L 3OPZH 1KJ3L 3FRUB 5CUSL 5HHMB 4HUXA 4TPRL 4EUPB 4X7DC 5EU6B 3UMTA 1OAXL 3QDJB 5FB8B 4IJ3B 3MZGB 4JRYA 1QSZA 3RNKB 2WIIA 2DWEA 1A6WL 1S7RA 4YHOL 3T0AA 1YEIL 2BOCB 4S1SL 5FGSA 4QHUA 2V9QA 5E8PA 2DLGA 1BPVA 1JRHH 3S5LB 1MWAH 5DEGB 2A6DA 1MIML 3K1KC 4TTGA 5GGSA 3K7UA 3LAFA 5FHAH 3UJIH 3UTSB 3P40A 4JPVL 5FFLA 4Y5VA 3FQTB 3W11D 5DWUH 1B6DA 3QIWA 4OCLC 4PJGA 5F1NB 5C9JB 4L8CA 5GHWH 4IRZL 4CU7A 3LH2H 2IPUG 2X4SB 3O3DB 4HUWB 3TO2A 2OR9H 3UP1A 1CICA 4EVNB 2R0ZL 1P84J 5JW3L 4JG0L 4MNQB 4XC1L 3RZCD 3KVQA 4JB9H 5IBTH 2HTLC 4U7MA 5F6IC 5DRWB 5H8DA 4PY7B 3E6HB 1FAIH 3DMMB 3S3JA 4LARL 5ESAA 2J8OA 1U8PB 1XIWB 4Y88A 3BKCL 2F54E 1EEZB 3RVUC 1G7HB 4YDKL 4FQIH 5ABDE 3W9DA 3ARFB 3ELAT 3L7EA 2G5BB 3QRGH 3VWKA 4PJBB 3ARTA 1JWSB 2B2XH 1ZT1A 4DKEH 5E1AB 3AROA 1CGSH 2MQCA 4IRJC 1OCWL 1B9ZA 1FGVL 4J3UA 4NO0A 3F7RA 3BP4B 1SYSA 5C0CB 3DROA 4OM0H 4LLWB 1P7QA 1CT8B 3TIEA 3C6LD 2ARWA 4XP6L 1RHHB 5IB4B 1WZMA 5ELIA 1YECH 4BUHA 3KS0J 2DF3A 1MI5B 2FJFB 1V5JA 3HZMA 4OFVA 4OZHB 1QLRA 3ARYA 3FRPG 2EIBA 5F3HB 3VXOA 3VFGL 2AABH 1YMHA 4NZUH 1F97A 5EULV 1JGLL 2DM3A 1OPGL 2IBZX 5FDYA 5BXFA 3MNVA 5FHBL 5T1DH 1IQWL 4XNUL 4QRSB 5DRNB 2XKSA 4MZ2A 1J0YA 5T33H 1G9NL 1LEIB 5GRZA 2EKSB 1C8PA 4KPHL 1BD2B 2VLMD 4XH2A 4MXWL 3MQIA 1HYSD 3IGAA 5E2UL 3RAJL 4Y89A 3B9EA 4G8GD 2I07A 1NSNL 1KJMA 2OTWA 3QWOB 1MNUL 3ARGB 3E1F1 4RAVA 3KDMA 5HYQB 4BZYA 3U36B 4F7EB 4HFUL 2OL3H 3N1PC 2KH2B 4PP1C 3AS1A 4JHAH 5IB5A 1DN0B 4GUPB 3W82A 3GB7B 3H3PH 4U1IA 2DWDA 3I6GB 3QXVA 4YQXL 5DA4A 1OAYH 4HXBH 4PRNA 1II4E 1RJLA 5DD3L 3VFOA 4HGMA 4E41A 4O02L 3O4OC 5LG1A 4FS0A 3V4VH 1CXEA 1S9XA 3PWNB 3QJHB 2E7BA 2WP3T 1RULL 5JUEH 5IVXF 5D71H 5JXEA 1G7IB 1HCVA 3MJ7A 1IM3B 3CVHA 1ZWIA 2J1KA 4XHJD 1HHHB 5F9JB 4HS8L 5JIPA 1A1OA 5B38B 3ZKXC 1MFEL 4RNRB 1HEZA 2X9YA 1JGDB 1QQDA 4PGEA 5JOFB 4AG4H 5TJWK 4Y4KB 3VA2C 1GGIL 3S4SA 1ZSDB 5HYSB 3VH8B 5JXAH 2AXFA 1OAZH 1JZ7A 4KUZL 1DQLH 2X40A 4HMEA 1BVLB 4WGVB 1JHKH 3F5WB 2W91A 3QHZL 3BKYH 3R0NA 4LLMB 4Q9BA 3GMRB 3HI5L 2SEBB 1OLLA 1IEBB 2PF6A 3KJ6L 3BD3A 3CSPA 4R7DB 1DBAH 5D7LD 3TWCH 3BEWA 3WDJA 3DUUB 2FB4H 4MA7H 1QYGH 2WQ8A 4ENED 4O2CA 4JDZA 2Q8BH 4NM4H 1TIUA 3V6OC 1T7WA 2MHAA 5J13C 1MQKH 5IMLA 3MLVL 1PG7L 3TYFB 4YBQC 3UTTB 5MEQB 1KSRA 2HWZH 5FKPA 2YD9A 3C2SA 1JHLH 5SWSE 1FIGL 1I1AB 2J8HA 4BFGA 1UH3A 43CAA 1B0GA 5BW7A 3WLWC 3SDAC 3MA9L 4EDXB 4IMKC 1U92A 5K9JH 5I1GH 4WW2B 5HD8D 1MFBH 4HS3A 3DXAB 1L7IH 1OHQA 4XPTL 2R0WL 5F7YC 4JGUA 1Y6NR 5F1IA 4ZFOA 4ZO7A 3EJZC 4R0LA 2R1YB 3SO5A 3NTCL 3BVNA 5GRVK 1F4AA 5DTFB 4JJ5A 1CGUA 3OPZL 4OQTA 4ZD3H 4HG4K 3T09A 3LKQA 1UG9A 4KI5D 4GAFB 3RZCA 4MAYB 3VXRD 1VFOA 4FQ1H 2X1XR 4EDWH 1U8NA 5JORB 5LGJA 1A6TB 2XWBA 3QULB 4CVXA 3RL1B 3ZE1E 3LQZA 3ZDZE 2D7OA 1Z6JT 3A6BH 4YDLB 5CEYA 1JRHL 5IGXH 3HKFA 1EERB 1MWAL 1RZKL 4X4ZA 5ECJE 5KSBA 1FSKB 4LKXB 2FYYA 5FHAL 5GGQH 4M7ZB 3UJIL 1RZ8B 5DWUL 3BMWA 4QRUB 1WFTA 2NLJA 2ERJB 4W6XB 5J1AB 3SE4A 3IAQA 1MWAB 2NXYC 3DX7A 3UBXG 5GHWL 1OY3B 4MLIA 1WCBB 1UQSB 1QR1B 4CMHB 4HGWB 3ALXA 4J1UB 5IW3A 2OR9L 4GJTB 5DSCA 3V4UH 3EFFA 4FQPA 4ACPA 4JB9L 3MTRA 1XGRA 4KK8D 5IBTL 1KPVA 1NAKH 1MHHB 3SKMA 3C6LA 3OR6A 1FAIL 1OF2B 3U82B 4K7PY 3GBNH 3FKUS 4Y4HC 4ODXB 5D7JD 2M26A 2NMSA 2WK2A 4XCCH 4KU1A 4JZJB 4C4KO 4QHLB 3QRGL 1KNOA 3MGTB 5DD6B 1K6QL 2B2XL 5IJVB 4DKEL 4WTWA 5FM8A 4NZTH 4U6TA 1CGSL 3GI9H 5HHXH 1PGRB 1IZJA 2FIRT 1CDCA 1DQQA 3WEXB 3QUZC 2DKSA 4QOKB 4G6JH 4PGDB 3VRIA 2VXQL 1MCJA 3S3PA 4OM0L 3IT8D 3BPLB 2NY2B 5T3ZD 5T3ZE 4YK4C 3VXSD 4XHJC 4LHJB 4YDJB 3V2AR 4U7KA 4G8GA 5CD5D 1JPTH 5EOCJ 4ZQKA 3MX0A 5H35B 3WE6B 1GOGA 1KTLB 3G6JA 3HZVB 3DURA 1QLFB 5CBAB 5DEFA 1CGWA 5B8CB 4HUVB 1F6LL 3OKDA 1D5XB 2ZNXA 3C8HA 3WXWH 3VE0B 4D8PA 5F3BA 2AABL 3MRBB 4NZUL 2AV1B 3JWDC 4Y5YA 3K4AA 1K8DB 4X6DF 5F6HI 4GRLD 2D31A 3BD4A 3FQWB 5T1DL 3VD5A 5HHPA 3QDGD 4D9RE 5T33L 3F7VA 1CFQA 3WN5B 4W70A 1OP5K 1YMMB 3PWLB 2X6MA 2CLVA 2DBLH 3ILQD 1LO5B 2OP4L 4HSQA 3C5SA 1SVCP 2HT2C 3GIVB 4D9QE 3B6SB 4P49A 3ARQA 2XTJD 4HG4J 3N9GH 1QFPA 4QRQB 4YHPB 1XGTA 4LCIH 1C5DA 1HE7A 1ZT7A 4H8WH 1ZKAA 4BH7B 4JHAL 5DMGC 3KNBB 4PFEA 1GZPB 5IFAL 3H3PL 3I84A 4R4BA 4HXBL 3U7WH 1OTUC 2Y06H 1FG2A 2OL3B 4MVBC 1YNLL 4WO4C 5IVZA 5DA0B 1ZK9A 1U8HA 2HRPH 1S7XB 5C92A 1G1YA 3QUYB 5CSGA 2LAGB 3W2DH 2DL9A 4WJ5A 4YLQT 5JUEL 1VFBA 5D7LA 5D71L 4EI5C 2H41A 2YUZA 2CRZA 1TTGA 4QRPD 4KI5C 3QBTB 3CLEH 2ZUYA 1KPRA 1YN7B 5EA0H 4OGAD 4DZBA 4RMWA 2VC2H 4LPCA 3IJYB 5JXAL 4M9OA 4CVZB 1OAZL 3H7BA 3ROLB 3FB6B 4LF3A 1DQLL 1KTRL 1JHKL 4QRRD 1FFPB 2AEQH 5J1TC 3MJ6A 5HHME 4LLUB 1VB9A 4DK3A 2DL2A 5EU6E 1U8IA 3U4EA 1J8HE 5E9DE 3QDJD 4MJID 1BGXH 2HT4D 3UPRB 3CDGB 3TWCL 5GS0C 3K8MA 1IGFH 2VZTA 5C0AB 3MNWB 2FB4L 4MA7L 1QYGL 4C57C 5EN2B 3QHTC 4FQJL 1OP3H 2IANE 3T0BA 4KJYB 2Q8BL 3VXRA 2VXVH 2CXKA 3IJHB 4NM4L 5CKGA 5CGMA 3PDGA 4FXKA 5GGTA 1MQKL 1NEZB 5F88B 1JWMA 4Y8AA 2HWZL 3UTSD 4H0IA 3UTSE 1MELA 3AXLB 4I18B 3U6RB 1JHLL 2KPNA 3HZKA 2UWEB 5L7XH 1RJYB 1JHTB 1ZHKA 2AGJL 4AL8H 2HG5A 3AAZB 3BIAX 1TENA 5K9JL 3N50A 3PIQA 1MFBL 2YEZA 3VG0H 4LVNC 1L7IL 3KWWA 4RBPK 2VIRA 3G6DH 3MCKA 4MNQD 2CH8A 5FYJE 3R06A 1Z5LA 4K3JH 4JO2H 2W9EH 1JE6A 4YHMH 3DMMD 4X6CE 4ZD3L 1XIWD 2QJDA 3IFLL 5HGGS 1KLFA 5IR1A 1BQLH 5C0BD 4HUUB 2V9TA 4U1HB 2ADJB 4FQ1L 3OR7A 4EDWL 4FG6D 5J12B 5CZVH 3WFCL 3NZHH 3KPMB 4PJBE 2XA8L 2EE3A 4NO5A 3RWFA 2K7QA 2VERN 5D7JA 3S4SG 5C0NC 1YN6A 3PGCA 4GW5A 2YZ8A 1PBYA 2YUWA 3BDYH 3JUZA 3CC5B 3TBSB 5GGQL 4KKCD 4NQUA 3U0PA 4L4TB 3MLZH 1BFOA 1QTYT 2MCPH 3H6JA 1YEGH 5ERWB 4PJ7A 1S9VB 5C0CE 1F4HA 1JPFA 1QBLH 5E7BA 3RDTC 5CP7A 5BO1H 1U93A 4G8EB 3BWAB 2IMNA 4HIEB 1CE6B 4DGYH 5HGHB 3QXWA 2EECA 2C3HA 1MI5E 3WHXB 3PL6B 4WI4A 3V5HA 3BAEH 1NAKL 4U7SA 3RGHA 3TPUB 3VXSA 3CMGA 5KVDH 4X0KB 2FJGA 2BMKA 2DI8A 4M02A 3NVQA 2GY7B 3GBNL 3T77A 3TFKD 4RGOH 4Y5XA 2EYSA 3JBG7 4AQ1B 1INEH 3P9LB 3QFJB 4XCCL 3I6LE 4PJXF 3REWA 2VWEC 2HFFA 5KANI 1PLGH 1WT5A 4GRLA 1BD2D 2P49B 2P8LB 4NZTL 3GI9L 3QDGA 2DJSA 2X1QA 5EZLA 4KV5F 4HPYL 5LGHH 4D9LH 4G6JL 1U8QA 3NABL 4P23D 4H88H 4G42B 2Y7QB 4JQVA 4BUGA 3FO1B 5ICYB 2HJKB 2F15A 4Z7UE 4JDTH 1JPTL 1N3NB 2XWJB 4NO2A 1KCUH 1FZMA 3NH7H 2JB6B 1NAMH 1XGUA 2YWZA 2BSRA 3WXWL 1FYTE 1TVHA 4JCMA 1AC6A 5HYJB 4PRIB 5M94B 5IROA 1TJHH 2R4RL 3ARBB 4X9HA 3KPPB 4NIKB 3BESR 3QUMA 4APQB 5A2LH 4YHNA 5EO0B 1KYOK 3ARDB 1KTDB 4WEBH 1IM9B 3RGVC 4ZPTA 3SE8L 3UJTH 2NY1B 5E2WH 4H25B 4QWWC 1IAOA 5IB1A 1EK3A 3TNMA 3GEWB 3BPOC 2DBLL 3WJJC 5C0EB 1BEYH 4QRPA 1UCTA 2BHZA 4RMQA 1RIVL 3N9GL 4OV5A 4NJ9H 2CKBH 2LVEA 2R9HC 4LCIL 4H8WL 3HI6H 4DJMA 1JNJA 4FABH 1PG7W 3U7WL 2Y06L 2GT9B 1UEMA 2G9HA 4KQ3H 2HRPL 4ZUWA 1JNNH 5D2LA 4XXDA 4QRRA 1Q9OB 5IT2H 1IE5A 1LK2A 3KYNB 2OI9B 1PEZA 5SWZB 1K8IB 1TFHA 4IOSD 3HUJF 3QDJA 4MJIA 5E70A 5FB8A 3RNKA 5JOEA 4P2QD 5GZNC 4ZO6A 4NCC2 3UTTD 2BNRA 2CIKB 1MF2H 4GS7C 4UAOB 3D1MC 4K8RC 2BOCA 4G80B 3N06B 1DBKH 3ORJA 1UM4H 1MHEB 1NGXB 1I1AD 4M1DH 4Z9KB 4GMTH 3CLEL 2EXWC 5HPMA 5EA0L 3RWHB 3RTQC 1GSMA 1QVOB 3PQYB 3FT4B 1EFQA 3DXAE 5JZ7D 2DQIH 5FF6B 5C9JA 3WNNA 4F7TA 2CQVA 4PJIF 4WFEE 3OHXA 2DJUA 2X4SA 4RFEA 1X5LA 4HUWA 2J88H 3HNTH 4NUGH 4JM2F 1YQ2A 2AEQL 2Q1EA 2NX5B 1DSFH 5DJ8B 1WQVT 4MNQA 1A7BA 5DXWA 4ZFFB 1BGXL 1R3HB 2YR3A 3EUUA 2JJWA 4ODUA 1K85A 5DRWA 2QEJA 1C5BL 4OLYH 1IGFL 3E6HA 2IH3B 3DMMA 4YAQB 1XIWA 3D69B 1EEZA 3DIFB 4P3CH 1G7HA 1U2CA 4JFFD 5C0BA 1QLEH 2VXVL 3GMPB 4K7PH 1XF4B 4FRWA 5C2BH 3EYQD 4ZUTB 1QSVA 3LS5H 2G5BA 4YWGL 2ARJA 3RTQA 1U8OA 2EDYA 1JWSA 2VDPH 3P0GB 1BLNA 3HE7B 2Q20A 5DRXB 5L7XL 4E5XA 4GG6E 4PJ5B 4AL8L 3TLRA 1L0YA 2IPKB 1PX3A 3VCLB 3VG0L 5I73C 1JF1B 3G6DL 4LLWA 2EDKA 4K3JL 1G9NC 2PETA 1CT8A 4QHMB 1S7SA 4JO2L 2W9EL 3FMGH 1RHHA 4YHML 5IB4A 5FECB 3LQAH 3HE6B 2FIKA 2A38A 2NY5C 2X70B 1KYOJ 1RUQH 2FJFA 4KQ4H 5HGDB 1NFDB 3MRLA 1BQLL 4N5EC 3AY4A 4OZHA 3MRFB 4PRBB 4TNVK 1TCMA 2C3WA 4U1KB 5CZVL 3NZHL 3O6FC 1FNLA 2DS4A 3MCLH 3KLHC 4XBPB 3ZTNH 4PRPE 4JFPB 1UWGH 4QRSA 3QO1B 3BDYL 5IMMA 1LEIA 4QOKE 3MLZL 3L6FA 2MCPL 1I9EA 1YEGL 3TJEH 2R2HA 3GSWB 5ENWB 2I24N 4C58B 1BD2A 2MCG1 1QBLL 4IHOB 2NY2D 1J0ZA 3P3YA 3E8UH 2Q7NA 1UH4A 4DGYL 3JV6B 4UDUA 3QWOA 1DQML 4LSDA 5HYQA 3L7FB 4F7EA 3IXTB 4P23A 3BAEL 1I8IA 4JN2B 3SDXA 5KVDL 1PYWA 4DVBB 1DZBA 1NANI 1DN0A 4GUPA 4MLSA 3GB7A 5IB3B 4X5XA 4YHYB 3I6GA 4JPKH 4QEGA 4RGOL 4YHZH 1INEL 4PJ9C 3HG1D 2HJFA 4LGPB 4JRWA 3DVIA 3QJHA 4QXGH 1KN4H 5FKAB 1PLGL 2ITCB 1YMME 5SV4A 3SGDH 3DLQR 5ISZB 3EOBA 1G7IA 1IM3A 1ULVA 4F7PB 1ZS8B 3DVNB 5J6HB 1HHHA 5DDHB 3VFUA 3OTTA 4D9LL 1HNGA 5LGHL 3QXUA 3I2CL 3QUKB 4ZFGH 5C7XH 3GMLB 5AYQA 2OX5A 4RNRA 1CXLA 1JGDA 5JOFA 5FO9B 2DMCA 2GK0A 2NY3C 4N90D 4MQXD 3TYGH 4GRWH 3TC9A 2UVFA 1ZSDA 5HYSA 1ZV5A 1KCUL 1SBBA 2A9MH 1YJDL 2CK0H 3NH7L 5D1QC 4QTIH 1NAML 1AGEB 5CSZA 4LMQI 5F72S 4LLMA 2SEBA 4OAWA 2J8UB 2WM0A 3QXAA 4YHKH 4XPFH 5EO1A 3SKNB 1FDLH 3AREC 5CD3B 3SE9H 5HYFA 4Q6IB 3VFSA 4V1DB 4FQLH 4PREB 3TZVB 3ULUC 3QSKB 4WEBL 3UJTL 1DJSA 3UPCA 5E2WL 1AO7B 4RZCB 5IWLC 5E95B 4NP4H 2OQJB 4BQ8A 4TUKL 3FO9B 4OSUH 4P2QA 5MEQA 3UTTA 5I8CB 1BEYL 2IMMA 1B2WH 3GJFH 1LP9B 3MLWH 2D4DA 5IBLC 5J0BA 3W5MA 1EDQA 1QHPA 4HS6B 3U9UB 1I1AA 3ME0A 3PABB 5FOJA 3MOQA 3Q1SH 3O41A 2WNGA 1LD9B 5D2NC 5DJZB 1HSBA 4WW2A 1OTTC 4F8TA 3OB0H 4FABL 5F1SA 1RZKC 1R6VA 4LHUB 3BHBB 2CKBB 4P5TB 3VWJB 4KQ3L 4R6UA 3NPSC 5IT2L 4PGCA 5C0AD 5KW9H 2XG4A 2X4TB 2NY4B 1CGXA 1DLHA 1XF5B 2R23A 3QDHA 1D6EB 3NCJH 1NBYB 3U0TA 1DE4A 4NC1C 1QUNA 3MUGB 2VABA 3QH3B 3S96B 1FIEA 5EO9B 1A6TA 4GAYB 3OQ3B 2CMRH 5MI0B 4EQ2A 4W6WB 4KVNH 1DBKL 3B9KB 3K4ZA 1UM4L 3EO9H 2YKLH 4GLRI 2UWEE 3AMLA 4GMTL 4JFFA 4M1DL 4TRPH 3TCLA 4Z7WF 4LLAA 3VFPB 5BVJB 1L9MA 4LKXA 3ES6B 4J3TA 4XP9H 2MKLC 1FZJB 1JGEB 2CDFB 1AHWB 5FGCE 3RKDC 4LEXH 4QRUA 2YRZA 3S98A 1CDJA 2PYFB 5J1AA 4WUKH 1DDHB 1H0DB 1MWAA 5INCB 3VXTA 1WCBA 1UQSA 1QR1A 3VGBA 3OJ2C 3TT3H 1AGFB 4HGWA 4J1UA 4NUGL 1GGUA 3HNTL 3N0PB 5EUOF 1T1YB 2V5MA 3AU1B 1P2CA 1IARB 3O2WH 2EIZA 4ZUSA 1ZANH 3SDDD 1GOFA 5C07B 1YYLH 4OLYL 1H5BC 2E8ZA 1YPZA 2DAVA 3ET9F 3O4LE 1MCEA 4I2XE 4P3CL 3B9AA 3IDMB 2KDGA 5D72H 5DQ9B 5GRXG 3S35X 4ODXA 1I7TA 1QLEL 3QIUC 3QQ4B 4K7PL 4M62H 3MRNB 5IW6B 1FBIH 1ADQH 4HUKB 2KBGA 3LS5L 4QHLA 3MGTA 3FAXA 4PJFB 4L4TE 3SGEI 5ICZA 2VDPL 2ARJQ 5DD6A 2FH6A 4TNVF 3TN0B 1VA9A 3NA4A 1MFAH 2BX5A 1NBVH 5TGBB 1IFHH 2DQHH 3O45B 4MDIA 3WEXA 1NFIA 1IKFL 3BO8B 4X6BB 2IH1B 2UY6A 3RWGB 5C1MB 1NEUA 3ZYIA 4EUPG 5J9PA 1LNUA 2WWMD 3LQAL 4M7KH 1RUQL 3QNYB 4JFDE 4KQ4L 3WE6A 4DOHB 4PY8J 5CAYB 1KTLA 3HZVA 1NLDH 1F3JB 3EYFB 5B8CA 3QFJD 4HUVA 1D5XA 1NGZB 3L3HB 4NPYB 3VXQA 3S5LG 4JKMA 1X5YA 5CGYD 3MCLL 4PBVC 2AV1A 2NYYD 1K8DA 4L29A 3HC0A 4LGRB 2G75A 5C0JA 5MERB 3ZTNL 1UWGL 3FQWA 1ZA3B 2HJLA 4KY1H 3VFWA 5H2BA 3HG1A 2VQ1B 5D7IB 1C08B 1OT1A 3TJEL 1RK1B 1OL0A 5KN5B 3E8UL 4YXLH 1F3DJ 3FTGA 4RRPG 2RHEA 3M8OH 2PW1B 3V4PH 1UVQB 1P9MA 3B6SA 1A6ZB 1FPTL 4Y7MA 2VL5A 2FCBA 2CJUH 4YHPA 5C3LD 2ZUUA 4HEPG 1GZPA 5HYJD 4PRID 3QUXD 3L3IB 4YDIH 2UUDH 3KPTA 3EYUH 3U1SH 3BYTA 4F37F 2OL3A 4WHDA 4APQD 1KB5H 3B8SA 2Q6WA 4GW4A 3ARDD 1LE9B 1IM9D 1F8TH 4QXGL 3LSOB 4PJCB 3UYRH 1EVTC 1KN4L 2ZOKB 5MEPA 1K2DA 4L8SB 4HLZH 3ZDXE 1IC5H 4QYOB 3TPKA 2VYRE 5C09D 1PD6A 1U91A 1HILA 4AEEA 4ZFGL 3ZSSA 5C7XL 2JCCB 2YD2A 3F6IA 2JJTC 3O3BB 3FZUC 1G6RB 2ZCHH 3MA7B 1FQ9C 3TYGL 1J5OH 4JFEB 3IJYA 2A9ML 3NIDF 3MLTB 3KPSD 1YEKL 5FGBA 2CK0L 4JHWH 1YZZA 2AP2A 5F7HA 1N26A 4JLRB 2EC8A 5I1AA 3H2WA 1TQCB 4GRWB 1FFPA 5A2IH 5KAQG 1U6AH 1FV1B 5EC2B 4CN4A 1YNTA 1U58B 2LAAA 5ID0B 3MV7B 5SWZE 3HLAB 4YHKL 4XPFL 3U7YH 4FFZH 1FDLL 3SE9L 3CDGA 4KMQA 4FQLL 2AEPL 3P11H 5C0AA 3MNWA 1E4XI 3GM8A 5CFHA 1A2YA 2WWKO 5EN2A 2JJUA 4N1EA 2XQYG 1IZKA 4NP4L 3IJHA 4PLJD 2VLKB 1D5BB 1HHJB 4M3JA 5F88A 2Z31C 1B2WL 1WFOA 5GSRB 5IV2B 3MLWL 4P57A 3PQYD 3NBNA 4H5SB 4I18A 4Q9RH 2X7LA 3HPLA 5KOVC 1JHTA 2ATKB 5JMRA 1S9WB 3IS1X 2AXGB 3DYPA 3WKMH 3AAZA 3GJFB 2X41A 3BISA 3MZTA 2NX5E 1TPXB 3MRMA 4H1LB 4M43H 2BXYA 4QNPF 4MQTB 2Y6SC 1FZOB 4HWZB 2KZWA 1FNAA 4Z78B 6CGTA 5KW9L 4OIBA 2B1AH 5D5MF 3NCJL 4ZNEE 3QI9B 4J8RB 3SDDA 5HI4C 4HUUA 5T1MB 2OR8A 1ZA6B 4XAWH 1T83A 3NIFF 4U1HA 1JMXA 2JIXB 3VGAB 1UEYA 1KEMH 5B38G 2ATPB 3ULUF 2CMRL 1GH7A 5DRZB 4K3EH 1J87A 1RHFA 2FGZA 3HE7D 1X5FA 3GMNA 4KVNL 5ACZB 2KQNA 2YKLL 4TRPL 3WXVH 4GKZA 3VH8G 4E9LA 4PJ5D 2WZPD 2V2XA 3BOVA 4XP9L 3V79C 1DANU 3CC5A 3TBSA 1A02N 2NYYC 3DV4B 4C56B 3GRWH 1EO7A 1Z3GH 5I74B 5ERWA 1S9VA 3OF6D 3WS3B 1N0LA 2VLRB 1F4XH 4WUKL 2DLFL 3ZTJG 1QNZL 2GTZB 4G8EA 2FATH 1SYVB 3O8XC 3TT3L 1IGIH 4XCYB 3C5JA 3DUSA 1CE6A 1KN2H 2Q76A 5HGHA 1UWXH 3HE6D 4R97B 2KQMA 3HPJA 5HGAA 3O2WL 1ZANL 1Z0MA 3WHXA 5I8KH 2NR6C 4TUJB 4BJLA 1YYLL 1PAMA 3C60B 4N0FB 5JPMB 2YMXH 3W0WB 5I18L 4X0KA 1WCQA 3NFPA 4PIRF 2R56H 1H8NA 3M1BB 3SGJC 1J86A 3EJYC 2BY0A 5D72L 3FT3B 3BXNB 3QT2A 4QCIB 4HWUA 1KJ2L 3QFJA 4M62L 5JIKA 4KGJA 1FBIL 1ADQL 3NCFB 1W2KT 2IFFL 4PJ8D 1X5HA 3CJJA 4LCUB 4GSDH 4ELMB 4NGHH 2ZUQC 1MFAL 2P8LA 4ZAKB 1NBVL 1IFHL 5DMJB 4ESKA 1H3XA 2DQHL 5T3XH 3TBWB 4CVUA 3S34H 5DYOA 1JIBA 2VDQH 4D0BB 4P0DA 1BQSA 1NUFA 3MACH 2C1OB 2Y7QA 4G42A 3FFCE 2FGWH 1T3FA 3FO1A 5ICYA 2HJKA 3DGGB 3SCMB 3TO4C 1JZ5A 4M7KL 4WHYH 4KDWA 1Q9LB 1PVHA 3K3QA 5EPMB 1CQKA 2JB6A 1NLDL 4X9IA 4RQQB 1IC7H 1FNEB 5CHNB 8CGTA 5EU5B 1KLUB 5HYJA 2DTSA 4PRIA 5T1LB 4I0CC 2NXZD 3QUXA 3SY0B 4XWOC 1D9KC 5ISZE 4KY1L 4APQA 4U1GB 5EO0A 5DJXB 1LEKA 3ARDA 1KTDA 4GMSH 5F7DA 1IM9A 2QSCH 1RZFH 3OKEB 5L0QB 1SY6H 4H25A 3T8XB 3U0WH 4WTZG 3PWPB 3EBAA 5C0EA 4YXLL 3M8OL 4PY8I 1SJHA 5C09A 3V4PL 3NAAH 2OS7A 4CMMB 5I66B 4H26B 3LD8C 3BE1H 5LWYH 5B39A 2CJUL 1JZ8A 2VN4A 4P5KA 4BA8A 4WFGD 3RJDA 2GAZA 2P5EB 3C6SB 3HR5B 1A1MB 4M8VA 1EMTH 3G08B 2J8UE 4KRLB 2W65B 4LNRA 4YDIL 3KPSA 3EYUL 2J5LB 3U1SL 2GT9A 2VKWA 4X8XA 5TQ2H 1KB5L 4V1DE 3TZVD 1F8TL 1HXYB 1LE5B 4JKLA 3UYRL 2E7LA 1AO7E 4ISVB 4LSVH 5EIVA 5EIQA 1R5VA 1TZHA 4HH9B 4KGLA 2GTWB 1IC5L 2VDKH 4YGVA 1LP9E 5EBMA 2IADA 3CFBB 1SMAA 2HN7B 1NGXA 3GSQB 2R0KH 4JY4B 3RWEB 2R2BA 5E24E 3CXHK 2V5TA 1L4IA 1QVOA 5ILTH 3OAYK 3PQYA 1J5OL 4F58L 2A1WH 2V7HB 2XIDA 1BQHA 4LHUD 4JHWL 4OQ1A 2X1OA 3FOMA 4P5TD 1WSST 1G84A 5IFJB 4DEPC 4LBEB 2AAVA 1RZJH 4HUNB 1OGAB 2MOVA 1LK3H 4EXPX 1R3HA 4WUUB 1KELH 4AMKH 3P11L 4U2YA 1MCKA 3V5DA 4YAQA 3MODH 2J2ZA 3D69A 3DIFA 4JGJA 5I6XC 2HKHH 3B9KD 5BCAA 4H0HB 4YXKH 1GPOH 3GMPA 3UYPA 1XF4A 5C6WH 3HC3H 5I1HH 4M1CD 1EEYA 3FQNB 4YH6A 1EA9C 1U3YA 4BQCA 4Q9RL 1S7QB 4ZS7H 3HE7A 2PCPB 5DRXA 4I48B 4PJ5A 4RA0C 3CMOH 2IPKA 3B2UC 3RVXC 2YD7A 5D1XB 3D48R 2GFBB 4M43L 1QSFB 3OF6A 4MX7B 4XPGH 5C07D 3FB7B 4L4JA 3Q6GH 1ZVHA 4ZFZB 5JHDE 5JR1H 1F5WA 1CLOH 4Y4FB 5CZXD 5FECA 2P1YA 4NUJB 2B1AL 3TBYB 3HE6A 1OWRM 4BELD 3IKCB 4AH2B 5HGDA 1NFDA 4LKCB 4JFQB 1QPPA 1WWAX 4OZ4A 4P2OC 3FB5B 4PRBA 5I17B 4XAWL 3S36X 4U6VH 1KEML 4OZIB 3TVMC 4PJFE 2LE9A 4K3EL 1J0HA 3TN0D 4JFPA 2WW8A 3SOBH 4XP5H 3WXVL 4M4RA 2BP3A 3W5NA 1RFDL 2YD4A 3QO1A 2WBJC 5IESH 1RZIB 4UI2A 4PJ8A 3GRWL 1Z3GL 1IAII 2UZYB 1F4XL 4IHOA 4HZLB 2PYEB 4K3DH 4P4RB 2A0LC 2FATL 2O93L 1IGIL 1KN2L 1T5WB 3JV6A 4HIXH 3RPIA 3MRGB 4NQVB 1TNMA 3THMH 5I8KL 4LCWB 2YD8A 5EZJB 3IXTA 4L3EB 5GRJH 4JN2A 3WUWA 5EZIH 1CE1H 2YMXL 1I8MA 4PYHA 4L4VD 4TUOA 3VXUD 2VLLB 2R56L 1NEZG 3T0EB 3O9WC 4MGXA 5HHVH 4XC3H 2BRRH 1MCLA 3KS0H 4WWKC 1N6QH 2JJSC 2AK4D 2Z8RA 1S5HB 3WO4B 4QTHA 1WAAA 2W9DH 3WKNA 3SDCC 1YJDC 4MA1B 3CXHJ 4GSDL 5FKAA 2ITCA 5ESQB 4KC3B 4NGHL 2A9NH 3RWDB 3B5HA 3NCBB 5T3XL 4ZXBD 3S34L 3DVNA 4C4KT 2VDQL 2GSIB 2YPLE 4BSWA 3FO2B 2MSPA 3FO0H 4NN7C 1V3KA 3PHQB 2DQTH 3MACL 4X4ME 3RWIA 5E8NB 4F15B 4UU9B 3S37H 2FGWL 1Q9KA 4J4PD 2VH5L 5FO9A 3ARSA 5IK3B 3OL2A 4HC1H 4U0QB 4PG2C 4M6OL 1KIRA 2W1NA 3UO1H 2IJ0C 4M00A 2VDRH 5CEZH 1IC7L 2G5RA 2DLHA 4PJCE 3RKPA 1NAMA 3WNLA 4LDLB 5HDLA 5DJCA 4Q6IA 4RGMB 4HDIB 4BM7A 3MJ8B 3TGXA 4GMSL 4PREA 3TZVA 1HH6A 3S6CA 2QSCL 5JOPE 3RIFK 3RI5K 1RZFL 1SY6L 1T1XA 2VAJA 3U0WL 2IQAA 2OQJA 3O2VH 4N0RA 3HMXH 2QKIB 3W39B 2GJ6D 5I8CA 1I9RH 3WMSA 2B39A 4JFED 4YBHA 3NAAL 1ZGLB 4HS6A 3RY5A 2E9BA 3NCCB 3PABA 1PSKH 5LWYL 3LKNA 5DJYB 2AEIT 1AR1D 1DANT 1B4JH 1J1OH 4P4KC 3MV7D 1EMTL 4XXCC 3V0WH 4LHUA 1EZVX 3BUTA 2CKBA 4GG8A 3QWRA 4P5TA 5TQ2L 3BUYA 4S0SD 4YFEA 4B7LA 1IGCL 3NACH 2X4TA 4JZOB 3UDWA 1XF5A 5L2JB 5K59E 3U83A 1NBYA 4LFHG 3H3KA 2DLTA 2Y25A 2P4AB 4LSVL 3WS6C 3MUGA 2VLKD 3I3EA 3QH3A 1CLCA 4N9GB 2BSTB 5EO9A 2JELH 3MLSH 2VDKL 2HVJA 3MRRA 2FX7H 1PKQE 2NZIA 3G6JF 1DLFL 3B9KA 2ESVE 5GS3A 4R7NA 3VFPA 5BVJA 3DRQA 3W9EB 1U3HC 3ALWA 4MJ6B 4PJXE 1HI6B 1FZJA 2CDFA 5ILTL 1AHWA 4NQDD 3DUHA 2A1WL 3C9NB 2PYFA 4PGBB 1UXSA 3WDIA 3SJVB 2EICA 3GDBA 3LV3B 1F11B 3B4NA 5JW4Q 3CLFH 3DX9A 2XACC 2B8OT 3AB0B 2MQ3A 1RZJL 3QI9D 4XVUC 3RNQA 3X13B 2APFA 5C07A 1GGBH 1LK3L 3FQRB 2EIEA 4HXAH 1KT2B 2JIXD 3RUGA 1KELL 5HDQL 1K5NB 2XKUA 4JFXB 1ED3B 4X80L 1KXVC 3ALPA 2BFVH 4YXKL 1GPOL 3CFKB 3QQ4A 1G0YR 3I02B 1M7DB 3HC3L 3MRNA 5EG6C 1NCBH 5I1HL 2ZP0T 4NQCB 3BJLA 3LPGA 4C56E 1LO2H 5FYLH 4ZS7L 1DR9A 5DK2B 3TN0A 2VLRE 5TGBA 3DGCR 3O45A 2BVUA 2EDLA 5I19H 3CMOL 3X11A 1CLZH 5F9WB 4FQXD 3P4NB 1GGYA 3ARFC 4X6BA 4XPGL 1NDGB 1X5IA 3Q6GL 4V2BA 4NCC1 3C60D 5JR1L 2X4UA 3W0WD 1XCTB 1CLOL 4N5UA 4LLDB 3GSRB 4YZFE 4N0UA 2AK1H 4NN5B 3QNYA 2V6HA 5ANMA 3IRZA 4OB5H 4DKFH 1F3JA 4YBLC 5GISH 2DYPD 5C6PB 3BN3B 2AS5M 5DK0A 2NTSP 1A8JH 4NPYA 4KK9D 4OJFH 1S5IH 4L4VA 3VXUA 3I6KA 1QACA 4LMQE 3GSVB 5MERA 2ZCKH 3SOBL 4XP5L 1ZA3A 2AK4A 4F7CB 5KJRH 1ND0B 1MFDH 3ARPA 4MNGB 4JFZH 5A2JH 5IESL 1FN4A 5FCSH 5D7IA 1I7UB 3AM8C 4JANA 5A16B 2W07A 3BQUD 4RISH 5I1DB 2FZ3B 2I60H 3HUJE 3WNKA 3ZDYE 4K3DL 2GITB 4XNYH 1HKLH 3WIIH 3SE3C 4NKQB 3SCMD 5DJ2A 2GK2A 4LP5A 4ZXBA 1MEXH 1NGYB 3O81A 2OJEB 4HIXL 2PW1A 1UVQA 4Z18A 3THML 3SQBA 3UTOA 3VXMB 5KSAB 2L7JA 5IHLB 4L9LB 5GRJL 5EZIL 1JNLH 1CE1L 5ACMA 4J4PA 1EUTA 3VMPA 1T22B 3LN4A 3ARUA 2ZJSH 4PLOB 4NM8H 3L3IA 4XC3L 2BRRL 4Y16C 1JP5A 4HKZB 1SMOA 4EN3C 1R3IH 2QQNH 3QZWG 1E4WH 1X4XA 4ERSH 1NDMB 2W9DL 4GT7A 1WUNT 1OT2A 5A3IC 3LSOA 5IHBA 4LSSL 4D94A 2ZOKA 1SJEA 4ZUUB 3SO3C 1KB9K 4OGYH 1MJJA 2VR5A 4L8SA 3PWPE 3GK8H 2VLJD 1BBDH 4R96B 4NRYB 3FO0L 1MIEL 1IGMH 3OAUH 4MD0B 2JCCA 3S37L 2GJ6A 3O3BA 3RIFF 4UV7H 1IC4L 3MA7A 3F8UB 1JYVA 2NY0B 1A4JB 2P5EE 3PV6A 4JFEA 2BSSA 4HC1L 3MLTA 4XVJH 4KMTH 4PJHB 1FVEB 1T2JA 4W4OA 3O3EB 3UO1L 2VDRL 5CEZL 3BP7A 3QAZC 3K2UH 1FV1A 1KACB 3EAKA 5EC2A 3N1GC 1U58A 1HNFA 3MV7A 1M71B 2LTQC 5ID0A 3HC4H 2C4XA 3T65B 5EBWA 1UB5B 2B5IC 2ITDA 1KEGH 1WFUA 2EDNA 4Y4KC 1X7QA 1ORQA 1EAPA 4IOIB 3OGCB 4JFYA 5IHZA 2CPCA 1BFVH 3OAZK 4RGNB 3O2VL 3HMXL 2VLKA 1D5BA 3QYCA 4WWID 3KG5A 1I9RL 3EOYG 4H5SA 5E6YA 4ZUVB 1U36A 1AJ7H 1KG0A 1T20B 1CVSC 3L9RB 2ATKA 2AXGA 1PSKL 1EV2E 3IDNB 5TH2B 3GJFA 4PBWD 5SX5H 3ZKMD 4HMCA 3D5OF 1B4JL 1J1OL 3JTTA 4NQDA 4OZFG 1H3TA 1OGAD 4Q74A 2H32B 3IU4H 3QEQB 1UJ3C 4IMLB 3V0WL 1FZOA 4HWZA 4WUUD 2YPVL 3TF7C 3NACL 4FQXC 3CFIC 1DVFB 3L3JA 5KOMC 3QI9A 4J8RA 5T1MA 1VGKA 2VRAA 4ZSOB 4QKXB 2JIXA 2F19H 3MLSL 1FNGB 4KUCD 2FX7L 4P99A 4WI7A 5DRZA 4NHCH 2VZVA 5E99H 2A6DB 3QPXH 3F65A 2YD5A 5GGSB 2VQUA 3MO1A 4Y5VB 4X7EC 4PJGB 3KYOB 1CS6A 3DV4A 5D1XD 4L8CB 4MAYC 5J3HC 1MREH 3X14A 1FORH 1QSFE 1DTUA 4HAGA 4RMRA 3WS3A 5AD0B 1MCSA 4YHIB 5FO7A 3TO2B 2ZKHH 4HCRH 5F1OB 2E9JA 4PJEB 4Y4FD 5F89B 4DW2H 3CLFL 4YDLC 4PJDA 4AENB 4MJ4A 5JQ6H 4LVOB 4FQXA 1I7ZB 1FSKC 4M48H 4O2FB 5GRYA 4TUJA 4M7ZC 4HXAL 1BJ1H 1KB9J 3C60A 4N0FA 5E94A 4Z7NF 5JPMA 4LIQH 4LSQH 5FK9B 3W0WA 5IB2B 5L9DH 3IFOB 4UOW1 5C08B 4DGIH 4Q6YA 1A3LH 2FO4A 3RWCA 3ZYOA 4KHTH 4U6XB 3L5WA 2BFVL 3BXNA 3L7EB 3RVTC 3VWKB 2DYPA 3B5TA 5CGTA 1IQDA 1NCBL 3G6AA 3OJMB 4B53A 1X5ZA 2XZZA 3J7HA 1LO2L 4TTDD 5FYLL 5BS0B 2BVOA 1QEWB 3IDJB 2VISB 4ELMA 4OLUH 5J7CC 5D2LF 2W0LA 4JFHE 4NO0B 2PYED 1MCOH 1NANH 3OV6A 1ADQA 4G8FB 1SYSB 1RY7B 5I19L 3OGOE 3CSYA 4PRHD 3BH8A 2Q86B 1T0NA 1CXKA 3JVGC 4KJPD 1T66D 3BQUA 1XCQA 4LAQH 1FVDB 4FXGA 4YEFA 4LCWD 5SX4I 4LCWE 1U42A 2WBKA 4L3ED 4M5ZH 2C1OA 4L3EE 5JW5B 3DGGA 3SCMA 4ODTH 3HZMB 5INDA 3BPNC 2YN5A 3S88H 1T03H 2IGFH 5E5MB 2BOBB 3T0ED 3LB6D 5EPMA 3C5ZD 3D39B 1QLRB 3DO3A 4BZ1H 4OB5L 4DKFL 5AZ2L 4NHUB 4JM4H 5GISL 2F53D 1J9CT 3OX8A 5GZOD 1MLCA 4RQQA 4OJFL 4HWEH 1S5IL 1I3UA 5CHNA 1F58H 1ZEAH 3BJ91 4HHAA 1KBGL 4U2ZA 2ZCKL 3O6LH 4UNTA 3UEZA 2D4FA 5GGRY 5KJRL 4K94C 3VGDA 1MFDL 4JFZL 1CI5A 3B9VA 3KJ4C 1YC8A 3GKWH 1TZGH 1ITBB 3GI8H 4RISL 3IGAB 3T8XA 1P4LB 2I60L 5T3XD 4XNYL 3DHMA 2I07B 1HKLL 3QDMB 3D6GA 3RX8A 2VLJA 3OJDB 1MEXL 2BNQE 3JWDH 2QQLH 3ZZ1A 4ZS6D 4R2GC 1CZ8H 4Z7WE 4CMMA 5I66A 2HA1A 4H26A 2L7UA 5IB5B 3TV3H 4PJBF 1JNLL 3P30H 3KAAA 3WN5C 1UADC 5E2VH 4PRNB 3MV11 3C6SA 1RJLB 1A1MA 3CFJB 2NCMA 3G08A 3VFOB 4E41B 1S9XB 1R3IL 1E4WL 3FHAA 4ZODA 1ACYH 2C3XA 1QBMH 4RA3A 1N4XH 4FHBD 5IMOB 3MJ7B 4I9WD 3MV8E 4OGYL 1KB5A 4F9LA 4MDJA 3GZKA 1U3JA 3AC0A 3D25A 3GK8L 1A1OB 4G9FB 5E6ID 3RBGA 1Z9SA 4NWUH 1BBDL 4H20H 3CFBA 3OZ9H 4OZHF 3HB3C 1N64H 2YRLA 1IGML 1HEZB 3HAEG 3OAUL 3TP4A 4XNXL 3QUYC 1LO3L 4KTDH 3MRJB 4UV7L 1P6FA 1BWMA 2IALB 3V5KB 8FABB 3RFZC 4PGJA 5KAQF 2V7HA 4HJ0C 4POZD 4LRIA 4WFFD 4XVJL 4KMTL 4WEUD 3F6LA 3OXSA 1TVDA 3K2UL 2R29L 1ZOXA 4GLRH 5DVNA 4LBEA 1H3UA 3HC4L 4N9OB 1OGAA 3OG6B 3D0LA 3RVVC 4M93C 1KEGL 3TIDA 5DK3A 4WUUA 4O2CB 3EHBD 4NOBA 3BGMB 2HLFC 4DVRH 1BFVL 1LEGB 2MHAB 5D4QA 1LWRA 5IMLB 3ZKXB 1NMBH 4FFWD 2CD0A 4FNLH 1T7ZA 5I16B 1KIQB 4M5YH 4UT6H 3H0TA 1AJ7L 3P4MB 3ULVE 1MCPH 2PR4H 2R8SH 4I1NB 3SJVD 4HS3B 4POUB 2VJXA 4ZFOB 5FO8A 5D1XA 1WBZA 4UUJA 4MX7A 4R0LB 3IU4L 3BVNB 2JK5B 4XAKD 2WINB 1G7QA 4JJ5B 4ETYA 3SGEH 5ACLA 4ONGH 4ZFZA 1O0VA 1CDYA 4Y4FA 3SGKA 4LRNH 3RZCB 1GCFA 1SHMA 4N1CA 3IKCA 4AH2A 4LKCA 2FH8A 3IDYB 1U8NB 3FB5A 2XWBB 1TCRB 4YO0B 2F19L 1JPGA 3WL9B 1VKXA 4D3CH 4OZIA 5CEYB 4K71B 4NQCE 4NHCL 5E99L 5KSBB 3QPXL 3CPLA 5DURB 3KXFD 4JAMB 1CL7I 1RZGB 4HKXB 3EOTH 1UKQA 2DICA 3K0WA 4F9PC 1FORL 4NFBA 3TH2T 4HZLA 2PYEA 4KDTA 2OJZH 5D1ZD 2UYLB 4HCRL 3EFFB 4ZOCA 3GRWA 4DW2L 3MLYH 1EHLL 4PRHA 2YA0A 3MRGA 1XGRB 5JQ6L 1KPVB 1IBGH 3C6LB 3OR6B 15C8H 4LCWA 2MWCA 4M48L 1UB6A 1S8DB 5EZJA 4L3EA 2APXA 2BCKA 4LIQL 4LSQL 5L9DL 3RJQB 2VLLA 4YR6A 4DGIL 1A3LL 3T0EA 4KHTL 1P1ZA 3NIDE 3C5ZA 4JY5H 4X7FC 5DO2D 5KVMC 3PJSB 2P8PB 2F53A 4WW2F 5FXCH 3F7YB 4MNGE 3WFHB 1AXIB 3CDYA 3PL6C 4NNXA 3GSXA 4TYUA 5DZOA 1IGTA 1RVFH 1DQQB 2I9LB 1MCOL 4H1LG 1I8LC 3BX7C 2I5YH 2IWGA 2BVTA 3VRIB 4P9HL 3FO2A 2RCSH 3VXMD 3CH8A 5CJOH 4M5ZL 3T4YA 5E8NA 4UU9A 5DJAB 4ZQKB 3BN9C 4BFIB 2LU3A 4ODTL 4ZOBA 1T03L 3S88L 2IGFL 2DRUA 3BKMH 4Y4HB 3GO1H 5F71A 4BZ1L 4MAUH 4D8PB 4I3GA 1BAFH 3CU1A 4JM4L 1GOHA 4Y5YB 4HWEL 4ZMAT 1F58L 1ZEAL 4QNPE 4ODVL 2DN7A 5LKNA 5DFWH 4LSRH 4GQPH 4X98B 5FUZH 4LPXA 5TPWH 4HDIA 1A0QH 3AGVA 4KTEH 3DV6B 5D5ME 3GKWL 4O5LH 1AR2A 1I9IH 3TJHC 3HTLX 4FN0A 3NIFE 3C5SB 2RIKA 2VDNH 5E6IA 3QHFH 2NY0D 5CWSA 3JWDL 3ARBC 1SY6A 2W0KA 4B50A 1XZ0B 2QQLL 4RFNB 1CZ8L 4I0PC 4KDVA 1E4XH 4PJHE 3TV3L 2YWYA 1CD1B 2NY1C 3P30L 5DJYA 2DQEL 5E2VL 5CEXB 1FG2B 5IVZB 1Q94A 4GAJH 1U8HB 1EXUA 5E8EA 3VGEA 1RIUH 3MV9E 1KJ3H 4GW1B 1AFVH 3KYMB 3NGBB 5CEZD 2PTVA 1MCWM 4WJ5B 3ZHDA 5DC0A 5IJKA 5L2KD 1ACYL 2WSKA 4X7TB 1QBML 1TJIL 4XHQA 5L2JA 1N4XL 1VFBB 5D7LB 4XI5D 4RGNE 3HA0A 3BH9A 1YEIH 1MCQA 1D5IH 2BSTA 4TVPE 3MNZA 1NLBH 4NWUL 1A6AA 3OZ9L 2DQFB 3EOAB 1C1EH 1N64L 2FDBP 3CGTA 3RY6C 4TSBH 3RVWC 4J23A 4KTDL 1HI6A 3H7BB 1ONQA 4LF3B 1OW0A 4EBQH 3QEQE 4OI7A 3WFEH 5C0FB 3SJVA 1RUMH 3LV3A 4UAOC 1F11A 3HRPA 3ESVF 1LO0H 4EQ3A 4KKBD 5EC1A 1U8IB 5BQ7A 2AJVH 4K8RH 1QRND 1DVFD 4P59H 1T0PB 4JRYE 3TA3C 4EI5B 2EDWA 3FQRA 1KT2A 2EYRB 3JSSA 1I85A 2NNAB 2OMNA 2H2PC 3REVB 4U1NB 3VXRB 3LHPH 4DVRL 1UXWA 4FXKB 4WDIA 5JMOC 1JI2A 2EDJA 1Z9MA 1NMBL 4LL9A 4FNLL 2DTMH 5J11C 4PJGE 2FBOJ 2VE6A 4M5YL 3HZKB 4IS6B 1ZHKB 4UT6L 5DK2A 5GXBB 1OCWH 4D0DA 2PR4L 1UJTA 2R8SL 3KXFA 3NCMA 2AJZA 3PIQB 1QFWI 3KWWB 2VIRB 3MCKB 4HBCH 3R06B 1UFUA 1Z5LB 3U4AA 3KPLB 1WZ1L 1HHGA 3OKYA 5D1ZA 1L6ZA 1JYWA 3HMWH 1XCTA 3CFEB 3GSRA 5C08D 4LRNL 3KLSA 5D9SA 4I3RH 4ZG1A 2BHUA 1A7RH 2AVGA 3QPQC 4Z7VB 4OIAA 3HN3A 4OLVH 4XCFH 4NO5B 1RK0A 4D3CL 1MFCH 5D7JB 4KK6C 5BS0D 4GW5B 3RL2A 3GSVA 5ICXA 1G9NH 2QADC 4JO3H 4F7CA 3CCHA 1ND0A 4PJ7B 5JPNB 1PJ9A 4LVNB 4BH8A 2NY5H 5FYLD 3EOTL 4PS4H 5A16A 4MXWH 4CL7A 2AQ3A 1TMCB 2FZ3A 2HTLD 1INQB 2F8XC 4OFDA 2OJZL 3G04A 3P77B 5MEND 4LSPH 1GVIA 2VZ1A 1NGYA 3MLYL 2OJEA 4P9MH 2D9QB 3RVUD 1AD9A 3V5HB 3G5XB 3VXMA 1IBGL 2Q3AA 3D39D 3ZKQD 2DMBA 15C8L 1PEWA 4J12A 1OAUH 3RHWF 2FJGB 4F7MA 5TF1L 1FLTX 1T1ZB 2R15A 4M8QB 1WIOA 4ZPVB 2R4SH 3T77B 1T22A 2IG2H 2G2RB 2XQBH 2UWEF 3CZJA 1A3QA 5IVXA 1JRHI 1PW3A 1SEQH 4JY5L 2PNDA 4IRJD 3SN6N 4OZGB 2HFFB 1PX4A 4JHZA 4J7RA 4PLKD 3GNMH 1J7VR 2VXTH 3SEPA 4QHKI 5TE6L 1FGNH 1HK6A 2N1KA 1I4FB 3MYZA 5GSVB 2I5YL 3QDMD 1U8QB 3I3DA 1T89A 1GHFH 2RCSL 1OP3K 1HWGB 4NRYA 5CJOL 3P4OA 4MD0A 4RWHA 1JYNA 4AZ8A 1GGIH 5BV7C 2OXHA 3NOIA 5FYKE 2AJXL 1JV5B 1T7YA 1A4JA 1IAIM 3C87A 3BKML 1YEFH 3GO1L 5GJSL 2BSRB 3KPRD 4E41E 1VEMA 4MAUL 5FYJU 4PJHA 1FVEA 4A2LA 1BAFL 1OLZA 1U95B 4LDEB 4WI2A 3O3EA 4MJ5A 2FEDC 3IJSA 3K46A 1M71A 4HC1A 3QUMB 4P46C 4Y1AB 4YHNB 3KLAB 6FABH 1UB5A 1K4DB 4LSRL 5FUZL 5TPWL 2WP3O 3IFPB 3OMZA 1A0QL 4G9FD 4KTEL 4IOIA 3OGCA 5L2KA 5IB1B 2V2TA 3TNMB 4LQ1A 4O5LL 4P2RD 1I9IL 1G0XA 1PG7H 4PP1D 4QRPB 4KJQC 4WW1A 2VDNL 3WCYA 2P8MB 3QHFL 4ZUVA 1T20A 4NBZB 2P5WB 4X5LA 2PO6C 3MRPA 3HMXA 4NKOB 1E4XL 2VXUH 1MCIA 3IDNA 2VMFA 2NW3B 2R0WH 4S2SA 3ULUH 3FN3A 2G9HB 2BC4B 3MXWH 4GAJL 4XXDB 1ZHLA 1RIUL 4X7CC 1LK2B 4Q2ZA 1AFVL 4WU7A 2E27H 2D7MA 2DLEA 1JF6A 4FTVD 1QRNA 1DVFA 4RMTA 4MJIB 4BFEA 4XBGA 2AW2A 3VJ6A 4NQED 3VXNA 1X5KA 4UZGA 4BZ2H 3KPNA 1HHKA 1DBML 1JVKA 3BPOB 2BNRB 4ZSOA 1N6UA 1G1CA 3HCVA 3HR6A 1D5IL 1FNGA 1NLBL 1L0XA 4FFVC 5EU7E 1YEDA 1RZKH 5E1HB 5HPMB 1C1EL 3VWJC 4ZO9A 2DBJA 3LEYH 3ARXA 5ALCH 5DVOA 2BSED 4AT6B 4ZO8A 4TSBL 3OWEA 3KYOA 4J3OC 3ULSB 1YYMH 1MSPA 1X3DA 5LAXA 4F7TB 1RSFA 5AD0A 2UV3A 2DM2A 3OHXB 4YHIA 4EBQL 3VFRB 4RFEB 2GHWB 3WFEL 3DYMA 3U7AA 1RUML 5IQ9B 1LO0L 4PJEA 5F89A 4NQXA 1QA9B 2AJVL 4K8RL 4P59L 1U8KB 4AENA 3V8OA 3VFNB 4ODUB 1I7ZA 1M4KA 4PR5B 2RJMA 3K8LA 3WHE1 3ZDXF 4O2FA 1CFVH 3MMEA 3EGSA 1ZE3C 3QEUA 4YBQD 3Q48A 1L6XA 5FK9A 5IB2A 5JIIA 3IFOA 5C08A 5C0BB 3LHPL 2Z93B 5KSBE 2H8PB 3LPWA 4U6XA 5DC4B 5DURD 1OQXA 3WLWD 3RTQB 3SDAD 2ARJB 1U8OB 3IDIB 4FQQB 2DTML 3BP6A 1K6QH 1BLNB 1X5GA 4C83B 4E5XB 5BS0A 1QEWA 3IDJA 1V3MA 2VISA 3EJZD 4U33A 4KKAC 3O6MH 1CLYH 4PLKC 5GQBA 4G8FA 2N4IA 4HD9A 2VXQH 4HBCL 1BFSA 1W72H 1IKNC 2Q86A 1KV3A 1S7SB 4QXWA 1FVDA 3PF2A 4X6EA 4XVTH 4U6HB 4MB4A 1GC1C 2FIKB 5JW5A 5MENA 4K7FB 4BQ6A 3HMWL 3H9SB 3MRLB 1FFRA 5H94A 4I3RL 4X6DA 5E5MA 2BOBA 3FQXA 4WCYH 1A7RL 1BJMA 3D39A 2XN9B 2DM7A 4OLVL 4NHUA 2K3TA 1UZ6E 4XCFL 4BKLA 1A9BA 1CTNA 1MFCL 1K9TA 4Z0BH 2NXYD 1AGDB 5IMMB 5A2KH 4IRJA 4JO3L 3L6FB 4PJAB 1XGYH 2R2HB 4UTAH 2OTUA 1ES0A 2NY5L 2VLME 1FL3A 4PS4L 4MA8H 5IEHB 1B0WA 1BZ9A 1P4LA 2OP4H 3HRZB 4G8GE 4UDUB 2MJWA 5J89A 4LSPL 3QDMA 3OJDA 4XPBH 5DUBB 4P9ML 3G6JE 4P23B 4Y4HD 1I8IB 3SDXB 2XV6B 1PYWB 1OAUL 3O6FB 4DGVH 2ZSWA 5IFAH 4X5XB 2R4SL 5I71B 2IG2L 2KKQA 2XQBL 1NUGA 1FFQA 2YXMA 4X4XA 3UTQB 1YNLH 3CFJA 3SBWC 4OF5A 5IKCA 3BRGC 3KPRA 4KK5C 3WIHH 1SEQL 4XWGH 2HJFB 1RUKL 3QUZD 4LASH 3GNML 2VXTL 4LCYB 3EOBB 5JDSB 5IMOA 3RWJB 5HI5C 2ENYA 3H42L 1T7VA 1FGNL 4U1SB 3VFUB 1FFOA 4G9FA 1NFDF 3H7LA 1U41A 1GHFL 4HV8B 1BBJB 4P2RA 3JXAA 2VDOH 3F58H 2FLBT 2YN3A 2GK0B 4M9PA 3MRJA 3O3UN 4HQQH 2IALA 1MCBA 5BRZD 3RIAK 3V5KA 4MNHB 1NC4D 5TFSH 3RX7A 3V95A 8FABA 1YEFL 5CSZB 4JQXC 3SBWA 4KKLC 4PJ9B 1BZ7A 2R2EA 1PG7X 4OAWB 4WV1C 3QXAB 4HBQA 5EO1B 1R0AH 2GQHA 5D7LE 3RRQA 4F33B 3VFSB 6FABL 1HKFA 1KGCD 1YEEH 4NT6B 1T1WB 4FQJH 5IEKA 3QRFM 3PXHA 1LVEA 3BGMA 1G6VK 2HT2D 2ZNWA 4FTVA 4C54A 4CADA 2QSQA 3HZYB 1LEGA 3EDEA 5J1SC 4NQEA 4P2QB 2DQGH 2PTUA 1DQDL 2WQRA 5HDBE 1I1FA