4P2VA

Structure of the ai-2 processing enzyme lsrf in complex with the product of the lsrg reaction p-hpd
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
281
structure length
281
Chain Sequence
DGKDFRTDQPQKNIPFTLKGCGALDWGMQSRLSRIFNPKTGKTVMLAFDHGYFQGPTTGLERIDINIAPLFEHADVLMCTRGILRSVVPPATNRPVVLRASGANSILAELSNEAVALSMDDAVRLNSCAVAAQVYIGSEYEHQSIKNIIQLVDAGMKVGMPTMAVTGVGKDMVRDQRYFSLATRIAAEMGAQIIATYYVEKGFERIVAGCPVPIVIAGGKKLPEREALEMCWQAIDQGASGVDMGRNIFQSDHPVAMMKAVQAVVHHNETADRAYELYLSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized aldolase LsrF
publication title LsrF, a coenzyme A-dependent thiolase, catalyzes the terminal step in processing the quorum sensing signal autoinducer-2.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
total genus 79
structure length 281
sequence length 281
chains with identical sequence B, C, D, E, F, G, H, I, K
ec nomenclature ec 2.3.1.245: 3-hydroxy-5-phosphonooxypentane-2,4-dione thiolase.
pdb deposition date 2014-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01791 DeoC DeoC/LacD family aldolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4p2vA00
4MUZA 1PIIA 3NQ2A 1XKYA 5LSMA 1VLIA 4NJHA 3IIZA 2TSYA 4FNSA 3HGJA 5AHLA 3MP4A 1GTHA 3BO9A 3O05A 4OGZA 1ZJIA 2YYTA 3GNNA 1Q6QA 3W87A 3P81A 2PE4A 5HWMA 5D04C 3ABSA 4AWTA 4Y8FA 2WOQA 2YYUA 3EWZA 4N9CA 3UPWA 4GUHA 2ZYFA 4NZJA 5I3HA 4UTWC 1GEQA 1R2RA 3C61A 3DKJA 4O57A 3SECA 3TK7A 5HUPA 3LI0A 3L5AA 4NJIA 3GNDA 4EIVA 1W37A 3DU0A 1WAUA 2QDHA 3E9AA 1TPVA 1ICPA 4MVAA 5IM51 3G18A 6ALDA 1K8ZA 3W7EA 2YW4A 1OYAA 1LROA 2QUVA 3JS3A 1EP1A 3W7GA 3TROA 2A0NA 3MI6A 1TV7A 3P5YA 3SGZA 1XDLA 3TCEA 2VEPA 2ZZ4A 3HPZA 3TA6A 3G1AA 1RPXA 3G0SA 3TFCA 5U4NA 2DZSA 2QKFA 2YFNA 4GUFA 1LRNA 3HOJA 2X30A 3NXFA 2YX0A 4JNMA 4U28A 4YLWA 4O17A 3LCLA 1Z41A 1D3HA 1YDVA 3NA8A 4KKXA 4MIMA 3KFTA 3LHTA 5HR7A 4RCXA 4OV4A 3USBA 4QAIA 3DI0A 3ANYA 3N14A 3M1ZA 3RNDA 3WK0A 1GVOA 2QEZA 4O4WA 1RQBA 1LM1A 3E02A 4RLIA 2QDGA 5ABTA 1MEIA 3NQ7A 3RK8A 3LTSA 2NX3A 3EB2A 3VNDA 3LLDA 1SW3A 2QUUA 4XKYB 3S1UA 2I9EA 1FDYA 3G8EA 5EBUA 4UTTC 4UTLA 2ISSA 4JDBA 2BWGA 4IMGA 4AHOA 4HSNA 1DHPA 4NNAA 3QSRA 2ZRVA 3T7VA 3OVPA 3RU6A 3W7PA 4O10A 3F4NA 1JRCA 3IVUA 5AOUA 5AHNA 2NUYA 1QO5A 5CZJA 4O54A 1QR7A 1XC4A 1K7FA 3KX6A 1OF6A 1H61A 1OF8A 1GQNA 2HS6A 2P0OA 2WNQA 1G4SA 3IVTA 3NDOA 1PHWA 2NWRA 3M6YA 5GVJA 5F2IA 1AG1O 4XBSA 4ADUA 3LRMA 4FX7A 1FXQA 2Y7DA 3NQDA 3KOFA 1VS1A 4IPIA 5D2XA 4LV4A 4JIPA 4JD4A 1W0MA 3T55A 2V8ZA 2E5CA 1I2NA 1TSIA 2WNZA 3LXAA 4O50A 4OV9A 3PULA 3LLFA 4LOCA 3O8AA 1P0NA 3BW3A 2ZCGA 3CT7A 1TJPA 1NVMA 1WOBA 3MHFA 1P4CA 4GUJA 1YLVA 3C2VA 4LS2A 5K4XA 4IWWA 3DH7A 2ZQ0A 3R8RA 1UJPA 3TH6A 1EUAA 1M6JA 2ABBA 3FLUA 1A5AA 2C1HA 3QF0A 3A9IA 2W79A 1QOPA 4IGHA 4D2JA 2C13A 4JTEA 1H7RA 4HKPA 1W3IA 5FEZA 1S5VA 4UFHA 3IGXA 5BW6A 3NQGA 2GQAA 3BGJA 2B7PA 3EX4A 4FNQA 5C2XA 3L5LA 3L9CA 2E6DA 1F7BA 3DGRA 3G8RA 1K3UA 4UFJA 2ZZ2A 4ZQPA 1ZALA 4TX9A 1JCXA 4AWSA 4PL2A 2QCCA 2XN0A 5LZLA 1UB3A 4Z1BA 3W1UA 2VEKA 4IQLA 4YL2A 2CFFA 3DZ1A 2Z2UA 5AYZA 4OBTA 1TTQA 2DORA 4Z0SA 5HR6A 4WXYA 2EPHA 3FKKA 2PC4A 3JR2A 5D37A 4CQAA 4FF7A 4N2YA 1W5OA 2QJGA 2ZFAA 3W22A 4JX6A 3NL6A 1ZAJA 4MYAA 1SO4A 3A5FA 3O07A 4IMDA 4DO6A 3I7RA 5K9XA 2FIQA 3KVLA 4ORIA 1I2PA 3YPIA 1GJPA 1TPDA 2BZNA 4BF9A 3U8GA 2VFDA 2NUXA 2VFHA 1AK5A 4LUJA 4AF0A 1F6KA 3QMRA 5D05A 1YXCA 4DELA 3W2NA 3TAKA 3PSWA 4GXMA 3NQ8A 2Y85A 3LTPA 5CKSA 1Z48A 2TYSA 1VRDA 5FF0A 1OK6A 3UWUA 3N3MA 2FB2A 4OU1A 1QOQA 3INPA 1W5NA 4ALDA 3Q37A 3O6YX 4UIOA 3R5EA 4BR1A 3GXNA 1FWRA 3QQ0A 3G3DA 2WJZA 3P5ZA 4O14A 3NYZA 3W7LA 3TFXA 2A7PA 1P1XA 4M6VA 2H3BA 3Q94A 1H7XA 4N4QA 4LU0A 2FPTA 4MPQA 4QQ3A 1G4EA 4RJEA 1JRBA 1JCYA 4NNCA 2V5BA 4MFEA 2CLHA 3HG5A 5G2IA 5G4EA 2X1TA 4MKNA 2A2IA 1IF2A 3G1FA 3GAYA 4YCOA 3STGA 3KHJA 2X1SA 3S1WA 2NXHA 1JUKA 4S2CA 1PV8A 1H63A 5FEXA 5AHEA 5BOOA 3MO7A 3I65A 3PBUA 5A8GA 1O5KA 4S1FA 4O15A 3W84A 3MP5A 4DF2A 2VKZG 1HO1A 2NV1A 1ZFJA 2R91A 5BMXA 2VOMA 3P82A 1TIMA 1G7UA 1J4EA 1X7FA 3CPRA 4N9EA 4A3UA 2NZLA 2VFEA 5C54A 1TPEA 1HO4A 3M7WA 4ADTA 2WSRA 1VYPX 3PVFA 1N7KA 3H55A 4WZHA 3QMTA 2WSQA 1XBYA 2WPBA 4LVAA 2HTMA 4JIQA 4FB7A 3GX9A 2B7NA 1U83A 1F76A 1JQVA 3STCA 4OT7A 3PBVA 3TW7A 4JXCA 3H54A 3L66A 3NL2A 3M9YA 3IGSA 1YYAA 3W88A 3PUOA 3W7QA 4XTDA 2UV8G 1SQ7A 1WQ5A 4E2BA 1NFBA 1QO2A 3CQ0A 2GUUA 2HMCA 3BVJA 5J5DA 3EX3A 3RFAA 3CTLA 3GDTA 5DY3A 1UASA 2DZXA 1THFD 1OX4B 1OYCA 3EKZA 3W85A 3GZ3A 1LORA 3BG9A 4P61A 1D9EA 4NUWA 1F2JA 4WQ6A 1SZEA 2CLEA 3T78A 2A21A 5LNRA 1TQJA 1RQEA 3HB9A 3OEXA 1XBZA 3NQMA 5EYWA 3W70A 1Q45A 5CPNA 4DPPA 3EEGA 5HUOA 3WJXA 3C0JA 5DLCA 3LHVA 3PC0A 5K2ZA 3GB6A 2GVJA 3EXTA 1G67A 1I2RA 1JCNA 2G5WA 3NVTA 3O16A 3QH2A 4PODA 1OFRA 1Z42A 3FS2A 3C6CA 4HSOA 3TSDA 2OZ0A 4UNLA 2NXIA 1KM2A 3SY5A 1ZAIA 4N6EA 5C5YA 4GJ1A 1V5XA 2ZZ7A 1KTBA 2RKXA 3W1XA 3MJYA 1QWGA 2ZRUA 4G1KA 2QCLA 3B4UA 4MY9A 3MMTA 3W2LA 3JRKA 3UD6A 5FF7A 3NQVA 2BTMA 3W7KA 1H7NA 2AQWA 4MLJA 5AB3A 3ZFHA 3PS7A 5KZMA 3HJZA 5HULA 5LGXA 3AJXA 3IEBA 2Y62A 2CZFA 3STFA 4MJZA 3T40A 4JTKA 1M5WA 4WY0B 3P67A 3W83A 1Q6LA 3L0GA 4LVGA 5EL1A 3CC1A 1WOAA 3PF3A 2OT0A 2V9DA 2YFOA 1GZGA 1DJNA 5FEPA 1FDZA 5D03A 3HO8A 4WOQA 5A5WA 3HPSA 2ZDRA 4A21A 3E96A 3HPXA 1FCBA 5G1TA 1DJQA 4WD0A 5CG7A 3DFTA 1H7OA 4DO4A 4LTSA 1N8FA 4PEKA 2ZZ5A 1K7EA 4HPJA 5E93A 1PVNA 2R8WA 1VYRA 1MEWA 1GVRA 3WK2A 1O4UA 4NU7A 2XN1A 1OFQA 4FNUA 2Q8LA 2Q3RA 5AYYA 3GAKA 1GVQA 3ZWTA 2RHGA 3SIZA 3VFLA 5CPMA 1MEHA 3P61A 1TPWA 4IMCA 4K37A 5AC8A 5LHFA 1I8JA 8TIMA 1SW0A 1TCDA 2J6XA 5F4SA 4QM1A 1TPH1 3LHYA 1SSDA 3NEVA 3UPBA 2V82A 1P5BA 1YPIA 1UUOA 3C3NA 4WJEA 1SO6A 2JBMA 3IVSA 4KWVA 1GVFA 2A4AA 3DFPA 1IIGA 1SZGA 3TE9A 1EIXA 3L5MA 1MSSA 1LTDA 1TJRA 3VKJA 3WJZA 3CB8A 1TTPA 3AO0A 3P7YA 2E6YA 1LLZA 5D30A 3W1NA 1G4PA 1LP6A 3TQ0A 2QAPA 4Z1AA 2FFCA 5TBOA 3TXVA 5D09A 1Q6RA 3BGGA 4UTMA 1VR6A 4AVFA 3HG3A 1KV8A 3M5VA 1JULA 4NQ1A 3G1VA 5G5IA 1VJIA 3LCIA 3KVKA 3LRLA 4M5PA 2VXNA 2QAFA 3MP3A 3NZ1A 2CLOA 1OX4A 1RD5A 5I3IA 3S0CA 1TV5A 4HNVA 2VFIA 2XN2A 3G1HA 3NQCA 4IMEA 4KWWA 4YCPA 4PCFA 1FCUA 5AYXA 4K36A 1A53A 3ATZA 2VEMA 3OVQA 4H6KA 3HGOA 4UFMA 3M47A 5HWNA 2PURA 3S5YA 1QPNA 1OJXA 3DFSA 3V75A 1HL2A 1LOQA 2E5DA 3H53A 2JGQA 4NJKA 4RXFA 3LCWA 2DU2A 4U4MA 3LBMA 1LBMA 3RMJA 3SI9A 2GQ9A 2QR6A 1SZNA 3I7SA 3PG9A 2ZRYA 3S1XA 3S9YA 4ML9A 4ONVA 5AHIA 1FBAA 4B5NA 2PRHA 5C6MA 4LW7A 2TMDA 4NXSA 1V7YA 1IIHA 4J9JA 2GJNA 3FKRA 3BG5A 4FHAA 2QCFA 1AW5A 4Y9AA 1XUZA 1EEPA 3W74A 4POCA 1VLWA 5D2YA 3IIOA 4GWEA 4NX5A 3QSTA 3LCHA 4PC8A 3MYPA 3CIWA 2B7QA 1AL7A 1O5XA 3OG3A 4FXRA 2O7QA 3QZEA 3B0UX 3S6DA 4UFKA 4ZQNA 3BW4A 1OK4A 4I9AA 4QJ1A 4H3DA 4CCDA 1XM3A 4JTGA 5D2VA 4YWIA 3BLFA 3EWWA 3B06A 2AGKA 1I4NA 2PCQA 4FO4A 2A5HA 4TO8A 2FQIA 3W7OA 1IXOA 2DP3A 2ZRWA 3NL5A 3W7JA 5G4WA 3UXAA 3TX9A 1FUYA 1FQ0A 2X1UA 4JX4A 4O0ZA 4XBKA 2C19A 4LVBA 3CEPA 3OBKA 5DCEA 2CLFA 1OFBA 4XTIA 3F4WA 4LRSA 3TC6A 3A24A 5BRBA 1H7WA 2VELA 1KLZA 1H5YA 3MI2A 2Y7EA 4UTIA 5CZSA 1ALDA 2ZTKA 2TPSA 3WK3A 3DENA 4NJGA 4FX6M 1KFBA 4N6FA 3W7DA 4A29A 2A7NA 1LOSA 3WJWA 3LXBA 1EUNA 2H8ZA 3G1XA 3NOEA 3LM7A 4AHPA 4GNJA 3W76A 1DOSA 1FXPA 3FFSA 1SW7A 4A2SA 1VH7A 4Y90A 1KTCA 2E09A 4BK9A 4NJJA 1JJKA 3C8FA 3N2MA 3KRZA 2E6AA 3OVRA 4IMFA 2E68A 2O7SA 4UR8A 3P8IA 5FESA 1XUUA 2W6RA 3P80A 4W9TA 1M7PA 2PRMA 3GDRA 4CCCA 1YPFA 2GQ8A 3LHZA 2FLIA 4CNNA 3VI2A 2J24A 3OHIA 5BNKA 4CLMA 2Y61A 4LS0A 1KLYA 5K9DA 2ISWA 4TR9A 4JR5A 2PRLA 1LBLA 4R53A 1B4EA 5LNSA 1YADA 1G4TA 3G1SA 1R2TA 5D38A 2FJKA 2Y63A 2A7RA 4RZ5A 4GUIA 4OHQA 1DQWA 1R30A 3W1PA 4HNNA 3FYOA 3NAVA 1YTDA 5BMWA 4PL1A 2DZUA 4MYXA 4MZYA 3M0ZA 4CCEA 3CU2A 2A6NA 4ZQRA 2KZHA 5FF4A 3W1QA 5DBUA 3ZWSA 1ZAHA 4S2BA 4O28A 3M5ZA 1UUMA 1S5WA 4O4VA 4RKAA 1FCVA 2BX7A 1WYIA 1OYBA 3TAOA 5AN7A 1H60A 4AXKA 2CLKA 4O12A 1QCWA 1H51A 2FDSA 5I3KA 3KRUA 4BWLA 3DAQA 2QUTA 3EXSA 1YTKA 2GJLA 2QCHA 2TRSA 3FOKA 1NEYA 2H8XA 2V2HA 1O94A 4O16A 5HQEA 4LWWA 1LDCA 3C2OA 2C3ZA 1W31A 3DHDA 3C56A 1SFLA 2NX1A 3CIXA 4H4IA 1KM3A 5G1YA 3C2RA 4UMCA 4XKYA 2A1YA 5AFDA 2Z6IA 5I3JA 3LTYA 2ZA2A 2Y88A 1M7OA 3TSBA 5LNUA 3R2GA 3SFKA 3NZRA 5CSSA 1ZENA 3LV6A 3G1DA 1JVNA 1A50A 3KXQA 1CW2A 2RDUA 3W1AA 4JTSA 5FI8A 4UTHA 1W3TA 4IX0A 5IBXA 1IXNA 3C52A 3NPVA 4FNTA 4C1KA 1OVDA 2H3DA 1ZY9A 5KSWA 2H90A 3VCRA 4AH7A 1TMHA 4JYDA 1JCLA 4JGDA 5DN1A 2V81A 3SGUA 2ZA1A 3DI1A 4WUIA 4QSHA 5F2MA 1NSJA 5SWUA 2RFGA 2Y70A 3A5VA 5AC7A 4RK8A 1KA9F 3LBCA 3B0VC 4IJBA 1KBJA 5DXYA 4X9SA 3MBDA 4M19A 3HG2A 2B7OA 3DFNA 3LGEA 3IIVA 2FPVA 3HIJA 2CWNA 2QCMA 4EWND 3FEMA 5FF3A 1RR2A 4N9DA 3LB0A 3GXPA 3C4UA 2C15A 4IPJA 2C0AA 4AWUA 3ELFA 1KFLA 4O13A 3TV8A 4Z08A 1A5SA 3NQAA 4MY1A 3S8HA 3TR2A 2C14A 1I2QA 3HGSA 1XCFA 3DFOA 1VYSX 4M7TA 3CWNA 3N19B 5LNVA 3CWOX 4YMZA 3B04A 1SFJA 2G97A 1LLWA 4LVFA 3R12A 1J2WA 2ZZ1A 2C6QA 3LHUA 1IXQA 1FWTA 4O1DA 4DXVA 5HMSA 1EPXA 1MXSA 2BLEA 3T44A 2EF9A 1TTIA 2CW6A 1CX9A 4IXXA 4LV9A 2JGYA 3QFEA 2V5LA 2NWSA 1OX5A 4HPXA 3SSJA 4O1AA 2H6RA 3M43A 1GYNA 3GXTA 3QMSA 5F2LA 2RH9A 3MYOA 1QPQA 5MHBA 3L21A 1VC4A 3UNDA 1BTMA 2X16A 5EA9A 3TNOA 5H2ZA 5F4XA 4FEZA 3FIGA 1JUEA 1RQHA 4Z1DA 4ZQOA 3NO5A 3FJ6A 4LT9A 3ZS4A 4ZL1A 1LYXA 4MZ8A 3SR7A 1R46A 1TQXA 4JTIA 5KITA 3BLEA 4XWUA 4CQ9A 2V0TA 1SO3A 2YCEA 4UMAA 1DKWA 4Q33A 1LRTA 3NPWA 4KFOA 4GBUA 2WKJA 1KBIA 2C18A 1PE1A 3A21A 4UTWA 1NAL1 3GYEA 4ADSA 3DKLA 2ZZ3A 3M5XA 1ZCOA 1XL9A 1QDSA 3W7RA 3PB0A 1ME8A 1C9DA 1OFPA 1PCKA 5F4WA 2AAMA 2VENA 4DQWA 4ZQCA 4TMCA 3W71A 3F03K 2ATMA 1H62A 2Q3OA 2DZPA 4NZFA 5K9CA 1FWSA 3BK0A 1RZMA 2Y7FA 4PH6A 1T99A 4I7WA 5LKYA 3W2UA 3BPWA 2YZRA 4K8HA 4AMAA 5K3VA 3MW7A 1VCGA 2YW3A 3W23A 4DO5A 3LHWA 3HBLA 1UBSA 3NGJA 2CLMA 4OE7A 3CEUA 3O6DA 3PBYA 4UC5A 1A5CA 3QM3A 2QCEA 2ZA3A 3ZR4A 2NXGA 5C55A 2B0MA 1FWWA 4L4LA 1OFDA 3IGUA 4K38A 3L68A 1ME7A 2CZEA 3NR0A 5DCBA 1W56A 4BI5A 4O0KA 3TJLA 4XQ6A 4HHPA 2WO5A 4LC6A 2ISVA 3L2IA 1CI1A 4TIMA 1T96A 3UYCA 4GE8A 4XZ9A 4PA8A 1ONRA 4O18A 4Z0JA 4M6PA 4AAJA 3N34A 2WSYA 2BSLA 2JK2A 1DQXA 4RV8A 2VC6A 1FX6A 3M16A 4Q4KA 3A22A 3W2JA 4K7YA 3OA3A 3N9SA 4UTTA 3BLIA 5DBTA 3I68A 4UFIA 1G6CA 4JEQA 5HWJA 3WK1A 1DV7A 3P74A 1SSGA 1T0OA 1E51A 3E0IA 2V30A 1WXJA 3B03A 3W6YA 4N4PA 4UTKA 3IV3A 1GYLA 1L6SA 3SJ3A 3S5OA 3MI3A 4R7JA 1W5PA 1MZHA 3UWWA 1LBFA 4CQ8A 3Q2DA 5EPDA 1LRQA 3P60A 3N73A 3EX2A 3EWYA 4O1CA 4JYEA 3C2FA 3I7QA 4UFLA 1TPC1 1QPOA 3PM6A 4UXDA 5E1QA 2OCZA 2F84A 4IOTA 1QNVA 1TPB1 2FTPA 1QPRA 5F1UA 3FA5A 3O6CA 1SU5A 2ATSA 5DCDA 3Q58A 4O53A 2YPIA 3BW2A 1ME9A 3B0PA 5I3FA 3TDFA 2ZRXA 1TRDA 5TIMA 1YXYA 1X8FA 2DJXA 2J9YA 1XDMA 2ZZ6A 4UCGA 1NF0A 3VE9A 4BFAA 5KINA 4MFDA 3THAA 5LGZA 4PTNA 5F1VA 4I7VA 3NM3A 3TKFA 3P62A 4ZMGA 4UMBA 1OABA 2VEIA 2W0UA 4AF0B 2QJIA 5D33A 3NPXA 5KMYA 3CLMA 1B9BA 5LNWA 1GWJA 3MWAA 3STEA 3WFAA 4Q32A 4FX8A 1KFEA 2V2CA 3BV4A 4A22A 3I6RA 1H1YA 3UWYA 1Q6OA 1P0KA 3DHFA 1OFAA 1LCOA 3FJLA 1B3OA 1EP2A 4ICNA 1IXPA 3G3MA 4KFPA 4RXGA 3UWVA 1R47A 1VHCA 4JX5A 1KW1A 4WY0A 4JY8A 1XXXA 2E1DA 3TJXA 3QPYA 1WV2A 2QJHA 2CLLA 1ZNNA 2QCNA 3GR7A 1QMLA 2I14A 5K7JA 4Y6GA 3W9ZA 1RVGA 2A85A 2J9ZA 2QCDB 1W1ZA 2JKAA 3OIXA 4JTLA 3EWUA 1C29A 5CPLA 3GLCA 1JR1A 2BXVA 4LUIA 3UQNA 1IGSA 3S42A 2DZWA 3MHGA 3CHVA 3W7HA 7TIMA 4UUIA 1TPFA 1QFEA 3WJYA 4HT3A 1K03A 2WV8A 1SZFA 3TU9A 3KVMA 5T26A 1L6YA 2CZDA 4WY0F 2NV2A 3N9RA 3QW4B 4N9BA 2J27A 2NX9A 3W1MA 4E0CA 4JTHA 4JYFA 3W1TA 2EGZA 5DELA 4ZZ9A 3DXIA 3LI1A 1JCJA 1ML1A 5AHFA 4ZQMA 1Z44A 3GIYA 3HF3A 1K02A 1H1ZA 2YXGA 3QW3A 5TQLA 4DPQA 3GDLA 4QISA 3LX9A 2E77A 2OX1A 3HQ1A 1B4KA 4DEFA 1VGAA 3G0UA 4FIQA 3GDKA 1HTIA 1KFCA 4CNOA 1JQXA 1G7VA 1DVJA 1T8XA 3G0XA 4QIUA 3THQA 1L9WA 5CZTA 4OQVA 1F74A 1YDNA 4DF0A 3LCGA 5HNRA 3F1QA 3DBPA 4MLRA 3GDMA 3T4CA 1ADOA 2VFFA 4UTJA 5CZ0A 1KFJA 3LRKA 3BG3A 2QCGA 1MO0A 1I45A 1AL8A 1WDWA 5EMUA 4K7VA 1X6UA 4FXSA 1F5ZA 1HG3A 3L67A 5L6UA 1WA3A 4YXGA 4JTFA 5E0KA 5F2GA 1TTJA 3CM4A 4FNPA 4R33A 3EXRA 5KZDA 5D2TA 4IXHA 1DORA 1X1OA 4WXZA 3L65A 4PFMA 1DBTA 1WX0A 5LHEA 3KAOA 4RR4A 3TMLA 4O52A 6TIMA 3HMJG 4E38A 4MZ1A 4XUGA 2YSWA 3O15A 4A2RA 3QJAA 1GT8A 4O11A 4M7SA 3GVGA 4NX0A 1KV5A 5AHMA 4DF1A 1S3HA 4O1BA 4JS3A 4HIBA 3O63A 1KM5A 1KM0A 4L4MA 1GTEA 3W2KA 3O06A 2P10A 1R2SA 4JN6A 3UZ5A 5H91A 1KM1A 3QEZA 4JTUA 1GG1A 4CNPA 2FPYA 3TC7A 3S5ZA 1OHLA 1JUBA 3W2MA 4K8EA 1OFEA 3KRSA 4TMBA 1SPQA 2NLIA 3TUUA 3TQKA 1BKSA 1TB3A 4M6QA 2YR1A 3LDVA 3SZ8A 4P2VA 3W07A 4GRSA 4EOUA 3NQ6A 3GKFA 3RLUA 2FB3A 1AW2A 2CLIA 4R34A 1BWKA 1OFOA 3NNTA 1Y0EA 1LZOA 3ATYA 4JDYA 1EX5A 4AHQA 4HNTA 4WX2A 5HINA 1YTEA 5FF2A 3PB2A 1F6PA 4K6AA 3G1YA 4EF8A 4RZ4A 5G2HA 5I3GA 2CU0A 4I7UA 5D2WA 1K8XA 3SW6A 5K4ZA 3RLVA 3E49A 3W7NA 1GG0A 3G24A 3HGRA 1B57A 2X1RA 5CGQA 1OX6A 4UTUA 2QCDA 2G95A 4LY8A 3PSVA 1H50A 1EA0A 3QPZA 4IUOA 4LNYA 4O19A 3GKAA 3UWZA 4EVZA 3L0KA 3PWAA 3WJSA 4NVTA 2A6LA 3NPUA 4GUGA 4AEOA 1J5TA 4DBDA 2YDAA 1C8VA 5G2WA 3QC3A 1JCMP 1K7XA 3W7IA 4ORMA 1LOLA 1QAPA 2Y89A 4AB4A 1EWDA 1VCVA 3LCXA 4QNEA 1PL9A 2GPTA 3L0NA 2XFWA 2Z0IA 1X1ZA 4JTTA 5DXXA 1RV8A 3W73A 3W7MA 3UY7A 1XBVA 2J88A 3NQFA 1WBJA 2OMAA 1PCWA 1KTNA 4FNRA 1OG0A 3M5YA 2QF7A 1TV8A 2Y7GA 3EKLA 3IIXA 3NM1A 1NF7A 3PY2A 1BEUA 2HS8A 5KTLA 3G22A 3W7CA 2DZTA 3PUDA 3O1NA 3MHUA 4MY8A 3UZJA 5FEWA 4NT0A 3W75A 3UY8A 3U2OA 3ABOA 1ICSA 4O8RA 2EKCA 3B05A 4X2RA 4BI6A 1W54A 2ALDA 1VPXA 1KM4A 4X3ZA 1EWEA 3PAJA 4BWLC 1DL3A 3LOTA 5DY2A 3MUXA 3UWQA 2Y6ZA 2Z6JA 1I2OA 3BARA 2Z1BA 4RX0A 3EX6A 3S5NA 3GK0A 3R13A 1N55A 4Z1CA 2B4GA 4JICA 2ZBTA 3ABQA 1HUVA 3EWBX 1W5QA 4IX2A 1D3GA 1W3NA 4C1LA 4LC8A 1L6WA 1TO3A 4NXKA 3KVJA 2IQTA 2OJPA 4MJMA 3VE7A 1PS9A 1VQTA 3W72A 3TQVA 3P8JA 3S1VA 2D73A 1YDOA 2JKPA 2LLEA 1KM6A 2E5BA 1FWNA 1TREA 4LS1A 4UNKA 2E6FA 2YGYA 5L9FA 3TXZA 2GVGA 2WQPA 2R14A 4E2DA 1K8YA 5CPOA 1TPUA 1UCWA 3B8DA 2I1OA 3W86A 3P84A 4WOZA 5EKYA 1EP3A 1XBXA 3W1RA 3UXDA 5IBXC 5CSRA 3LCFA 1VZWA 3MBFA 3QQ1A 1TRIA 1AW1A 2EAWA 1S5TA 1TYGA 5EY5A 3V1PA 2G96A 3PUEA 2R94A 2J9XA 3PBWA 3A23A 2P1FA 2NUWA 2GVLA 3NQEA 5D32A 3W1LA 1AMKA 3ABRA 4JY9A 3W3OA 1O95A 4MOZA 3NG3A 3R89A 4HN4A 1XI3A 5KZEA 2DZVA 1GOXA 4DBEA 3TIMA 1GPWA 2DJLA 2V2DA 2ZRZA 3IIPA 1FY6A 4K39A 3N2XA 4JTJA 1Q3NA 1KFKA 5D02A 4Y96A 3RF9A 1SUXA 1W8SA 2OT1A 3TSMA 2F7FA 1FCQA 1G69A 3PG8A 1EB3A 3E12A 3EWXA 3IRDA 4N02A 3LV5A 1HFBA 4LRTA 4GFSA 3K30A 4RZ6A 1VCFA 2C16A 3QYQA 3TW6A 2WNNA 4KFNA 1XFBA 1WBHA 1H7PA 3GR8A 3M44A 3U6WA 3C2EA 1A5BA 3D0CA 1F05A 2ABAA 4ZVJA 2VFGA 4LVDA 2HSAA 3M41A 2X2GA 1PHQA 1SO5A 3NL3A 1O60A 5U7SA 4TU1A 3HG4A 4HNUA 1F73A 3TMQA 1BWLA 4NNBA 4GC4A 3EX1A 3QRHA 4QNWA 5J5RA 3LXCA 1GVSA 1U5JA 2EHHA 1YXDA 4X22A 2ZTJA 5HJLA 2CZ5A 3FYPA 2GOUA 1ICQA 1SR9A 3DFQA 4UR7A 1VHNA 1L2UA 2RDTA 1FDJA 2Q8ZA 4QITA 3LERA 4EF9A 2RDWA 1ZHAA 4FIRA 2JKEA 3PR2A 5AC6A 4BI7A 4OWGA 1W5MA
chains in the Genus database with same CATH superfamily
1E4IA 4MMWA 1X6LA 1XKYA 4M81A 2WW5A 4IFOA 3IIZA 3HGJA 4PBGA 5AHLA 3MP4A 1GTHA 2OOFA 3IJ7A 2YYTA 1OIFA 4ACZA 1HL9A 3P81A 2C7FA 4AWTA 1GOQA 4DZHA 4EPEC 2WOQA 2F2HA 1HGWA 2WHKA 2ZYFA 1BQCA 3M7SA 2HV5A 1GEQA 1R2RA 3E5PA 5HUPA 1V6WA 3CZJA 2VVSA 1IQ8A 3L5AA 3V0SA 4OJYA 2F38A 1WAUA 1UOKA 2QDHA 4LAUA 4MVAA 4ZO8A 5IM51 1A47A 3ZSTA 3W7EA 2HBXA 4JQ2A 2QUVA 3JS3A 3W7GA 1US3A 5ABEA 4GXWA 3CZGA 2A0NA 3SGZA 1CBGA 3G2GA 4PFHA 1Q6FA 2VC9A 3G0SA 4YIWA 1LL6A 2DZSA 2QLYA 3VIFA 3W00A 1R6WA 4F0SA 1PWLA 2F61A 2QJNA 2Z1SA 4YLWA 3ECQA 3LCLA 4AQLA 3R10A 3NA8A 3CMFA 3KFTA 1UH4A 1UQZA 3V4BA 4QAIA 4QG8A 2YCJA 3ANYA 3N14A 1VFTA 3VIOA 2XVLA 4NI8A 1GVOA 4FR6A 1FWHC 1LM1A 2VZTA 3AZSA 5ABTA 4AZGA 4LEQA 1LWJA 5DFAA 4JDBA 4ZFCA 4WLCA 3OVPA 4X60A 4QFUA 2O4MA 1JFHA 4MWAC 4GABA 1PYFA 4B4FA 2HJPA 4NF7A 5CZJA 3VFCA 1DYSA 3QR0A 2WSPA 2HS6A 2WNQA 3M0HA 1AUSL 2BOGX 3ZIZA 3VDHA 3GY1A 3LRMA 1PDZA 3NQDA 4IPIA 3GU1A 5TD4A 1W0MA 3UJFA 4QDMA 1V8EA 3T55A 2E5CA 1ELSA 1TSIA 3R79A 1W91A 4GY1A 4ZXLA 4OV9A 2VZVA 1NDZA 2XIJA 2VQUA 3BW3A 4RDZA 1A5NC 4JN7A 1YNQA 3TCSA 1YLVA 4PMVA 4AISA 4TX6A 1UJPA 1XIBA 1Z6KA 2ABBA 5HNTA 3A9IA 3ALGA 1PAMA 4D2JA 1H7RA 1XYBA 4IGMA 3IGXA 2OKTA 3VABA 1PKLA 3EX4A 2ISDA 1V6UA 4U5IA 4QE5A 3L9CA 3H2FA 2W61A 4DZAA 4IT1A 4L56A 1LQ0A 5E5CA 4IFKB 2QYGA 4PL2A 1SGJA 2AL1A 3EA3A 3TZFA 2VEKA 4IQLA 4YL2A 5LXEA 3VIJA 3E1F1 2CFFA 2Z2UA 5AYZA 2GSEA 4OBTA 1TTQA 1UWAA 1JPHA 2J13A 3BSMA 4Y9NA 2QGYA 4MM1A 1D7KA 3WQ6A 5CJMA 3FKKA 3FHQA 2PC4A 3JR2A 1HKVA 3SBFA 3KWXA 3VOHA 2CITA 4P5UA 2CYGA 4JX6A 1ZAJA 2X0YA 2EEXA 1BSIA 3RAOA 2FJUB 2BY1A 3O07A 4IMDA 4B5WA 3I7RA 2FIQA 3KVLA 3CMJA 2VFDA 2VFHA 1ONWA 1F6KA 5FJIA 4HBKA 5JH2A 5A3HA 2IXUA 3O6AA 5CKSA 1Z48A 3HPAA 4BEQA 1VRDA 4Q8WA 2XH2A 5FF0A 3F2DA 3UWUA 1BD0A 4M8UA 1W9UA 3TEVA 2AMXA 4S3GA 2E67A 1QOQA 3O6YX 4UIOA 2XVKA 3R5EA 4QBXA 5EBAA 5AYIA 2XH4A 4C1NB 3WUGA 1V6TA 2H3BA 1Z32X 3VVGA 5I7GA 4N4QA 1LUCB 4LU0A 2FPTA 4QQ3A 3VILA 3IANA 1XYAA 1EOMA 4GC3A 1GZJA 2QGHA 3PWGA 5G4EA 4JN8A 4PUNA 2VL4A 2X1SA 1UKTA 1ZJAA 2PGWA 4H8HA 2NXHA 1JUKA 4UOJA 4E3TA 2V3EA 5AHEA 4QGCA 3MO7A 3I65A 4US5A 1O5KA 1XD0A 2ODOA 2JALA 2GDVA 2JIEA 4DF2A 1J5SA 3CZLA 2NV1A 1ZFJA 5BMXA 3WQ4A 3K13A 3QZ6A 4P7OA 4ICMA 2X2YA 1HO4A 2ANUA 5BROA 3B0XA 3H55A 4WZHA 3VUSA 2WSQA 4HHHA 1JGIA 4PB3A 3PBVA 1VKFA 3BLLA 1E6RA 1F8MA 3AFBA 4DI8A 3NL2A 2PF0A 5LXXA 2PCEA 3WNLA 4E2BA 4HZ7A 1QO2A 1EGZA 1EXPA 3MS8A 4NYYA 5J5DA 5DO8A 4GACA 2OZ3A 3GDTA 4TVUA 3AQUA 1OC5A 1UASA 2XSAA 4IQDA 2VYOA 1THFD 1OYCA 1K4GA 3WD3A 1GKRA 1D9EA 4NUWA 4P61A 4M6UA 4WQ6A 1SZEA 4H9VA 2PDJA 1TQJA 6ENLA 3HB9A 3W70A 4DPPA 3LSCA 1M68A 5HUOA 3C0JA 3LHVA 3PJUA 3BURA 1O5RA 1K4HA 4G7EA 2YL5A 1JCNA 3NVTA 5FKYA 1KRBC 3O16A 1XLLA 2REQB 1UC5A 5FCZA 4IM4A 4LUSA 4HSOA 1V6VA 3TSDA 3WNOA 3SY5A 4Y2WA 1BYCA 4GJ1A 4E5TA 4CUCA 2FVLA 4LAKA 3MJYA 1QWGA 1Q6GA 1ADSA 3B4UA 5REQB 3WLMA 3MMTA 4DN1A 3W2LA 3UD6A 2BTMA 3FGCB 1H7NA 2VEGA 4B9YA 1A80A 2HPMA 4J27A 3PS7A 9XIAA 5HULA 5LIWX 4NAFA 4QCFA 3PPHA 4D6JA 3P67A 4GZIA 1TR9A 1P7TB 1U2YA 3KM8A 4J3XA 3MMDA 1WOAA 2OT0A 1QHPA 5A6KA 4CNUA 4REQB 2YFOA 3JU2A 1FDZA 2WVSA 3HO8A 4WOQA 3GHRA 2ZXDA 4WD0A 5CG7A 4EKJA 4V33A 2VCAA 3DIPA 2XIOA 4BEUA 1N8FA 5CC6A 3SRHA 1S38A 4CQCA 3QGKC 1O4UA 3LPGA 4NU7A 2XN1A 4FNUA 2Q8LA 3VK5A 1BPLB 2Q3RA 3GTXA 3H4WA 1UPMB 4PULA 1JI1A 4ZTYA 3SIZA 3S47A 1MEHA 4IMCA 4F0MA 3N9KA 1PJ9A 4DUOA 8TIMA 1SW0A 1TCDA 5F4SA 3ZMRA 2I5QA 3C3NA 1I1XA 2DZBA 4KWVA 1GZ1A 1IIGA 3U57A 1EIXA 1QVBA 3UCDA 1TJRA 3CB8A 4CNTA 3VXGA 3AO0A 2PWFA 4H00A 4Q4PA 2C91A 1LLZA 5CPQA 3W1NA 4K1WA 4WIWA 1YNYA 3WQ5A 2D3NA 4B3KA 1JDDA 5D09A 2JF6A 3BGGA 2Q8XA 4UTMA 5BZAA 1KV8A 4PCSA 1JULA 4H8UA 3AYRA 4PGLA 4TUFA 1M53A 2GJXB 5BRPA 3MP3A 4RNHA 4E8CA 3H26A 3BCFA 1OX4A 1HKKA 3N4FA 1RD5A 1RLDA 4HNVA 1OT2A 2VFIA 5IHRA 2XN2A 4JBRA 2XFRA 3NQCA 4ZTXA 4YCPA 5C71A 2A3BA 2P5NA 2PTYA 2QF8A 1A53A 3RG6A 3OVQA 3UW6A 4Y7EA 3M47A 3PP7A 1YDYA 4AZCA 4ECLA 3N17A 3VZZA 3AS0A 3T4WA 3SI9A 3AMGA 2BFGA 1SZNA 3WDRA 2ZOXA 1KBBA 6REQA 4YNGA 4ONVA 3USZA 3VGFA 5AHIA 1SM9A 1UPPA 1Q7MA 3BCJA 4B5NA 5D9NA 3DCPA 4J9JA 2GJNA 2OZTA 1AW5A 1E6PA 1EA9C 1ISZA 3BJSA 3IUHA 1EQPA 1EEPA 4HTYA 4POCA 1FKWA 4S3JA 1TWZA 2QPSA 4PC8A 1CGTA 1B3VA 3OG3A 2E8YA 2FMOA 1B3XA 1XLEA 3B0UX 1L2QA 1ZUAX 5CCZA 3AXHA 4H3DA 1XM3A 1E1CA 4YTUA 3BLFA 1B30A 3K5XA 1X6NA 2FDMA 4H7CA 3AZRA 1I4NA 2A5HA 4TO8A 5KETA 1MVYA 2DP3A 3EDEA 3W7JA 1R8LA 2BP1A 3SUVA 3ITVA 1AODA 5DCEA 2CLFA 2QDEA 1O1ZA 1A5LC 3UG5A 3OGSA 2DUZA 1TZ9A 4AZBA 1W9XA 2Y7EA 4UTIA 2XVGA 3DENA 3AHXA 2AOSA 4HK5A 1DIKA 4GKLA 3C0QA 3L12A 3LM7A 4XX6A 1H4PA 1VH7A 3KBVA 3S2MA 2X0HA 3ABXA 4BK9A 1UR9A 1ZGDA 1ITQA 3UG3A 3N2MA 3I3EA 2E6AA 3OVRA 3RLHA 3AIQA 3U9IA 4D8LA 4CNNA 1VB9A 3A3HA 2Y61A 3U5YA 4LS0A 2ISWA 4JR5A 3OYZA 4R53A 1UYQA 4WDTA 3W81A 1BRLB 3G1SA 4CVWA 5D38A 2Y63A 3R58A 4ZODA 4IP4A 4RZ5A 4AD0A 4AIBA 3WD2A 4JKMA 3MUZ1 5BMWA 3H7VA 4NZ4A 4TTUA 2J8TA 5B7YA 3M0ZA 2WC7A 3NUKA 1NFPA 3M5ZA 1S5WA 3UGVA 2BX7A 3AXKA 1W2PA 4K3ZA 2Q71A 4AXKA 1C8YA 1CLKA 3WNNA 2FDSA 1X1NA 4LAOA 4BWLA 1HP4A 1JXKA 3EXSA 3REQA 4IUGA 2QCHA 4QEEA 3AALA 2CXEA 2V2HA 1FWDC 4O16A 3MSYA 4E8GA 4H01A 3RPMA 4R7WA 4B4HA 1SFLA 1RA0A 1KM3A 3ZO9A 4JHMA 1IYXA 2WVUA 5AFDA 2WZTA 1RJQA 2Z6IA 4GK8A 1KGWA 5MKGA 3RRAA 2IKIA 2ZA2A 1SJAA 1EJVC 1JFXA 1SMDA 3MJMA 4PTXA 3OW1A 4DWSB 1KQZA 4I6KA 4PBEA 3LV6A 1QPKA 2CC0A 1HN1A 2OSXA 3AOFA 2RDUA 3BLOA 4JTSA 2OEJA 3A4XA 3VOFA 4UOZA 1EF3A 2XUCA 5IBXA 3NPVA 4H04A 4B5XA 1JF6A 2PGEA 4Z17A 1ZY9A 2IKHA 2VC5A 1W1TA 3VCRA 1Y5XA 3W0KA 5C7VA 3NO1A 4G1NA 3K4AA 2XTKA 3SGUA 2ZA1A 5SWUA 2C79A 2RFGA 3CHCA 4RK8A 2VT0A 1DTUA 1TZZA 1KBJA 2X05A 4M19A 2OGJA 2R82A 1A0DA 1CGYA 3TR9A 1UR0A 4ZE5A 3Q65A 2FPVA 5HBFA 1PDYA 4DZ5A 4IICA 3GH4A 3P0XA 2C15A 4GQ0A 4F0RA 1XH0A 1KFLA 7PTDA 2ZUNA 3CUHA 1WAWA 4H9ZA 1QBBA 4MY1A 1IR1A 1F9CA 4GJJA 2PTZA 1IZKA 3EOOA 3FW6A 4P7LA 5C9XA 2EG6A 1LLWA 4LVFA 3OG2A 3QXBA 3W26A 4O1DA 1EPXA 2EF9A 3E2SA 3QQWA 4PMRA 3AHYA 5LA0A 4LV9A 3EOSA 2ZDSA 3WUEA 2V5LA 1S2WA 1QNPA 3EWDA 2NWSA 3FSTA 1OX5A 1GK8A 1V93A 3SSJA 4LBUA 2YZ5A 1GYNA 2RH9A 3ME3A 5MHBA 1RPKA 1VC4A 2VP8A 3BSHA 5EA9A 4XIAA 4J40A 3ARWA 1J0HA 1VD6A 1OCNA 1KXHA 1JUEA 2RJGA 4J3ZA 3GG8A 1IHIA 4D6DA 3FJ6A 4ZQOA 1OB0A 1B54A 1CXLA 2NQ9A 1R46A 3BLEA 4XWUA 4CQ9A 3FAWA 1HIZA 1HJUA 4GBUA 4CU7A 3QY7A 3GYEA 3GE7A 4JHOA 3M5XA 2XGZA 1QDSA 3GXMA 1C9DA 1PCKA 1YIXA 4FLOA 4XVEA 4DQWA 1H11A 4IIFA 4IL2A 3F03K 3TONA 2FZMA 3VINA 5K9CA 1FWSA 1DJHA 1MQQA 2Y7FA 1XLMA 4PH6A 2ZX5A 4LNCA 2YZRA 1O66A 4AMAA 4XAPA 4PMUA 5HATA 3KRBA 4A8NA 4WKFA 2CLMA 3A4WA 4HMNA 3CEUA 5FIPA 4YU1A 2GYIA 4UC5A 3PZIA 2EPLX 3GTIA 2R1NA 2B0MA 1OFDA 3L68A 1UWUA 3NR0A 3GZAA 3WCZA 4JQ1A 4O0KA 3TJLA 3R6IA 1X38A 4LC6A 3RXZA 1CYGA 5IOBA 4ATLA 3GNOA 3UYCA 4W7VA 4GE8A 2PBGA 4Z0JA 1TJ0A 1EHNA 1GW1A 5GJMA 3RLGA 2VC6A 4V2XA 4UTTA 4GVGA 4UFIA 1PO9A 3L2MA 1KR1A 3VGGA 3OB8A 4FLSA 1VIWA 3E0IA 2BVYA 2NQJA 1IR2A 1J12A 4J7RA 2GLKA 1GKQA 5AC4A 4N4PA 4J3VA 4ICCX 1T40A 3RX3A 1UJQA 1BTCA 1J0ZA 3SJ3A 1ISXA 2ADAA 2DSKA 2IXVA 1KWKA 1LBFA 4CQ8A 3Q2DA 3NO3A 3P60A 3EWYA 4O1CA 1MFUA 4XKMA 3I7QA 1QPOA 3PM6A 1I0DA 2GGHA 2I56A 3R0UA 1XSIA 2X40A 2WBGA 1VEOA 3CPUA 1ME9A 3DC8A 4B5VA 1NP0A 2CHOA 5A8NA 1Q2SA 5M17A 4PMDA 3ARZA 3ARPA 3E74A 3OLEA 4LEFA 4AZ6A 2ZZ6A 1MW1A 4PTNA 5F1VA 5A6SA 5DMLA 5JBFA 1PX4A 3QTGA 2VRQA 1B9BA 1JAEA 1GWJA 3UJRA 5LNWA 1W9BM 4HU8A 3NGFA 4FX8A 2FZ8A 4A22A 1PB0A 4XVDA 1R85A 2DH2A 5JMUA 5A94A 5C2GA 4L61A 1EP2A 1IXPA 4C90A 3LMYA 1KW1A 2YA1A 2PD5A 3VMOA 1UD8A 3GWQA 4HMCA 3QPYA 2XFFA 3FJ4A 2EPMX 1J6PA 2QCNA 5JIWA 2I14A 3CAWA 3QOKA 1RVGA 2AKZA 4KQNA 3UP8A 1ZBCA 3H7RA 3CH0A 3LPFA 1W1ZA 2WZHA 4JTLA 1DXIA 2XZ9A 4AC1X 5EGRA 3CUZA 3N12A 3S42A 5RUBA 1R38A 2DT3A 1YW1A 5HOSA 1XSJA 1V0LA 1V08A 5I77A 2PTDA 1A4MA 4XBJA 1SZFA 1RHCA 3EPOA 4XO6A 1L6YA 1BYDA 4C6LA 1DJXA 1N8IA 3DHUA 3NSMA 4KWOA 3KOXA 1DWAM 3W1TA 1YKWA 5CSUA 5HMDA 1TVNA 3HURA 3GTNA 2RDXA 3SCOA 1JCJA 1ML1A 3L4ZA 1NDVA 5H8UA 4F4RA 1K02A 5EMYA 2YXGA 3H2OA 2VX7A 3QW3A 5TQLA 4U2ZA 3GDLA 3TTEA 2OX1A 5BXPA 2VGFA 3WLQA 3IPWA 3WF2A 3EEZA 4FAMA 3WELA 4QG9A 3NDZA 3PTMA 3DEQA 4OQVA 1AMYA 3LCGA 2ZUSA 3F1QA 2FZNA 4JQ3A 3UVAA 1AVAA 5CZ0A 1KFJA 3LENA 1ZZMA 1MO0A 3RX2A 4DJDC 4FXSA 1HG3A 3B8TA 3WD4A 1POJA 1JDFA 4WSJA 4JTFA 2WZMA 1C90A 3EXRA 2D1ZA 3APYA 1XQKA 3RCYA 1S2TA 1X1OA 4WXZA 3U48A 3BZGA 1TE1A 1WX0A 3KAOA 1D2KA 1GOOA 4RR4A 2F6XA 2WYSA 1H49A 2DFAA 4P8WA 4X0NA 4IMAA 3HMJG 4E38A 4GVFA 4L1WA 3MKCA 3O15A 4A2RA 3QJAA 4FOJA 2PDHA 3KS5A 3CUGA 3VD4A 2P88A 1S3HA 4G7EB 1V0NA 4GBDA 4O1BA 2OZ8A 2B31A 4UB9A 1KM5A 2IUZA 2NVCA 4ACYA 4WVXA 4LUSB 2P10A 3UZ5A 5H6HA 3RR1A 2V63A 1KM1A 2Z1WA 1UD4A 1DWIM 2HQAA 1N8WA 1RCXB 2Z00A 4DBUA 4LBRA 3PPGA 5AZ0A 4ML4A 4E2VA 2BOEX 3WLPA 2OXNA 4RNJA 1BKSA 4G9PA 1E4LA 2XHYA 2EG8A 1EYWA 4P2VA 2Y24A 1TA3A 4J3UA 1AW2A 2CLIA 1BWKA 1OFOA 1HJSA 2YA0A 3POCA 5HINA 1XIGA 4KF1A 3URAA 3ZYZA 2F6UA 3QLLA 3WSUA 1XRSA 1V3HA 3LYEA 3LEPA 4WDWA 5G2HA 1UQYA 3WKZA 5D2WA 3JUGA 3WMSA 5K4ZA 3O9NA 4MNJA 2QPUA 3HGRA 3XISA 1B57A 3KOZA 2G95A 4LY8A 3PSVA 3QPZA 1VBHA 4LNYA 3QR3A 4O19A 3WJSA 4A8LA 2E25A 1UKOA 3NPUA 1ZRQA 4AEOA 7TAAA 1XH1A 2PUZA 5H8PA 1TVPA 2YDAA 2ZVIA 5G2WA 3V18A 1EWDA 4XD3A 3CUFA 2QV5A 3L0NA 3W73A 5DXXA 2UY5A 3WQGA 3NQFA 2BY0A 4M29A 2OMAA 3IV8A 2QF7A 2JIWA 3BOLA 3PY2A 1A3XA 3G22A 4KEUA 3WY1A 5C7HA 3LN3A 1TKKA 4MY8A 2BV9A 9XIMA 1ZTVA 2FMNA 3AS2A 3AMLA 3LA4A 3U2OA 1DQUA 3ABOA 1ICSA 4O8RA 4DWSD 2EKCA 1ECEA 1IV8A 3B05A 3ICJA 1KM4A 3ZVHB 1AJ0A 3LOTA 2FGLA 3MUXA 5DY2A 3BARA 2YXXA 2Z1BA 3RYSA 3S5NA 4LCQA 3R13A 5H8MA 5CGTA 2D22A 1LQ2A 3GG0A 1LWHA 4Z1CA 4JICA 5I5RA 2CLPA 4EXBA 3QGVA 1TO3A 3L7RA 3WIJA 1GNXA 2IQTA 1PS9A 1VQTA 3W72A 1KC7A 3ZJKA 3TQVA 5HNUA 1HGYA 1Q63A 1XHGA 1JZ2A 2JKPA 3VIPA 2YGYA 5L9FA 3R7MA 4H6EA 3GC4A 2WQPA 4E2DA 2PGRA 3RO8A 3KE0A 5CPOA 1TPUA 4D8ZA 4NG3A 4F2TA 3B8DA 2I1OA 3P84A 4WOZA 1EP3A 3W1RA 2ZUTA 2E28A 2VCBA 3ARVA 4CCZA 4LFYA 4FXJA 2ZX8A 1S5TA 3SN1A 2G96A 1RSCA 2J9XA 3WBXA 1W3LA 1MZRA 1K8CA 2D23A 1R3QA 2NUWA 3NQEA 1A5MC 2VTFA 6REQB 5D32A 1O95A 1NM9A 4HA0A 2P3ZA 1DWHM 1VP5A 3R89A 1XI3A 4L9YA 5KZEA 2DZVA 3B0YA 3FJNA 3ZXWA 1NFGA 3H4GA 4F2UA 2V2DA 2ZRZA 1RY8A 1JPDX 3IIPA 1FY6A 4MADA 4AFYA 4K39A 1VFUA 4QJ4B 3GVVA 4UNIA 4JL1A 3RF9A 1DHKA 4LAZA 1KXQA 2F7FA 1G69A 2CERA 1CXHA 3V7PA 5I07A 1HFBA 4KRUA 2OELA 3K8KA 1VCFA 2C16A 2PDWA 1GJUA 3M44A 1POKA 1L6GA 4IPLA 1V79A 1VPQA 2WWCA 1WDDA 1CXFA 3P14A 3I4KA 4ATWA 1G94A 1S5MA 2BXYA 1F73A 4GOAA 3OQ8A 4DJDD 3VD9A 3QRHA 2EJ1A 1R3VA 1KGXA 1I6NA 2OGYA 5HDRA 1YXDA 4X22A 5HJLA 3FYPA 3DFQA 3V0TA 4E4PA 4QG6A 3LERA 1ZHAA 3B4YA 2JKEA 2AQOA 4OWGA 1W5MA 1N82A 4IFRA 3MUIA 3ZJ8A 4FNSA 3O05A 4OGZA 2VM8A 1HJQA 3W87A 1Z9AA 2PE4A 5D04C 3ABSA 4KBXA 5CC5A 4Y8FA 4L4PA 1GQJA 4N9CA 3GW0A 3TYUA 1MUMA 4WRHA 3UPWA 3BH4A 1EDTA 4GUHA 4LXFA 1NELA 5I3HA 4UTWC 1PKMA 3DKJA 4O57A 3SECA 4Q4QA 3N4EA 3BAJA 3CGTA 4D8AA 3HJEA 2ACUA 3E9AA 4H19A 2I5IA 6CGTA 4KCVA 2HCVA 2YW4A 3APGA 3KTXA 1LROA 1QI0A 4NIRA 1EP1A 3EOUA 3TROA 4AVOA 3MI6A 3S3GA 1BVZA 3P5YA 3WF4A 3AI0A 3BAWA 1XDLA 3TCEA 2ZZ4A 3HPZA 2V5DA 3TA6A 3TFCA 4ZCWA 3EOLA 5U4NA 1QK0A 3HOJA 2X30A 3NXFA 2YX0A 4GMEA 1CT5A 5AC5A 4O17A 3GVWA 1Z41A 4DBSA 4AC7C 3LHTA 2PLMA 4R9OA 5IXEA 5HR7A 4OV4A 3AUOA 3LGGA 1R87A 3M1ZA 3RNDA 2RAGA 3WLKX 1JYVA 1RQBA 4GH3A 3HQPA 1NIUA 3QV9A 1E73M 1MW3A 2NX3A 3EB2A 2ZVRA 3LLDA 3IJQA 2QUUA 3S1UA 2INEA 2XH0A 4KCWA 3E2RA 2IPWA 4UTLA 2GJRA 5MKGB 3LZ5A 3Q45A 3WZ0E 4HSNA 2ZXBA 4Z42C 4GXPA 3TTOA 1TJ1A 2Y5EA 3F4NA 1K9EA 3PPFA 2NUYA 3ITLA 4PMYA 1QR7A 1VRXA 1XC4A 4S3CA 5ABGA 3KX6A 1RP8A 1OF6A 1UZDA 1H61A 4FF5A 1OF8A 3NVDA 5FACA 2P0OA 4C6PA 3MUAA 1G4SA 2YB1A 4ZENA 4Q4MA 2QDDA 1AZ1A 2V3DA 1GHRA 3VD3A 4ADUA 3KOFA 1OY0A 2PDFA 4LV4A 4L1GA 2BGSA 5FA5A 3KHDA 4OUIA 4FSAA 1CCWB 4W84A 4O50A 2PWUA 3PULA 3O8AA 1P0NA 3OO2A 3CT7A 3MHFA 4MTVA 4GUJA 5K4XA 1RXOB 1M6JA 1A5AA 2C1HA 3WDIA 5T9CE 4HOXA 3F5JA 5FEZA 3KCOA 1XRTA 1TFVA 2YDRA 4I8DA 4AY7A 4FNQA 2DY3A 2E6DA 3DGRA 1M65A 3UVIA 1FWCC 3BC9A 4UFJA 4ZQPA 4D6HA 4TX9A 4US5D 3EA2A 1RCOB 2QCCA 1K9DA 2O9TA 5LZLA 1UB3A 4Z1BA 3W1UA 5BWFA 2J6VA 3E2QA 2P0IA 1FHDA 2F2KA 3DZ1A 2WSKA 2DORA 1EJ7L 5GNZA 2CBUA 4Z0SA 4RL3A 5E6ZA 5HR6A 2EPHA 2ZICA 2F9RA 4CQAA 1XGZA 3GVQA 2QJJA 5AY7A 1XLHA 3W22A 4GKTA 3MV01 3LBOA 3BV7A 3A5FA 1DTNA 4DO6A 3SO7A 1I2PA 3VKBA 4FALA 2O0TA 4LUJA 1AK5A 4XZBA 3QMRA 5D05A 4XUYA 2ALRA 1YXCA 1F07A 3BAXA 4AX6A 1V6XA 3PSWA 4WKHA 2O9PA 4ZXOA 4HCDA 4DVOA 3LTPA 3BZJA 1BSLA 2TYSA 5G1MA 1OK6A 4PRTA 3N3MA 2FB2A 3WQFA 4DYJA 1OSEA 4KEMA 2VNCA 4ALDA 2QUMA 3FVMA 4BR1A 1FWRA 1HL8A 3QQ0A 4IIDA 3WLJA 1AQMA 4LYRA 1RP9A 1XLDA 2AGTA 4C5ZA 1C91A 3IJDA 3QY8A 2A7PA 3Q94A 1H7XA 5LIXX 1G4EA 1KRAC 2WMHA 1JRBA 1QASA 4MFEA 5G2IA 2V67A 4W8BA 1IF2A 3G1FA 4YCOA 4LB3A 3GIPA 4IQEA 1HXJA 1H63A 2WMGA 5A8GA 2R1PA 2W62A 1E71M 1TMQA 4O15A 1JXJA 2VKZG 3B8VA 3H21A 1HO1A 2VOMA 3BWWA 1M1BA 1IEIA 3CPRA 2VFEA 3T05A 3AWOA 3KDNA 1TPEA 3M7WA 4ADTA 2WSRA 1VYPX 3WQ8A 6PTDA 4MUPA 2WPBA 2HTMA 2FZDA 4FB7A 4C7DA 3GX9A 4IIBA 1U83A 5ABFB 2WAGA 2DPEA 4OT7A 4JXCA 1JZ4A 4GIAA 3JVAA 3PUOA 3W7QA 4XTDA 4YHGA 3UG8A 4AY8A 3EPNA 1NFBA 3VM5A 2GUUA 2HMCA 3NSNA 3RFAA 2IQDA 1XLCA 4I6VA 1UROA 4Q7IA 4IFKA 4IISA 4KRZA 3MWCA 3BG9A 3GFZA 3LPOA 3O7UA 4B92A 3OEXA 1XBZA 5EYWA 3BL3A 5CPNA 5HAOA 3EEGA 2XGBA 3PC0A 3Q4DA 4H9MA 3ZVIA 4XZIA 1Q2RA 3WL1A 4PODA 2QIIA 3VDAA 1B3WA 3VCCA 6A3HA 5IFTA 2ZZ7A 2ZUWA 3SB0A 1KTBA 4KMQA 3CQHA 5A69A 2QCLA 4MY9A 2VUYA 1ITUA 2DSUA 4MB4A 3NQVA 2I17A 2AQWA 3IARA 5KZMA 3QHOA 1FHUA 4HTBA 2PDBA 3AJXA 2Y62A 1Y65A 3STFA 1XYFA 4GO9A 5CAKA 3W83A 3M0LA 2WXDM 3GRIA 5ABHA 3L0GA 4LVGA 5EL1A 3PF3A 3IK4A 4W5ZA 2FVMA 5JXQA 2XVNA 1GZGA 4C1NA 1FH7A 1P0DA 2OG9A 4LF1A 5A5WA 2ZDRA 4PR4A 1FCBA 4XO7A 1LUCA 4L1XA 1MRAA 2PDIA 2PLJA 4LSBA 2QZRA 4AD1A 3WH5A 4PEKA 3VOIA 3A6OA 1K7EA 2PDQA 1TG7A 5CBBA 1YX1A 1MEWA 3UT0A 3L2LA 1OFQA 1V51A 1GVQA 1JG9A 3G6LA 3ZWTA 1XRVA 2RHGA 3VFLA 1JPIA 1BG9A 1S2AA 5BWAA 3P61A 5D9OA 3COTA 4K37A 5AC8A 3C0SA 1XRFA 5J04A 1SSDA 4FZIA 3UPBA 4NZ3A 2V82A 1P5BA 1YPIA 1EJUC 4M1RA 2JBMA 3IVSA 3PZNA 1GVFA 3DFPA 1SZGA 3CQJA 3S2LA 4B3LA 3L5MA 1UWRA 5DT5A 1MSSA 1LTDA 3WJZA 1JZ5A 2XVPA 1WDSA 4JTQA 4L80A 2MUCA 2PP0A 4Z1AA 4X9YA 3TXVA 4AVFA 4PRWA 3G1VA 1WXZA 3GNRA 3PANA 3KVKA 3LRLA 4EXAA 2OLAA 2QAFA 3NZ1A 4MDPA 3DDMA 3VM7A 2A79A 2Q01A 3TN4A 4IMEA 1R9XA 4GQBA 5AYXA 4K36A 3PUGA 3GSMA 3SJNA 5HWNA 1AH0A 5G4HC 1OJXA 3V75A 3DBNA 2REQA 1HL2A 1LOQA 2E5DA 1UD3A 3DN5A 4WJXA 5HA7A 2HZGA 3W4RA 3RCNA 4Q7BA 3LBMA 1JZ7A 3CQIA 4IGNA 2QR6A 3T9PA 4GX9A 4JTAA 3MO4A 2ZX6A 4ML9A 2PRHA 1XP3A 1V7YA 3B8UA 2PFHA 3AIUA 3FKRA 3FGCA 3SSZA 2CCRA 4Y9AA 1BYAA 1JDCA 4ASTA 1QATA 4GWEA 3QSTA 1P7TA 2DDXA 5C8BB 3MYPA 3MCNA 2J75A 3IRSA 1N2VA 3CIWA 3FV9A 3TOPA 2Y8UA 2O7QA 3QZEA 4UFKA 4KESA 2NW0A 4P8XA 2PF8A 4C6QA 1DWGM 4I9AA 3AU6A 4Q6XA 4CCDA 1Z69A 4YWIA 1S2VA 3B06A 3M07A 2AGKA 1E15A 2PCQA 4GCAA 4CEXC 3MSGA 2FQIA 3OP2A 3L4XA 4A8IA 3S5SA 3TX9A 1FUYA 4O0ZA 1EXBA 2C19A 1HVXA 1C7SA 1ONXA 1XGDA 1OFBA 3TOYA 3OODA 3N04A 4LRSA 3A24A 1HKMA 4I3GA 5BRBA 1H7WA 1OWQA 3VMNA 3IJLA 1VAHA 3MI2A 1H41A 1NOWA 5A1AA 1WDRA 2X09A 1ALDA 1EF2A 3WK3A 4TOQA 1KFBA 2O9RA 3T0DA 1EBHA 3WYZA 1LOSA 2H8ZA 3KDOA 4I8YA 4AHPA 4GNJA 3DGBA 3H2EA 3FFSA 3GC5A 1SW7A 3WBYA 3BMWA 4Y90A 2YDSA 2E09A 1H0GA 5A6LA 1NOUA 4C6NA 2Z4GA 1R7OA 2O7SA 2W5FA 4W9TA 1YE4A 2PRMA 2VDHA 3GDRA 2GQ8A 3LHZA 2FLIA 5FD0A 1US2A 1K1DA 3VI2A 2VWTA 2PBOA 5BNKA 4TR9A 1GJWA 1ITCA 4CN4A 3H24A 3WLSA 2PDNA 1G4TA 5I2UA 1WE5A 1K77A 2XIBA 2FJKA 2A7RA 3A64A 5C9WA 4GUIA 3WUFA 3WN6A 1I1WA 2G41A 3W1PA 3WQCA 4PL1A 3EZ4A 4H9XA 4U31A 4ZBCA 1RBOB 2I7GA 2KZHA 3CL7A 3W1QA 4S2BA 3RHGA 4GD0A 1M01A 4EXQA 2P8CA 2P76A 2V38A 4PSRA 3IACA 1OGGA 3IAPA 1H60A 1GOKA 1TWSA 1IZJA 4O12A 1QCWA 1PYMA 1H51A 4YS1A 4PUUA 5DQPA 3G77A 2DIEA 1W3HA 1C3FA 3V5OA 5HJYA 2TRSA 2BGQA 1NEYA 4NKCA 3EDKA 3LSBA 2H8XA 1O94A 1RUSA 4W8AA 5C9UA 4A4AA 4NY2A 1VPYA 3C56A 3ITXA 3MZ2A 2NX1A 3CIXA 3KL0A 1ISWA 5G1YA 4XKYA 5IFPA 4F3HA 1FOBA 2H9AB 3LTYA 4AD2A 3W01A 2I57A 1M7OA 3TSBA 2AKMA 5DF0A 2WVVA 1VBRA 3PN8A 1TCMA 5CSSA 1ZENA 5TF0A 2HWGA 1VBJA 1TMLA 3SRDA 4GYJA 8CGTA 2ZWYA 4IX0A 2QS8A 3WMBA 2DW6A 4ERAA 4B15A 4LALA 4DX3A 4IGSA 5I02A 1WP6A 1ZBKA 1A3HA 1WXYA 4D1JA 1JCLA 4I5UA 1QBAA 2VX5A 2NV9A 2V81A 1EJRC 4B9ZA 1NSJA 1ZP3A 4L6HA 4UR9A 3A5VA 4ERIA 4GIYA 1KA9F 3K2GA 2VWSA 4AZ5A 3HG2A 3EBVA 3Q67A 1CLVA 3P3BA 3DFNA 3NZPA 4XAZA 3TLQA 2QCMA 4MKSA 1UC4A 1RR2A 4L9XA 1C93A 3GU9A 4Q8OA 3N6JA 1M3UA 2C0AA 4AWUA 3ELFA 3TV8A 3RITA 3PWIA 1XIIA 3H2MA 3U0HA 3S8HA 1Q8JA 2C14A 2XFYA 5H1WA 4OTKA 2JEQA 2PWVA 4HZ8A 4AZ7A 3CWNA 5BXTA 4H6RA 5LNVA 4GY7A 4PTVA 1BXCA 4W7WA 1EIBA 4LYPA 2J62A 3R12A 2ZZ1A 2C6QA 3AIBA 4HNLA 1IXQA 3ZQ9A 5HMSA 2BLEA 3SCRA 2CW6A 4BZYA 4IXXA 5T91A 4GZ7A 4F9JA 3QFEA 3KTCA 4A6GA 1DP0A 5HQLA 1QPQA 1EH9A 4J2PA 1AD1A 2VGBA 3GG7A 2C1IA 3GBEA 2WHJA 5H2ZA 3FYYA 4BQ5A 3NXLA 5F4XA 2EQDA 4FEZA 3TYEA 2R24A 3UJ2A 3ZS4A 2Z28A 1LYXA 2Y5JA 1W1A1 3U2EA 3ERPA 2V0TA 2P3EA 4Q33A 3NPWA 3H2NA 4KFOA 4RPPA 3A21A 4UQDA 3HZ3A 3D5HA 4PCTA 2RJHA 1ZCOA 1UH2A 4QX4A 1OFPA 3EAUA 2AAMA 4HCHA 2POTA 1AA1B 4PUKA 1MUWA 2ATMA 4RDYA 3L23A 4NHVA 2Q3OA 3FHAA 1H1NA 1RZMA 3IJ6A 3MKVA 1E9ZB 3KTSA 4I7WA 7ENLA 2WZEA 3BPWA 4DWDA 5K3VA 3U5UA 5I23A 1VCGA 4DO5A 3HBLA 3TYCA 4LANA 4J2MA 1QI3A 3LS9A 3E6EA 1F3TA 2NXGA 4K68A 1XG3A 3LLXA 4L4LA 1KCKA 5A2CA 4R7OA 1W56A 2B81A 4M82A 5E9AA 3C2YA 4JIRA 1WZMA 2WO5A 4A8RA 5CPSA 4TIMA 1T96A 3GXFA 4DM2A 1AH4A 4U2YA 1ONRA 3RDKA 2BGNE 4O18A 2V69A 3LZ3A 1OZMA 4EPKA 1LQAA 4AAJA 1DQXA 4Q4KA 2AAAA 3A22A 1NJJA 3OA3A 2QULA 4H83A 3BLIA 5DBTA 3I68A 2BS9A 3C8NA 3DFYA 3PJWA 3WK1A 1GW9A 1UW9A 1XISA 3P74A 3DERA 1E51A 4MWAA 2CBJA 2PDUA 4UTKA 2CETA 2Q09A 2Y5SA 3DYMA 4LJ3A 2Y8KA 4N42A 2R6OA 3AHTA 4R7JA 3UWWA 2Y2WA 1IEWA 4DLFA 1S5NA 1LRQA 4UWMA 4JYEA 3MVIA 3C2FA 3V5FA 4F8XA 2OCZA 3ITCA 2C8NA 2EBNA 2F84A 3P0WA 3VGEA 4IOTA 3C0LA 3AXXA 4DJFC 1UBPC 5F1UA 2Z1XA 2YPIA 3HQNA 5J8LA 3K1DA 3RR4A 4MPKA 1TRDA 2CEQA 3R43A 5CLTA 5TIMA 2RGMA 4K8GA 1X8FA 1R3YA 5LGZA 3A4AA 3NM3A 4F0HA 3P62A 4UMBA 4HK7A 1JNEA 4DAFA 5D33A 3BJTA 3GO2A 1G9HA 3MWAA 3S83A 4Q32A 1J10A 2V2CA 2RUSA 1JYWA 1H1YA 1UZHA 3LGDA 3VGBA 1R3TA 3FJLA 2BBFA 3WENA 3CASA 5F7UA 3UWVA 3W38A 3EA1A 4HPNA 4WY0A 3I6EA 4JY8A 4A35A 1SJDA 3VX0A 3TJXA 3LQLA 4R88A 5HMFA 4YPJA 1ZNNA 5DT7A 4EAMA 4ZOEA 2OWXA 4Y6GA 3W9ZA 2PWGA 2QCDB 3RJXA 1J79A 4TQTA 3A12A 1C29A 2Y0FA 5CPLA 8XIAA 1FVPA 3TW9A 3MV11 4PTDA 1JR1A 3KBWA 1FFQA 1QFEA 2OX4A 2CHRA 3WH9A 1UR8A 2Z2BA 2G8ZA 3CWHA 1A3WA 4Q8PA 3WO8A 1HP5A 2NV2A 2WCAA 2J27A 2YCLB 2GGGA 5CH9A 1B0IA 4E8DA 4C6JA 4B90A 4J28A 4ZZ9A 3T42A 1Z44A 3HF3A 3GFYA 3AZTA 3B9DA 3D3AA 1B4KA 4DEFA 3G0UA 4FIQA 1HTIA 3SCSA 3G0XA 1CTNA 4KGLA 3MKKA 4QIUA 2PDLA 2UY4A 1VFLA 3RILA 1L9WA 3WFLA 1I0BA 5CZTA 3GVRA 1M04A 3SUTA 2D2JA 3DBPA 5AVNA 3GDMA 1XICA 3T4CA 2PDGA 1TUXA 2QHAA 4UTJA 3K8LA 2PDXA 3LRKA 3RM9A 5EMUA 1I9CB 4WHBA 1QWKA 4K7VA 3CV1A 4OBRA 1CXIA 2C1GA 3P93A 5F2GA 4I5XA 4ZEPA 1RD6A 4GY0A 2GK1A 5KZDA 2GDQA 5LIKX 5JQ9A 3CL8A 3L65A 5LHEA 4GQQA 4F48A 1Q6DA 3TMLA 4O52A 1H2JA 3RPDA 3OBEA 1EYEA 2YSWA 3GVGA 1KV5A 2DT1A 2VR2A 2IMRA 3WNKA 3E5BA 4JS3A 3UXIA 3O63A 4AG0A 1RJRA 2WANA 1R2SA 4JTUA 1GG1A 4GNKB 4CNPA 2FPYA 4D6FA 4ENLA 3S5ZA 1J6OA 3AC0A 1OHLA 4K8EA 1BGGA 3KRSA 4TMBA 1SPQA 5E09A 8A3HA 3TUUA 2HVMA 3TQKA 4M6QA 3DG6A 3PJXA 3TA9A 3SZ8A 1S46A 4GRSA 2ON3A 4EOUA 3RLUA 1FWIC 2A3CA 4R34A 3D47A 1Y0EA 3ZR6A 4JDYA 3ATYA 4V28A 1X8CA 4ZO7A 1YTEA 2Q02A 3CT2A 1W8GA 4EF8A 4L9ZA 2CU0A 3W24A 2YL6A 3G24A 4FR1A 4E4UA 5HPCA 2V6AA 4B91A 2X1RA 5CGQA 1OX6A 4UTUA 1VEMA 1KKOA 2POZA 4IUOA 4FI4A 4HA3A 3VDGA 5BU9A 1Q4WA 6XIMA 3ARYA 2A6LA 3R11A 1LT7A 2PSNA 4PMXA 1M7JA 3BQ6A 3M0MA 1J5TA 4KIRA 2GUYA 4LCRA 3URQA 1FWAC 1XYLA 3WQEA 9RUBA 1JCMP 3W7IA 3AMKA 4ORMA 3LCXA 1PL9A 3E38A 3KP0A 2GPTA 3W7MA 3GFXA 3GNXA 3UY7A 1FHLA 1GEHA 1WBJA 4MKVA 2PD9A 3WDJA 1AQ0A 1BVNP 1KTNA 4FNRA 4GZEA 4WDUA 4CD6A 1TV8A 3EKLA 5E70A 3B8WA 3UERA 2HS8A 2CNCA 2G3MA 3W7CA 3O1NA 3MHUA 5FEWA 1E0VA 1ZB5A 1I60A 4QEHA 1T7LA 4JL2A 1JGMA 3ANUA 5A2BA 4DJFD 5CJNA 2WB5A 2ALDA 2WJFA 1VPXA 4GVHA 4X3ZA 2HVOA 2CKRA 3AJ7A 1I2OA 1M9HA 1QT1A 1P6CA 3M64A 3OYXA 3SUWA 4BQ3A 1N55A 2B4GA 2ZBTA 3KUMA 1W5QA 4R27A 3KBSA 1D3GA 1WO2A 3MA8A 1L6WA 1XJBA 4ZB0A 4Q4SA 5EB8A 4MJMA 3VE7A 3WLOA 3P8JA 1CDGA 1JZ3A 2Z29A 4C6IA 1FWNA 3W29A 4UNKA 2E6FA 3TXZA 1CGWA 6TAAA 2R14A 3ITGA 3OQEA 4D9PA 1UCWA 1Y7VA 2D2HA 1J8VA 3SIMA 3W86A 1XBXA 1UP0A 3UXDA 5CSRA 1Q4NX 1V4YA 3WQVA 1GOWA 1AW1A 4Q8UA 1H0IA 2IKGA 2EAWA 2VDGA 4P8VA 1TYGA 5EY5A 2R94A 4H2CA 4Z2IA 1NY1A 2JFEX 2GVLA 5GNYA 4URIA 2YA2A 3BQ5A 1AMKA 3ABRA 2QMJA 4PUDA 4C91A 2CXGA 3NG3A 3L4TA 3VIKA 4HN4A 3GW3A 1JD7A 4TX8A 4LB4A 1QHOA 4LF2A 2IPGA 3R4IA 4DLMA 4IIGA 1EC7A 3GG1A 4U3CA 2IPFA 4UBPC 2R1LA 2ZIDA 3N2XA 3F4VA 5D02A 4JTCA 4Y96A 2DVUA 2ONEA 2QT3A 1NH6A 1EB3A 3EWXA 4DUVA 2AMGA 4N02A 2BB0A 4LRTA 3TTSA 3CV2A 1OCBA 3QYQA 4L6OA 2TODA 4RDVA 1WBHA 4O0QA 3U6WA 3C2EA 4XZLX 3G6MA 3D0CA 4I9JA 4GQRA 4HHMA 4QLKA 1VEPA 1REQA 4PE8A 3QFWA 2XWDA 2BASA 3CAVA 3NL3A 2NLYA 1FP8A 4I5RA 3HG4A 1TUFA 3DHPA 4HNUA 2ACSA 3TZNA 3EX1A 3LXCA 1GVSA 2OWWA 4YYFA 2EHHA 1ZCCA 4PUWA 1ICQA 4GYPC 1MQPA 2W67A 4I9MA 1E1FA 4H2HA 2X41A 3MQTA 2RDWA 4FIRA 3BAKA 3CIVA 3NWRA 4AIUA 4Z2GA 2YBTA 3PR2A 2HISA 4MUZA 1PIIA 3S2JA 3NQ2A 3QPEA 3DX5A 5LSMA 2ZXQA 3TYAA 2W66A 3R94A 4L64A 3BO9A 4DYKA 1JL8A 3RPTA 3ZVHA 1F4HA 3GNNA 1G5AA 1Q6QA 2BXZA 5GPRA 1XLGA 4AZIA 2YYUA 1MNZA 5BCAA 5EFFA 4D6IA 4NZJA 3VAVA 3C61A 3TK7A 3GNDA 1W37A 2WLZA 3VU2A 5CJ5A 1X39A 1TPVA 3G18A 4QJ5B 6ALDA 1DE6A 1K8ZA 4CKQA 4KCTA 1UD5A 1GVYA 3XIMA 4YTTA 2V5JA 3G1AA 3UCCA 3UR2A 1UWQA 1UOZA 2QKFA 2YFNA 3UZXA 3MVTA 1LRNA 2XZ7A 4O1EA 1T8QA 4JNMA 4U28A 2DVXA 4KKXA 5T8GA 4MIMA 1RA5A 4RCXA 4CN1A 3USBA 1UD6A 4BS0A 4M80A 5D8WA 3OGVA 3TTQA 3WK0A 4O4WA 4J4KA 4RLIA 4AYGA 2QDGA 4FS9A 4GCXA 3VD5A 3VNDA 1SW3A 4XKYB 5FJOA 4MGGA 1V02A 1S3TC 3WEZA 4C7FA 2J47A 4HNOA 3GH7A 5EBUA 2ISSA 3VKDA 5E9XA 1DHPA 4NNAA 3QSRA 3SY1A 1O7AA 4O10A 3UESA 2WVVB 3V0UA 3IVUA 5AOUA 5AHNA 1BF2A 1EBGA 2YKKA 1GQNA 2KAUC 4G8TA 2E9MA 3AYVA 5FJTA 4GO8A 4AVNA 3M6YA 3PZVA 5F2IA 1O68A 3HV9A 1W1YA 5TNVA 4FX7A 2Y7DA 1E72M 1EFZA 4AD4A 1PZ3A 4JD4A 3H2CA 1GONA 1GGOA 1I2NA 2WNZA 3LXAA 1NWTA 3T6CA 4LOCA 4XG1A 3M46A 2ZCGA 3S1GA 1NTHA 1P43A 1TJPA 1WCGA 4GZJA 1NVMA 1WOBA 2PDPA 1P4CA 3C2VA 5CPTA 3KCLA 4IWWA 3RGTA 2R1KA 2ZQ0A 3R8RA 3TH6A 1EUAA 3FLUA 2Z26A 3QF0A 2W79A 1QOPA 2G4FA 3IUDA 4MB3A 4HKPA 3BE7A 4KS0A 4UFHA 4Q7NA 5BW6A 2YIHA 3A3XA 2GQAA 4PB5A 3U2CA 2B7PA 3ABZA 1D3CA 1LG1A 4EAYA 5C2XA 3HQOA 1F7BA 4AIEA 1US0A 1XIMA 1HQTA 3VKCA 2ZZ2A 3BGAA 4OUEA 1ZALA 3UEQA 4RE3A 4AWSA 4E6MA 1CGVA 1J18A 3WDHA 4Q6JA 4C60A 1J11A 2R9RA 1XINA 2ACQA 4F66A 1W9DM 4WSHA 3AMDA 3VDCA 4OKDA 2PLCA 3HTWA 1EJTC 4WXYA 2NT0A 4V1XA 5D37A 4FF7A 3EGJA 1W5OA 5A8OA 2ZFAA 3THCA 4V15A 1MDRA 3NL6A 1GOMA 2GOKA 4JTRA 4D71A 2J74A 3CPGA 3I6TA 1SO4A 4MB1A 2PZNA 5K9XA 1MI3A 5FJRA 4ORIA 2OQYA 4GIRA 2XISA 3N15A 4Z2HA 2BZNA 4BF9A 3U8GA 2CESA 2VD9A 2NUXA 4AF0A 1E6ZA 1DJYA 5XINA 1CEOA 3W2NA 3TAKA 1QJWA 2YLAA 3VIIA 1RK6A 4GXMA 3W37A 4XZHA 2J25A 2OLSA 2PB1A 4GI6A 3F5KA 3INPA 3VX1A 1W5NA 3Q37A 3GXNA 3H23A 1J2BA 2WJZA 3LPPA 3NYZA 3W7LA 3TFXA 2FZBA 3IS4A 3VO0A 3SUSA 4IJCA 4MPQA 1Z3NA 1E4NA 4RJEA 4OOUA 2Z27A 4NNCA 2CLHA 2YOCA 3HG5A 4R5EA 3AIWA 1JNDA 1PUDA 1MW0A 4MKNA 4G5DA 1WZLA 2OTDA 4HHLA 4UQCA 3ARUA 4S2CA 1TWWA 4DJEC 5FEXA 1EDGA 3WFZA 3PBUA 2YXOA 1QW9A 1HJWA 1U5VA 5CSYA 4NZCA 4YWSA 4D6EA 3ITTA 1TIMA 3WD0A 1J4EA 1X7FA 4N9EA 1XCWA 4A3UA 5C54A 4IF2A 4WSKA 3QMTA 1XBYA 3KOWA 3N6HA 1Q6CA 2B7NA 4QE4A 4IIHA 4A3HA 1A49A 1F76A 2BMBA 3DECA 3II1A 4MWAE 1GORA 3STCA 3VDBA 3TW7A 1MMFA 4HYVA 3L66A 3M9YA 1YYAA 3W88A 3GYCA 2UV8G 4MWAB 3KEHA 1WQ5A 2VX6A 2DVTA 5M5DA 5CBIA 2XJ7A 1U1UA 3BVJA 4C65A 3EX3A 5I6SA 5AYBA 5MF5A 2D2OA 2YL9A 1E70M 1FRBA 1Z8AA 4FOUA 3R0DA 2WMJA 2PAJA 4WR3A 1F2JA 3KLLA 3SCQA 3UZWA 2A21A 2BY3A 5DMNA 4LUTB 5CAHA 1A0EA 4HA1A 2ZE3A 4I90A 3TLLA 1L8NA 3WJXA 4HZMA 1C92A 1PXGA 1QI5A 1OG6A 1G67A 1OFRA 3ZSSA 4ZOCA 1HNYA 3FS2A 1UMYA 1KXVA 1E3ZA 1KM2A 3U4FA 1ZAIA 4N6EA 5C5YA 4C6FA 1V5XA 3FX4A 3T8LA 2G3JA 2WMKA 3GXDA 3N2CA 2ZRUA 5IHSA 1UH3A 5PTDA 1DJIA 1NWSA 3JRKA 1JZ8A 5FF7A 4H9UA 3UA4A 2VR5A 1B90A 5GNXA 3GNPA 4A3YA 4MLJA 1WKDA 3ZFHA 3E3HA 1B2YA 3HJZA 1NU5A 3BANA 2HVNA 1V3MA 1CZ1A 1LL7A 2CZFA 3PTQA 1UA7A 4RW3A 4WY0B 3HN3A 1P48A 1NQKA 1Q6LA 1UIPA 2WJDA 4IJRA 2V9DA 2J8GA 3V5CA 4L65A 1F8IA 4PUJA 5D03A 1EGVA 4A21A 2W91A 1ESWA 3E96A 3HPXA 5A6MA 1DJQA 3DFTA 1Q8AA 3OLIA 1NP2A 3K1GA 5C9ZA 3UFYA 3ISIX 1W1VA 2OOGA 1VYRA 3WK2A 4W88A 3GAKA 3VYLA 1SMAA 4LAMA 4O1FA 2PDMA 2XM2A 1W9VA 1TPWA 2FH6A 3L4VA 4YVXA 3OTRA 1I8JA 2HE8A 5CBJA 1TPH1 1C7TA 4XSMA 5AZ1A 2GSHA 1ZJBA 4WCJA 4JAWA 3LK6A 4W86A 1UUOA 2DGAA 2Z1VA 2OWCA 1DIDA 3E2VA 3S46A 2BVTA 1TVLA 4W85A 3SQLA 4NI3A 3GDBA 5ABFA 1J0JA 4KH2A 1TTPA 4CD7A 1E0TA 4GYFA 5I79A 5D30A 3WQDA 1LP6A 3T0CA 4ZSUA 3TQ0A 2FFCA 5TBOA 3N2TA 3WDQA 3MU7A 4NQ1A 4UQEA 4HN8A 5G5IA 3FAXA 2DSWA 1EPVA 3AMCA 3PPCA 4GIEA 2GK1B 4M0XA 3H12A 3NEHA 3O3RA 3S0CA 4GQGA 4C6MA 1EZ2A 3G1HA 1E6SM 1BAGA 3BLDA 4W8LA 4DWSC 1WUEA 4YYCA 2VEMA 4IPNB 1EJWC 2VQTA 2ISFA 4RUBA 2YB4A 3F2CA 2PURA 3S5YA 3P6LA 4W89A 1ZPTA 3H53A 2JGQA 1B3ZA 4NJKA 4RXFA 1TWIA 4X63A 2DU2A 1OINA 1LBMA 3CYVA 2GQ9A 4JNZA 5EU9A 3I7SA 1PKNA 3WEMA 3PG9A 1GHSA 3EPMA 2ZRYA 3UPMA 3URBA 4DIAA 3BDKA 1KD0A 3MTWA 4PMJA 1A5KC 3PNUA 5C6MA 1J01A 1EOKA 1IWPA 2TMDA 4LW7A 3VNZA 4DJED 4IQJA 4NXSA 4DJDA 2PI6A 3DG3A 3KBJA 2IS7A 3BG5A 1XLAA 4FHAA 1VJSA 2QCFA 4KWUA 2XIQA 4Q3MA 3R0KA 4BCEA 3TYZA 3ARSA 1XUZA 4NZ1A 3N2BA 1KRMA 3W74A 1VLWA 3ARRA 5DMYA 3QKEA 4NX5A 4R3UA 2E4TA 4Z2LA 1XIEA 1O5XA 1WPCA 4XAYA 1KBKA 4KW2A 3S6DA 4KCUA 4ZQNA 1F3WA 1E4MM 4G7FA 4ERGA 4WJ8A 5D2VA 4GNVA 3WX7A 1NWUA 4FO4A 1OD8A 2O92A 2ZXAA 3AICA 4HB7A 3NL5A 5G4WA 3UXAA 1XIFA 4TV6A 3CV6A 4HOZA 2ZC1A 2F8QA 3DG7A 4XBKA 1BQGA 4B5TA 4LVBA 3CL6A 3OBKA 4LGXA 2BHZA 3F4WA 3TC6A 3BMVA 3GM8A 1H5YA 3M0XA 3BLPX 4D1IA 1TJ2A 2NSXA 1AJ2A 2OQLA 5CZSA 5I24A 1TV3A 3PBMA 1I75A 4XB3A 4N6FA 1KR0A 2A7NA 3LXBA 1EUNA 3OZPA 1FWGC 4A2SA 2W9MA 2PDCA 3B3DA 1OZQA 1KTCA 2WHMA 4NJJA 2FHCA 1UZ1A 3C8FA 3SN4A 2E68A 3MZNA 1FTXA 4UR8A 1XUUA 2W6RA 1M7PA 1EGMA 1YPFA 1ZBVA 1WB0A 2J24A 1XLBA 4CLMA 5K9DA 4P8UA 1G1YA 4CD8A 4FPSA 1LBLA 1B4EA 5HANA 3GTHA 2IKJA 3TP4A 3GC2A 2E3ZA 1R2TA 5JIPA 2J7FA 7CGTA 4HNNA 2PS2A 1KB3A 3FYOA 2PODA 1YTDA 4MZYA 3XINA 3ZT6A 2OSYA 2A6NA 4ZQRA 5FF4A 3FA4A 5DBUA 4JFWA 5I00A 3EMZA 4O28A 2OYKA 1UUMA 1YRRA 4RKAA 1FCVA 1WYIA 1OYBA 4GLEA 1K6AA 5AN7A 3TAOA 2Z1KA 1JDEA 4RZBA 2CBVA 2W3ZA 4GA8A 4TTGA 4DUXA 3PBGA 4ZGYA 1PTGA 1YTKA 2GJLA 3HFYA 3UJEA 5HQEA 1W2VA 3OIHA 3GQYA 1IEXA 1PEZA 2C3ZA 1W31A 4C6KA 3DHDA 3RJYA 2OO0A 4YVVA 4H4IA 3CZKA 3CO4A 1E9LA 1QI4A 4WKAA 5I3JA 3D3FA 4G56A 4J35A 4M51A 1EO5A 3VOCA 4IIEA 3FCPA 3IK2A 3SFKA 4C6OA 1E6XM 1VIZA 5C70A 1JVNA