4P2VA

Structure of the ai-2 processing enzyme lsrf in complex with the product of the lsrg reaction p-hpd
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
281
structure length
281
Chain Sequence
DGKDFRTDQPQKNIPFTLKGCGALDWGMQSRLSRIFNPKTGKTVMLAFDHGYFQGPTTGLERIDINIAPLFEHADVLMCTRGILRSVVPPATNRPVVLRASGANSILAELSNEAVALSMDDAVRLNSCAVAAQVYIGSEYEHQSIKNIIQLVDAGMKVGMPTMAVTGVGKDMVRDQRYFSLATRIAAEMGAQIIATYYVEKGFERIVAGCPVPIVIAGGKKLPEREALEMCWQAIDQGASGVDMGRNIFQSDHPVAMMKAVQAVVHHNETADRAYELYLSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title LsrF, a coenzyme A-dependent thiolase, catalyzes the terminal step in processing the quorum sensing signal autoinducer-2.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
molecule keywords Uncharacterized aldolase LsrF
total genus 79
structure length 281
sequence length 281
chains with identical sequence B, C, D, E, F, G, H, I, K
ec nomenclature ec 2.3.1.245: 3-hydroxy-5-phosphonooxypentane-2,4-dione thiolase.
pdb deposition date 2014-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01791 DeoC DeoC/LacD family aldolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4p2vA00
1ME7A 3I7SA 3G0XA 3GR7A 4N2YA 2CZDA 1S3HA 5EPDA 5KITA 3IGXA 1IXOA 5F2IA 3OVPA 3DHDA 1PS9A 2TMDA 2WPBA 3TK7A 3HB9A 1TRIA 3EB2A 1XBVA 5I3IA 4UMAA 1TQJA 3UQNA 4QQ3A 3NQMA 5I3GA 4MYAA 4GWEA 1W3NA 3FFSA 3HPZA 4JEQA 1G7UA 3C52A 3DI1A 2VEIA 1OYCA 1UBSA 3PWAA 2PE4A 1EUNA 1WDWA 1LYXA 1KBJA 4Q4KA 1MSSA 1V7YA 3N2XA 5LHEA 3FJLA 4IMCA 4RX0A 2QCNA 4JTFA 1I4NA 3NXFA 2FPYA 3E9AA 2J9ZA 2PURA 3KXQA 4IXHA 3G3MA 2A6LA 4N9CA 2ZRZA 1GTEA 4LUIA 5CGQA 4NNAA 2TSYA 2F84A 1TQXA 3W70A 1QPNA 4QNWA 1K8XA 1LDCA 2V5BA 3LHUA 4GFSA 1HG3A 5D33A 4UC5A 4XBSA 1NF0A 2E6YA 3ABRA 4LNYA 3TFCA 2VENA 3MBFA 4FEZA 5D02A 3P7YA 1RQHA 3C56A 3PVFA 2RKXA 1SU5A 4O52A 2ISWA 1SZGA 3MI2A 2GJLA 2QDHA 4UTHA 3IVSA 1K7XA 5HUPA 1W5MA 3LHYA 3O8AA 1G4TA 2B7OA 5F1UA 2FIQA 4LVFA 4NNCA 2GPTA 4A2SA 5CKSA 1OG0A 1Q6QA 3PUEA 4LY8A 3KVLA 1GVOA 3PC0A 5LNVA 4NUWA 5AHIA 1H5YA 5F2GA 1P0NA 1TO3A 1KM5A 4O12A 5C55A 3S5ZA 3GNNA 5BMWA 4Y6GA 5D03A 3R5EA 1SZFA 2ZRWA 1BEUA 4O18A 1S5TA 4DF2A 2DP3A 2Y7EA 1JCNA 4TU1A 4GC4A 3IIXA 1SW0A 4WJEA 2Z2UA 1EP1A 4M5PA 3W87A 3EX6A 1GYNA 4XQ6A 4E2BA 3DENA 2R94A 1TV8A 2AQWA 5H91A 5C6MA 2VFFA 3TJXA 1OFOA 4CCDA 1Y0EA 1RQBA 1WX0A 5G4EA 3W1PA 2CZEA 1H7OA 4LC6A 1EA0A 2WQPA 2EGZA 3S1UA 4EF8A 4WD0A 4C1LA 2RDWA 3FKKA 3BARA 3O63A 3LI0A 1DKWA 3NQEA 4NZJA 4BR1A 3TDFA 4LS0A 3NZRA 3C4UA 2FTPA 4MZ8A 3O15A 4Z1AA 3TA6A 3GXNA 3F4WA 1AW5A 3BGJA 4JR5A 1U5JA 3LHWA 1EP3A 3W84A 3VFLA 5DCBA 3B04A 3F1QA 5TIMA 4WUIA 2QUUA 3NQ7A 4Y8FA 2P1FA 2YZRA 4HIBA 2ZA1A 3G3DA 2F7FA 4NU7A 1XUZA 3P81A 4ORIA 3NPWA 5F2LA 1YXCA 3IIZA 4CNNA 3LM7A 1YTKA 1U83A 3T4CA 2A7NA 3W85A 1I2PA 1OJXA 3TW7A 3W7EA 1VLIA 2NV1A 4LVAA 1DOSA 3LBMA 2BTMA 5AHMA 3R89A 3TW6A 1W3TA 2ZZ4A 4ZQMA 2JKPA 4BI5A 3C6CA 2ISVA 4XTDA 2NUXA 2P0OA 3DBPA 3GDTA 4AH7A 4XWUA 1NF7A 5AC7A 3P82A 1G7VA 1W3IA 1KFEA 3FKRA 4IWWA 4OT7A 5AHLA 3TR2A 4NX5A 5FEPA 3SIZA 3TFXA 3W7KA 2O7QA 3EX4A 3S5YA 3BG5A 4JTGA 4O11A 3EKZA 1KM2A 1OFAA 3P5ZA 4BF9A 1AW1A 1YDVA 2WSQA 5G5IA 1TPDA 3HQ1A 5LKYA 1JULA 3KVMA 4O0KA 2XFWA 3TROA 3VE9A 1GTHA 3LRMA 4LRTA 3JR2A 4DF0A 1KTBA 4MIMA 4O1DA 5D09A 4GE8A 3IVTA 5AHNA 3LCLA 3W75A 2E5DA 2OMAA 3W2JA 4MY9A 5HMSA 1NEYA 2VXNA 4HNNA 3M1ZA 4K37A 4K6AA 4AWUA 2HTMA 2OT1A 5LGZA 1KV8A 4WZHA 3RNDA 1WA3A 1K7FA 1Z48A 2QJGA 5I3KA 4DEFA 4WY0F 2UV8G 4NJKA 5FF2A 1L6WA 3QQ0A 1ZHAA 4GUGA 2NXHA 3K30A 1VCFA 3L5MA 3P8JA 3T40A 1SFJA 1LLZA 3CWNA 1F6PA 6TIMA 3QPZA 4WY0B 3GDLA 1RV8A 1KW1A 4IJBA 4K8HA 4JYDA 5D38A 3G8RA 3SW6A 3GXPA 4JTSA 4KWWA 1KM0A 3QH2A 2ZRVA 2CFFA 2VFHA 3D0CA 5LNRA 3PULA 3P62A 4MFEA 3MP4A 5J5RA 1T96A 3SSJA 2X30A 1LORA 4FNUA 5AFDA 2OX1A 3THQA 2ZZ3A 5TQLA 2EHHA 2FQIA 2C19A 4JTTA 1QOPA 1R30A 4DBEA 3LCWA 1ADOA 3LHZA 2WNNA 3RFAA 1O4UA 3R13A 1SW7A 3P80A 2Y88A 3TH6A 3VKJA 4OU1A 1W5NA 2NWSA 2WV8A 5FEZA 3V75A 4D2JA 1B3OA 3QFEA 4Z1BA 3STCA 4FNTA 3ABOA 4QJ1A 2ISSA 2V82A 5CSRA 3HJZA 2WO5A 2WNZA 3G1VA 3UXAA 4UTUA 1TTQA 4RCXA 2OJPA 1O5XA 1TV7A 3WFAA 2XN0A 4LV4A 1A5BA 1H7XA 2R14A 4MOZA 4IQLA 2W79A 1ZY9A 1ZNNA 1JQVA 1SO6A 2G95A 4FNRA 3C0JA 3HG3A 1KM3A 3WK2A 4LTSA 4IOTA 3VI2A 2Y61A 5KSWA 3NL2A 2H3BA 5DY3A 3G1DA 3BO9A 5CZTA 3R2GA 4RXGA 2Z1BA 3O05A 4UFJA 4HNTA 5IBXA 1TTJA 5D2WA 5EKYA 3TC6A 3CWOX 3GDKA 4R34A 3W7HA 2O7SA 4OV4A 5K7JA 3DFOA 5AOUA 1HL2A 3PB2A 5HWMA 4O1BA 3L9CA 1YPFA 4EIVA 4LWWA 2VEMA 1P5BA 3MP3A 3GYEA 1C8VA 2AGKA 2I9EA 4X22A 1A50A 1IIGA 1RVGA 4X2RA 3NNTA 2DZSA 4JS3A 5HR7A 2H3DA 2QAPA 2VFDA 3RK8A 1ICSA 1GOXA 1KFBA 2Y6ZA 3STFA 3UXDA 3O6YX 3C2RA 3H55A 1DL3A 1OFBA 3GDMA 3LCGA 3PBWA 2TYSA 1LOQA 3CLMA 5G2HA 1THFD 4DPPA 3S8HA 1GZGA 1H50A 5LNWA 1FCBA 1OYAA 1IGSA 2E77A 3GKAA 4OGZA 1QPQA 2YSWA 2CLKA 2QEZA 4BK9A 1M5WA 3G1YA 4ZQRA 1FXPA 3Q2DA 2CLLA 1L2UA 4NJGA 2V0TA 2JKAA 2VFIA 5LGXA 3EWXA 4UMBA 1G4SA 2V2HA 3NO5A 3T55A 1SZEA 5CZSA 7TIMA 2PRHA 3QW4B 3EWUA 3HOJA 1X7FA 2CLOA 4P61A 3W1NA 3F03K 4IX2A 4JIQA 1XDMA 1H61A 1J5TA 1ICPA 4POCA 3O6DA 1TPH1 1X1OA 5KZDA 3DFQA 4EF9A 2C0AA 4Z08A 1ZJIA 3YPIA 3VE7A 4PTNA 1LOSA 2QKFA 3W76A 2QCHA 4JNMA 3QQ1A 5CPOA 3LOTA 3NQVA 4ML9A 3L21A 1TB3A 1G4EA 2VFEA 3C8FA 5HULA 1I2OA 4M19A 3L0NA 1LBFA 2ZZ6A 1OF6A 4UMCA 1PE1A 3MMTA 2EAWA 3W7MA 4HT3A 5SWUA 4RK8A 1OHLA 1P4CA 3W2UA 1EWDA 1K7EA 3I6RA 3G8EA 1N55A 4O57A 3PUOA 1H7RA 5D2TA 5DBUA 4FNQA 3S1VA 1TPC1 3OA3A 2C14A 3M43A 3G22A 4UUIA 4O50A 3W1QA 1OFQA 4MFDA 5D2VA 4IX0A 1QOQA 4JY8A 2YFNA 4JD4A 3WJXA 2ATSA 3L68A 2A4AA 3HGSA 4LS2A 1R2SA 1H62A 1LM1A 2QCLA 2GUUA 5F4XA 2J24A 2OT0A 5E93A 4AXKA 2R91A 4Q32A 2CZFA 4OV9A 1V5XA 3DZ1A 1ZENA 1VZWA 3O06A 1IXNA 3TXZA 4MYXA 4WY0A 5CG7A 3GDRA 3HG2A 1ZALA 3F4NA 4ADTA 2CLFA 2E1DA 3I7QA 4S2BA 4EVZA 4Z0JA 1HFBA 3E0IA 1KTCA 3B03A 3DAQA 1SUXA 1LRNA 3LV5A 4KFPA 2C1HA 3W7PA 2QCGA 5F1VA 3C2FA 3KAOA 1X8FA 3G1XA 1FWTA 3HMJG 1M7OA 1AW2A 3PSVA 4K36A 3RMJA 2Q8ZA 4PC8A 2V2DA 3L67A 1YDOA 3EWWA 3QMRA 3TCEA 1SSDA 3LXCA 2NZLA 2H8XA 3DH7A 4NXSA 3NL6A 5HINA 1PCKA 4GNJA 5D2YA 4UTLA 2B4GA 5TBOA 1XUUA 2A85A 1KFCA 2A7RA 3EX3A 4RZ5A 1JCJA 2GJNA 2DORA 2A6NA 2VOMA 4S2CA 4L4LA 4NJHA 3S42A 3LB0A 3CEUA 3LXBA 2V81A 3DGRA 2V9DA 2GQ8A 5C5YA 3EX2A 1OX4B 1TSIA 5EMUA 3P84A 4R7JA 1FDZA 4UNLA 4HSNA 3W7RA 3N3MA 3BV4A 1DHPA 2GQ9A 4ZQOA 2RDTA 3H53A 3ZFHA 3E02A 3EXTA 4N6FA 1HUVA 1LTDA 3W2NA 1VLWA 2YXGA 3JS3A 4HSOA 4JICA 4ORMA 3LTSA 3WK1A 3MO7A 1SO5A 3DFTA 1RPXA 3LDVA 4NNBA 2YW4A 1Z42A 2J9XA 1J4EA 4UTJA 5F4WA 1AK5A 3HGJA 3PSWA 4QIUA 1Q6RA 2RHGA 4DO5A 1FDYA 1N8FA 4M7TA 4DF1A 5HWNA 5K3VA 1DBTA 1FUYA 1EIXA 3DFSA 2ZRXA 4H3DA 3M16A 5IBXC 1FWSA 3OG3A 1PV8A 4JTLA 5E0KA 5FF0A 4LVGA 2JK2A 1TTPA 1H51A 5FEXA 2B7PA 5DCDA 4YCPA 1VS1A 2RFGA 1UCWA 1ME8A 1CW2A 1GVRA 5K4ZA 1T99A 1YYAA 1TJPA 3W83A 5D05A 1KLYA 4A3UA 4U28A 3W74A 4O15A 1VH7A 4K39A 4AEOA 1JR1A 3CIXA 4PA8A 3HGRA 4UTTA 3LLFA 2Q8LA 1SQ7A 1LROA 4OWGA 2A21A 2XN2A 1FQ0A 3O07A 4IXXA 3STEA 5A5WA 3R8RA 5CPNA 1EWEA 4ICNA 3RF9A 4HPJA 2NX1A 1TPVA 2YGYA 5AC6A 3A5VA 1TPUA 2TRSA 2Y7FA 1W37A 4UTIA 5FF4A 4K38A 3GIYA 3HF3A 3C2VA 4I7UA 3EWBX 3O16A 1N7KA 2J88A 4H4IA 4QNEA 3SGZA 1E51A 4O53A 4AWTA 1O94A 3L2IA 2NUYA 4EWND 3KX6A 2CWNA 2JBMA 2YPIA 2Z6JA 2WJZA 1L9WA 3UY7A 4MKNA 5G4WA 1Q6LA 1SFLA 2HSAA 4PCFA 1QPOA 2VKZG 3PG8A 3NQDA 3W1TA 2Q3OA 5F2MA 1H7NA 1RQEA 3B4UA 1HTIA 4I9AA 3O1NA 3ATYA 2PCQA 3P74A 5HQEA 2QCDA 4O10A 1KA9F 3GAYA 2EF9A 4LUJA 1F7BA 2NUWA 4YXGA 4RKAA 5AB3A 3HO8A 4N9DA 3FOKA 2CW6A 1XKYA 3W1XA 2ZZ1A 5HNRA 1KM6A 2FB2A 4GJ1A 1M7PA 2B7NA 1I2QA 4EOUA 3BW3A 4GUHA 5CZJA 1WOAA 1GWJA 5K9CA 4JN6A 1Z41A 2NXIA 4LC8A 3N34A 4TIMA 1GT8A 3UWWA 4ZMGA 3BVJA 3B05A 3PY2A 1WOBA 2ZYFA 1P1XA 1BKSA 2QR6A 3WJSA 1G6CA 1ZCOA 2H90A 3LCIA 2WNQA 3OEXA 2YYTA 3HBLA 3HIJA 3EWYA 5KZEA 3NR0A 2CU0A 4NJIA 3LLDA 1CI1A 3T44A 2ABAA 5CPMA 1FCQA 1WYIA 5BMXA 4N6EA 3N2MA 3UWQA 3PBVA 3M5YA 4JXCA 5D04C 4PFMA 5U4NA 2DZTA 4ADUA 2BX7A 3M5XA 1XCFA 2QCCA 1JCLA 4IPIA 3M7WA 5L6UA 3QRHA 4XUGA 1EEPA 2H8ZA 3QSRA 3W7DA 2YYUA 3HG5A 4MJZA 3WJZA 1AL7A 1KM1A 3N14A 4OBTA 1J2WA 4QITA 1JCYA 5LZLA 2OZ0A 1VHNA 3NA8A 4UNKA 5DBTA 4RZ6A 1L6SA 3GLCA 1VYSX 3ZR4A 2Y62A 4O14A 3QZEA 3RU6A 3LCHA 4AF0B 1WV2A 3QC3A 3PBYA 4BI6A 3KOFA 4KFNA 3PF3A 3HGOA 4M6QA 2DZPA 4CCEA 2YW3A 1XL9A 1Q3NA 5FESA 2DZVA 4RLIA 5K2ZA 2WKJA 3KHJA 3CPRA 3MJYA 4NZFA 1D3HA 3LBCA 4BWLA 4LT9A 4LS1A 4AWSA 3PBUA 2Y70A 4DXVA 5IM51 5KTLA 4GRSA 3NM3A 1I8JA 1XBXA 2QAFA 1K3UA 3C61A 5AN7A 1JUBA 1OF8A 1B9BA 4BFAA 6ALDA 1KM4A 3FIGA 3LCXA 4NQ1A 4QISA 4W9TA 1Z44A 2DZXA 3W7GA 1RR2A 3W3OA 3NVTA 1DVJA 3MYPA 4M6PA 1FCUA 2ATMA 1DORA 1OFEA 4ZL1A 4O19A 3W72A 1SO3A 1NSJA 2YR1A 3NQFA 1AL8A 1VPXA 3G24A 3L5LA 1ZAJA 2GVLA 4JX6A 3TU9A 2LLEA 4YWIA 3W7IA 2PC4A 1FDJA 4LW7A 5CPLA 2GQAA 1CX9A 3GR8A 1W8SA 3OVQA 3UPWA 3NPVA 5EBUA 2FB3A 3TIMA 2QJHA 4UR7A 4K7YA 1FWNA 4GXMA 1W31A 3A22A 4CNPA 4N4PA 2ZBTA 4UFLA 2X16A 4A21A 1F2JA 4OE7A 5A8GA 3CEPA 1YTDA 1G4PA 3G1SA 5CSSA 3TXVA 4UTKA 1QMLA 1FCVA 1VGAA 3MYOA 1T8XA 1TRDA 1GG1A 4KWVA 3W1LA 2YX0A 3LTPA 3GX9A 1G67A 3M5VA 1QO2A 2X1UA 2CLEA 4KKXA 3UWVA 3BGGA 3FYOA 3IIVA 4LVDA 3T7VA 3CC1A 5DELA 3UWZA 2Y63A 2KZHA 4FF7A 2DZWA 3CTLA 1NVMA 3NQCA 3LRLA 3MBDA 4P2VA 5E1QA 4E2DA 3P60A 4HHPA 3QYQA 4RV8A 1QO5A 3B0PA 3B0VC 1VYRA 3OIXA 1Q6OA 3EX1A 2ZQ0A 4XTIA 3UYCA 1TPWA 1VYPX 1IIHA 1LRQA 3QSTA 1JVNA 2C18A 4IMDA 1LZOA 1L6YA 2A5HA 1IXQA 3FYPA 1QPRA 3S1WA 2QCEA 4MLRA 4HNUA 2WOQA 1Q45A 1VR6A 4JIPA 4UTWC 2CLIA 3LHTA 3MW7A 3LX9A 3LGEA 3THAA 4XKYA 3B06A 3GK0A 1XFBA 1KV5A 4TX9A 1G69A 4O13A 1FXQA 1GVQA 3EWZA 3IGSA 4FNPA 1K8YA 5HWJA 3TSMA 1W0MA 3S5OA 1GQNA 5DXYA 3SGUA 3C2OA 3CIWA 1UUMA 4NJJA 5T26A 4O17A 3LERA 1LP6A 5EYWA 2I1OA 3USBA 3PR2A 1S5VA 5L9FA 4LU0A 1VHCA 1WQ5A 1ZFJA 3EXRA 1XBZA 4MUZA 1TREA 3B0UX 2X2GA 1MEWA 3IEBA 4JTUA 3V1PA 3IV3A 3NZ1A 5KMYA 1XDLA 3BPWA 2QF7A 5LNUA 1SZNA 1XI3A 2E09A 3NPUA 4DQWA 2P10A 4GBUA 4GUFA 1XC4A 2HS8A 1OFDA 1OFPA 3GXTA 3NM1A 4LVBA 3NEVA 1YDNA 2V5LA 5LSMA 3WJYA 1BWKA 3HPXA 1YXDA 3N9SA 1UASA 3U8GA 2C16A 2OCZA 2X1RA 1TMHA 3QF0A 2ZRYA 1DV7A 3Q58A 4UCGA 3NQAA 3A9IA 2CLHA 3M6YA 3S6DA 1JCMP 3ZWTA 2A7PA 5AC8A 1GPWA 4LOCA 4NVTA 3CB8A 1DQWA 1W54A 1GYLA 5GVJA 2C15A 3P8IA 5U7SA 4G1KA 2ZZ7A 4Z1DA 2YCEA 1TPB1 2VEPA 1WBHA 3NQ8A 5G2IA 4HKPA 3RLVA 4UIOA 2J9YA 2E6DA 4FNSA 5G1YA 4FO4A 2ABBA 3L65A 4MZYA 1K02A 1RD5A 3L66A 3SR7A 2GOUA 3KRUA 1DJQA 2PRMA 3OBKA 3W22A 2ZTKA 1QDSA 2J27A 1W5PA 4TO8A 4AHQA 4PL2A 1H1ZA 1B4EA 3QMSA 3W6YA 4CQ9A 2AAMA 4JGDA 2Z6IA 3KFTA 1EB3A 1FX6A 3G18A 3P67A 1AMKA 1PHQA 3GKFA 3H54A 1QCWA 3WK0A 3MI6A 3LV6A 2QDGA 2ZCGA 3W88A 2EPHA 4AHPA 4UTTC 3I65A 2ZZ2A 5MHBA 3U2OA 1W5QA 4LRSA 3W9ZA 2R8WA 4MPQA 2ZTJA 4UFHA 4K8EA 3PUDA 3S9YA 8TIMA 5K9XA 1JRBA 1KFLA 4K7VA 1A53A 3EEGA 3TQ0A 3SZ8A 2B0MA 3SJ3A 3E49A 1LBLA 1QFEA 2W6RA 2G97A 3BLEA 2HMCA 4DO6A 2BXVA 2ZFAA 3NYZA 1T0OA 1VQTA 4JX5A 1QR7A 4A2RA 4MLJA 4Y9AA 1JRCA 1UJPA 5DLCA 4JTIA 3RLUA 1OYBA 2QCMA 5DN1A 1JJKA 4WQ6A 5FF3A 3ATZA 4I7WA 1IXPA 3S1XA 1F05A 4NT0A 2ZDRA 3MP5A 1R46A 4WOQA 1S5WA 3G1FA 1R47A 1EPXA 4E0CA 1K8ZA 2D73A 3BW2A 2FPVA 4Y96A 3PM6A 3SFKA 1XM3A 1BWLA 4Y90A 4JTJA 5I3FA 1EUAA 1R2TA 4M6VA 4DBDA 1F74A 1XXXA 4O4WA 3TV8A 4HNVA 4UFMA 4HPXA 5K9DA 1WXJA 3HPSA 1KFKA 1F73A 4S1FA 3S5NA 3DKJA 3NL5A 1SW3A 3IIPA 4IMEA 3A5FA 3Q37A 1SSGA 2E6AA 1D9EA 1VCGA 3L5AA 4R53A 1VRDA 4XKYB 2C6QA 3UPBA 3FA5A 4LV9A 3NOEA 4O28A 4ALDA 5FI8A 2Q3RA 4RJEA 3MI3A 4WOZA 5C2XA 5EY5A 2J6XA 1ALDA 4ZQPA 3I7RA 4WX2A 1PCWA 1RZMA 1ZAIA 4QM1A 4ZQNA 4JTKA 3W73A 5HUOA 1F6KA 1OX5A 2RDUA 4TMCA 2E5BA 1B57A 3G0UA 3TQVA 1YLVA 2FDSA 3B8DA 1QAPA 1O60A 5C54A 3VNDA 4WXYA 3GNDA 5J5DA 4IGHA 1FBAA 4CNOA 1D3GA 5AHFA 2BLEA 2NX9A 3CQ0A 1F5ZA 4FX6M 4MZ1A 4PL1A 3W7QA 4C1KA 2RH9A 3S0CA 3O6CA 4AB4A 3M9YA 5D32A 1VC4A 2NXGA 2X1TA 3KRSA 1H63A 2QUTA 4XZ9A 3TQKA 2FLIA 2X1SA 4FX8A 3W2MA 1O5KA 5ABTA 1HO1A 3VCRA 3DI0A 1ML1A 4AHOA 4FIRA 5H2ZA 2DJXA 3LHVA 4UR8A 4BWLC 1ICQA 4QSHA 1DQXA 2NV2A 1UB3A 5D2XA 2G96A 3W1AA 4JY9A 3LTYA 1UUOA 4BI7A 4O4VA 2YFOA 4CLMA 3UWYA 1OX6A 3BG3A 3NQ6A 4YMZA 1TIMA 5D37A 5BNKA 3TSBA 4X3ZA 1X6UA 2QCFA 1X1ZA 1MEIA 4RXFA 1KBIA 3KVKA 1EX5A 1SPQA 2BWGA 3BG9A 4J9JA 3UZJA 4E38A 4GUJA 3W7LA 4A22A 3G1HA 5HR6A 4OQVA 5AYZA 3IVUA 4TR9A 3QW3A 1KTNA 4UFKA 4DPQA 3W23A 4UTMA 3HG4A 3MHGA 3QM3A 4JYEA 2Y7DA 3WK3A 4N02A 5AHEA 1AG1O 2ZZ5A 2TPSA 4WXZA 2GVGA 4IMGA 3NAVA 3W7NA 3UZ5A 2DU2A 3N9RA 4DO4A 5FF7A 2V30A 3L0GA 5DCEA 4FXRA 1YADA 1TPEA 1H7PA 1OABA 3R12A 1JUEA 2A2IA 3G0SA 3IIOA 3W2KA 2C13A 1JCXA 3QPYA 1VJIA 3TAKA 4AF0A 3UY8A 3BW4A 3NQGA 5F4SA 3TAOA 1DJNA 3AO0A 1WBJA 3DU0A 3GVGA 1YPIA 2Z0IA 3DHFA 3TC7A 2V2CA 4H6KA 1YTEA 3KVJA 1HO4A 2DJLA 1A5CA 3ABQA 3WJWA 5KINA 3W07A 4N4QA 3W71A 4MY8A 3TMLA 1W56A 5BRBA 3QEZA 2VELA 1BTMA 4UFIA 1XBYA 1PVNA 1TCDA 3CT7A 1P0KA 2V8ZA 5BW6A 2ZRUA 3PAJA 3NPXA 2VC6A 4JDBA 4GUIA 2GVJA 3LRKA 2QCDB 1EP2A 5CZ0A 2QUVA 1TJRA 4ZZ9A 2CZ5A 5EL1A 1H1YA 3UNDA 1LBMA 4NXKA 3ANYA 3G1AA 4JTEA 2I14A 3LXAA 1R2RA 4O54A 1FY6A 1K03A 3TJLA 1I2RA 1SR9A 3BK0A 4OHQA 4B5NA 2QJIA 3DXIA 4ONVA 2XN1A 3PB0A 3CM4A 4O1AA 3FJ6A 2WSYA 5DY2A 4YCOA 2Y85A 4I7VA 4Z1CA 3LI1A 4A29A 1H7WA 4JX4A 5I3JA 2VEKA 1MZHA 1W5OA 2FPTA 4JYFA 4MJMA 5G2WA 4FIQA 3PG9A 4RR4A 3BLIA 1NAL1 2E5CA 1PHWA 1TPFA 3LCFA 1QNVA 1LRTA 5FEWA 3GZ3A 3TX9A 2BZNA 4JTHA 5DXXA 3EKLA 2JGQA 3NDOA 4FX7A 3STGA 5LNSA 3W7CA 3MHFA 3A23A 3TNOA 5BOOA 2G5WA 1GVFA 3P61A 3W86A 2C3ZA 3DKLA 2ALDA 3M41A 1WAUA 4CQAA 4L4MA 5KZMA 4N9EA 3TSDA 2JKEA 4YL2A 3E96A 2YDAA 4Q33A 4X9SA 5G1TA 3FLUA 1W1ZA 1H60A 2HS6A 4FXSA 1TYGA 4QAIA 3UWUA 3IGUA 4M7SA 4ZQCA 1C9DA 3L0KA 2E68A 2ZA3A 2NX3A 3FS2A 3NQ2A 4MVAA 4IPJA 1ME9A 1KLZA 1NFBA 3CU2A 1JQXA 4IUOA 5AYYA 4AAJA 3TUUA 3A21A 1GVSA 1KFJA 3W7OA 3QMTA 3EXSA 3QJAA 1PIIA 3P5YA 1I2NA 3TE9A 3NG3A 2Y89A 3GAKA 3M5ZA 3TMQA 3C2EA 1LLWA 3I68A 4AVFA 1FWWA 3DFPA 4DELA 1PL9A 2CLMA 1GEQA 2NLIA 3ZS4A 4FB7A 3NGJA 1SO4A 2ZA2A 2IQTA 4R33A 1A5AA 2PRLA 2B7QA 1MEHA 2A1YA 1JUKA 1VCVA 4ZVJA 3U6WA 4TMBA 4CCCA 5D30A 1C29A 1OK6A 4O8RA 3OHIA 4JDYA 1MXSA 4FHAA 4U4MA 1ZAHA 3M44A 4XBKA 1QWGA 3ABSA 4HN4A 3NL3A 2H6RA 3Q94A 3ZWSA 4NX0A 5AYXA 4UXDA 1GG0A 3BLFA 4UTWA 3SY5A 2FFCA 4Z0SA 4YLWA 4PODA 1MO0A 1FWRA 1TTIA 3SECA 1OVDA 5LHFA 3FEMA 3UD6A 4N9BA 2BSLA 3IRDA 2EKCA 1B4KA 2FJKA 5I3HA 1OFRA 3JRKA 1F76A 3M47A 5EA9A 1I45A 4AMAA 2DZUA 3N73A 3W7JA 3E12A 2VFGA 3W1RA 5K4XA 3TKFA 3W1UA 4KFOA 3OVRA 2Y7GA 1OX4A 3MHUA 3MWAA 2A0NA 3CHVA 4ADSA 3M0ZA 3W2LA 3KRZA 1O95A 1GJPA 5HJLA 1TV5A 3PS7A 3N19B 3A24A 4PH6A 2NWRA 4O1CA 3GB6A 3W1MA 4O0ZA 2E6FA 1A5SA 3C3NA 1OK4A 1M6JA 1LCOA 3INPA 4MY1A 1ONRA 2WSRA 1YXYA 3MUXA 3ELFA 3DFNA 4IMFA 3AJXA 1IF2A 4O16A 3SI9A 4PEKA 2W0UA 4CQ8A 4RZ4A 3T78A 2JGYA 1LOLA
chains in the Genus database with same CATH superfamily
3I7SA 2VD8A 3ABZA 3BSMA 1LF1A 3G0XA 1M9HA 4GI8A 5EPDA 1XYAA 3OZOA 2XH4A 4OOZA 1D7FA 1B0IA 4MAZA 4Z2LA 2QIWA 3DHDA 4EPDC 1BKHA 1PBGA 2DT0A 3EB2A 2NSXA 1YE4A 3QY6A 3UQNA 3B97A 1E72M 5I0DA 3TLLA 2YCLB 1GOMA 1G7UA 3USZA 5A6AA 2PE4A 1EUNA 4AY7A 2E1WA 1KBJA 3VDCA 3N2XA 5DMMA 3H6OA 1J6OA 3H4GA 3R25A 4YVXA 3VC6A 4IMCA 4RX0A 2BY3A 1XDJA 5JIWA 4XD4A 3QV7A 1F4AA 4IXHA 3ZZ1A 2A6LA 5GJMA 4C91A 4LUIA 5CGQA 4NNAA 1TQXA 4TQTA 5CH9A 2G4FA 4QNWA 1Z8AA 2V5BA 3LHUA 3N2TA 2WB5A 4LBSA 4UC5A 3ZSSA 1VEOA 1SJDA 2VENA 3MBFA 1RQHA 2OGYA 4O52A 1OSEA 1HKWA 1SZGA 2GJLA 4F3HA 3O8AA 3QY7A 1ESWA 5F1UA 3FAXA 3CHEA 1OG0A 3AS2A 4AZ7A 3PC0A 4FPSA 1HIZA 4K3ZA 1H5YA 2BY1A 4LGXA 4O12A 1VJZA 3WQWA 3AWNA 5BMWA 3R5EA 1BEUA 1S5TA 2YL9A 4X9YA 3ITXA 1WZLA 3CO8A 1EZ2A 4J3UA 5CLWA 4TOQA 4WJEA 1UG6A 3P14A 4PN2A 4H7VA 4H41A 2R1KA 3R4IA 3W87A 3T0AA 1KBKA 3FYYA 1H1NA 4C6JA 2QW5A 1L8PA 4D6JA 1T6MA 4CCDA 1FH8A 3N18A 2CZEA 4Q4RA 3GTFA 2VO5A 3MV01 5M03A 4EF8A 2V6AA 2XIMA 2UY2A 3BARA 3O63A 1DKWA 3W28A 3R11A 4QROA 1JXJA 4G56A 1TE1A 4NZJA 5IFTA 3LGGA 4MZ8A 4GD0A 1UD5A 4JR5A 3LHWA 1EP3A 1BXBA 3W84A 3VFLA 1XF0A 3HM7A 3W37A 3G3DA 1UHVA 2F7FA 4NU7A 1XUZA 3GNRA 3IJQA 4DYKA 3LM7A 2XTKA 1EFZA 1Q6EA 1U83A 3DHUA 2A7NA 1IE7C 1KRBC 3F5KA 2XSBA 1MW0A 4MWAA 4LVAA 1R8LA 4ERGA 6REQA 1DOSA 2BTMA 3WZ0E 4HK6A 4JTAA 4BI5A 3C6CA 4WR3A 4AEFA 1T41A 4R85A 1J11A 3VD5A 1RY0A 2NUXA 4HCDA 3RN6A 3RYSA 1YMYA 3P82A 1W3IA 3GUGA 3FKRA 1GVEA 4OT7A 1WXZA 4U10A 5AHLA 3TR2A 4NAEB 4S3KA 3TFXA 3S5YA 3EDEA 3L23A 3BSGA 1UD6A 1KM2A 4IM4A 5KETA 4PSPA 4L4PA 3T05A 2WSQA 1JPIA 4EE9A 3M0VA 3F7JA 1QW8A 1R9ZA 1JULA 4O0KA 1MMFA 3JR2A 4JAWA 5LXEA 2WZTA 1KTBA 4W8LA 1R9YA 1QBBA 2V5JA 4LNCA 2PDHA 3LCLA 2E5DA 3CUZA 3OYZA 5HBFA 3TA9A 4PMDA 2QS8A 4FSAA 1A5OC 2FTYA 3IPWA 4AWUA 2HTMA 2OT1A 1OGSA 3OZPA 4LAOA 5TD4A 4WY0F 2UV8G 4NJKA 1L6WA 2OQLA 3GU9A 3EYPA 1JPDX 2C71A 2NXHA 4KH2A 3RM4A 4RZBA 2VRJA 3G5EA 3K30A 2I5IA 1VBJA 2GGHA 3P8JA 1S5MA 2GDVA 1V08A 3QPZA 6TIMA 2NT1A 1RV8A 1G0CA 2O9TA 2CNCA 1FWIC 4IJBA 3R8HA 1X98A 4K8HA 5D38A 3SW6A 4KWWA 5B80A 3CK5A 3IUDA 2AGTA 3BLOA 2Q71A 3CT2A 4MFEA 1UMLA 4FNUA 2FHCA 5T91A 2NQJA 1GOWA 1J12A 4NAFA 4P8VA 3QN3A 4JTTA 1R30A 1ADOA 3OQ8A 1O4UA 3TJIA 2MUCA 1MRQA 1BLIA 2A3AA 2Y88A 5A8OA 3R58A 2H9AB 3AUOA 2NWSA 2OYLA 3V75A 2PTWA 3F4DA 1B2YA 3UBPC 4FNTA 4QJ1A 4ZB0A 1UYQA 3QR1A 2WO5A 4W7WA 4IJCA 3UXAA 5BROA 2CCRA 4HU8A 2YCKX 4RCXA 2PTXA 1K4GA 1TV7A 4V1XA 3WQ8A 4E8DA 3UR2A 2BOFX 4D72A 2NSOA 1W2PA 4FNRA 3AIUA 4LTSA 1XH1A 5TF0A 3MZ2A 5I03A 3RRXA 1E5JA 3R2GA 3UETA 4RXGA 3LUTA 5DF0A 1JDEA 3W7HA 1Q7QA 4NILA 1KXHA 1NARA 3HFTA 3AZTA 5A6TC 5HJXA 4KCVA 4A8RA 3DN5A 4PCNA 4JIEA 4M3PA 4EIVA 3U2EA 1MFUA 2VEMA 2YL8A 2PGWA 2AGKA 3AHZA 3IJ6A 1YNPA 2W5FA 1HGWA 5M3WA 1IIGA 4GH3A 1ELSA 2QAPA 3KS5A 4IICA 2OODA 2Y6ZA 1OFBA 3LCGA 2HV5A 1LOQA 3CLMA 2E7FA 4BA0A 1FCBA 4XO6A 3TQPA 4GVHA 2WLYA 2YSWA 4HA4A 4IQEA 1RP8A 2QEZA 3G1YA 3A9BA 1L8NA 4Q8TA 4GO8A 3AOFA 2JKAA 1UWRA 3STPA 1G4SA 2V2HA 4YPJA 4Q8WA 4XISA 4KT2A 7TIMA 5CC6A 5BXRA 1B9ZA 3HTWA 1HVQA 2XM2A 5GNXA 1X7FA 4L6DA 1GUVA 3F03K 4IX2A 3NDYA 3E0WA 1JDAA 4JIQA 4WIWA 1Q2SA 1XDMA 1H61A 4KCUA 5BRQA 5IRPA 3DFQA 4EF9A 4PTNA 1R3TA 2QKFA 2QCHA 3MTWA 1M01A 1D8CA 1JGMA 2D0HA 4E3VA 4JFUA 1E3ZA 1TB3A 4PFHA 3WMSA 5JH1A 3AICA 2DSWA 1H09A 4AZ6A 2EAWA 2FZ8A 3W7MA 4HT3A 1Y8BA 1OHLA 2XGZA 3W2UA 1K7EA 2J8TA 4MWAE 4O57A 4DJEC 1DQUA 1H7RA 3NURA 3LMZA 2GGGA 2XFFA 4BF7A 1O7AA 3MDUA 3OA3A 3NDZA 2C14A 3SJNA 3G22A 4QLLA 5GJNA 3LK6A 1L2QA 3ARQA 2ATSA 3HGSA 4LS2A 3K4DA 1H62A 3FW6A 2J24A 2OT0A 1UKQA 2VC7A 5AYIA 4OV9A 1IXNA 1PXGA 3AFBA 4ATDA 3WG6A 3OLEA 3FJ4A 4QP0A 4B3ZA 4PB3A 3F4NA 4Z2JA 4UNIA 2E1DA 3I7QA 4S2BA 2PDKA 3E0IA 3DAQA 1EYWA 1PWLA 3JZUA 1SUXA 1LRNA 2WZIA 4KFPA 2C1HA 4QTGA 2QCGA 1UR3M 4M82A 1X8FA 2JQXA 3THDA 2ONEA 3AMCA 4B2DD 3FX4A 1XPYA 2Q8ZA 4B4FA 4RNHA 1HL9A 3PJUA 3AYVA 1SSDA 3LXCA 1ZBKA 2NZLA 1GHSA 3QR0A 3AXKA 3DH7A 4Z42C 2ACUA 3ENLA 4NXSA 1TIWA 3NL6A 1PCKA 2JIWA 1XUUA 2A7RA 1ODZA 1WDQA 2DORA 3WD2A 3ZJ8A 1QBAA 4S2CA 2W9MA 3LB0A 3DGRA 2V3EA 2VZUA 5DQPA 4HYRA 4ASTA 3V5CA 4Y9PA 4R7JA 2J62A 4HSNA 3W7RA 3CNYA 4F8XA 1E56A 4S3AA 2GQ9A 4KETA 3H53A 2A3EA 3E02A 4N6FA 4XAYA 1O5RA 1VLWA 2YXGA 3JS3A 4ORMA 4Q8MA 3GHUA 1WDRA 4KWUA 3WK1A 2BGNE 3MO7A 3E0LA 1Q7ZA 1B3WA 2YW4A 1Z42A 4S3JA 2J9XA 4ZOEA 5F4WA 1AK5A 1TELA 1MUCA 3PUGA 4QIUA 1RCQA 4Q7NA 2DIJA 4GXPA 1DBTA 1FUYA 2XVPA 4LUYA 4H3DA 3QHOA 1QW9A 3M0XA 1FWSA 1PV8A 4FOKA 5E0KA 4KGLA 4LVGA 2OX4A 2JK2A 3TEVA 1H51A 5FEXA 2B7PA 4MB3A 3T09A 2BS9A 1MQQA 1O1HA 4H9VA 1JDDA 1H4PA 7XIMA 1T99A 1HP5A 2OEKA 3W83A 4XZHA 2OO6A 1C92A 4K39A 4NG3A 4AEOA 1XRFA 1JR1A 4CVUA 3RM8A 4EANA 3NXLA 4M0XA 1GOOA 2Q8LA 4W85A 4KCWA 3IV8A 4EWJA 4L61A 4GIRA 2VOTA 3VC5A 4AYSA 3R8RA 3T2QA 4ICNA 1AJ0A 3SN1A 4HPJA 2NX1A 2WMIA 1ISXA 4KRZA 2Y7FA 3HF3A 3VABA 3C2VA 5FACA 2BOGX 3KHDA 4HSHA 3O16A 4H4IA 1E51A 4O53A 2HCVA 1HVXA 3RU8X 2XVLA 3KX6A 1CGVA 4BHYA 3BC9A 3GUWA 1Q6LA 2HSAA 3PG8A 3ANUA 3NQDA 3B4UA 1MXGA 2FVMA 1KA9F 2OKOA 2XSAA 1JEZA 2HPMA 3FAWA 2NUWA 3WQCA 4RKAA 2ICSA 4PCPA 4ZO8A 4LXFA 2ZXBA 3RXZA 2J8FA 2ZZ1A 5FL0A 1KM6A 3MCMA 1UR8A 2FB2A 3D47A 1EJVC 3K8MA 4YHGA 1U22A 4LF2A 1WOAA 3N15A 2YA2A 2DW7A 2HVOA 1GT8A 4U2YA 4ZMGA 3PY2A 1WOBA 2ZYFA 4IFRA 3CZLA 3AMDA 1U1JA 3IJ8A 2G8ZA 5EFFA 4D8ZA 3NR0A 4ROPA 2CU0A 3WDPP 7CGTA 1X6NA 2PI6A 3KCJA 3SRHA 3AS3A 5CPMA 3A4WA 3N2MA 1SMDA 3W02A 3ZT6A 1V6YA 3MZNA 3M5XA 4AVOA 1V03A 2ODOA 2X42A 3DESA 1EEPA 2YYUA 3GDBA 3HG5A 3WJZA 2IKIA 3N14A 5CAKA 4C6QA 1U30A 3Q67A 1AVAA 1U5VA 2E3ZA 3NA8A 4RZ6A 1OZQA 1EBHA 1UKPA 1J0IA 1VYSX 4GYKA 3QZEA 3ARZA 4AF0B 1WV2A 4BI6A 3PF3A 3HGOA 5CZKA 2DZPA 2WCAA 1Q3NA 3U5UA 4IP5A 3Q65A 2DZVA 1UIPA 4RLIA 2WKJA 4G9PA 4QX4A 4DHGA 4ROQA 4NZ4A 4MB5A 4PE8A 3PBUA 3MDWA 3VGEA 5KTLA 4IGNA 1I75A 4IUGA 3C61A 1H3GA 2DVTA 4L80A 3OBEA 3LCXA 4NQ1A 3GE7A 3T8LA 4W9TA 3W3OA 4H1ZA 2XSXA 3WL1A 1M68A 1TFVA 1XR2A 1DVJA 3MYPA 4JZ5A 4K1WA 1DORA 3U0HA 4O19A 4C60A 1FFQA 2WW5A 3CV7A 4WHBA 1W32A 2YR1A 3VUPA 3G24A 3R94A 3TJ4A 3VAVA 2LLEA 4YWIA 4YNGA 5CPLA 1UKTA 3DEQA 4B9YA 3GR8A 4I5UA 3U57A 4UR7A 3GU2A 3E0FA 1XRTA 4GXMA 3EWDA 1W31A 4CNPA 4OFCA 5A8GA 2DSVA 1QMLA 3K1GA 3MYOA 1T8XA 4KWVA 2GGEA 2FDMA 2OZ3A 3OZYA 4IT1A 1IEVA 3SUUA 2X1UA 4KKXA 3ICJA 3FYOA 1RPKA 4LVDA 3CC1A 4NI8A 3ANVA 3E2SA 2Y63A 3W01A 4YJ5A 4FF7A 1NVMA 5CJNA 2BHUA 1A3XA 3QYQA 4IP4A 4RV8A 4GLEA 3TR9A 1Q6OA 3UJRA 4Z2HA 1WUFA 4YVPA 1YEYA 1BG9A 5FJTA 1QPRA 1AQMA 1ECEA 3CYJA 4JL2A 2WOQA 5DRCA 4HNUA 1KBLA 4P7OA 3EWCA 4GPNA 5FJIA 5C71A 3GHRA 3WD3A 5CQ1A 4MNJA 3AYSA 2IKGA 1KV5A 4TX9A 4REQB 1GVQA 1A3WA 2ZE0A 4FNPA 1VENA 4L4OA 3C2OA 1UR2A 1Y7VA 3VKAA 1FWBC 1V4YA 2ON3A 3BCFA 3VNKA 1LP6A 2DGAA 2E4TA 3USBA 5L9FA 1S2WA 1JF6A 1QHOA 3SN0A 1ZFJA 4ZFCA 3K1DA 3QZ6A 1XBZA 4E6MA 5E0FA 2W4XA 2WVSA 1EL3A 1V6TA 1HJQA 2G0WA 5KMYA 3QLLA 1XDLA 1XG4A 3NPUA 4DQWA 2HS8A 3ZJKA 2DVXA 3SRFA 2RGMA 4P8WA 5AZ0A 3GXTA 3W24A 1KR1A 3FJNA 3KUMA 3WJYA 4DYEA 4H8HA 3U8GA 1OB0A 2OCZA 4L9ZA 1JAKA 2VDGA 2F61A 3SQSA 5LIWX 3RR4A 2KX9A 3WQPA 5BU9A 1JCMP 2GJXB 3GTIA 4PUKA 1GPWA 5AC8A 4NVTA 3CB8A 4HK5A 4XVEA 3P0XA 1GYLA 1OCNA 3OYXA 5U7SA 1OG6A 4G1KA 1TPB1 2Y8VA 2Z2AA 1PKMA 3UW6A 3VMOA 3KRBA 4EK7A 2ZUVA 4B4HA 1BYAA 1DXEA 4IIEA 2ABBA 2IQDA 4MZYA 1XSKA 3AS0A 3SR7A 3S2CA 3KRUA 2PRMA 3OGRA 2P53A 2ZTKA 4MWAB 1E6ZA 4TO8A 4AHQA 1B4EA 2IKJA 3QMSA 2WMHA 2D22A 3QGVA 5JH2A 1EGVA 4F2TA 1EDQA 5HNNA 3B9DA 1QCWA 4WEVX 1J93A 3WK0A 3MI6A 2RJGA 4O8AA 2JE8A 3OQEA 2EPHA 3VOGA 4UTTC 1JCTA 2I9UA 1YDYA 2P8BA 3U2OA 1IEIA 3W9ZA 3OTRA 2XU2A 4M56A 3M6DA 2X40A 3S9YA 8TIMA 1DIEA 4K7VA 3TQ0A 3SZ8A 2B0MA 3BOLA 3A47A 3E49A 4AQLA 1LBLA 2BXVA 5HQMA 1UIOA 1T0OA 2WK2A 3UCDA 2YDRA 4ERIA 1VFTA 1WDDA 1GVIA 5DLCA 2DUAA 4H04A 1WZAA 4S3DA 4TX8A 1F05A 4NT0A 1UPMB 4ES4A 4B9ZA 3G1FA 4YHEA 4I6KA 1EPXA 4KEMA 2Z25A 3AALA 4DLMA 1B5TA 2D73A 3SCUA 3ABXA 4L64A 4W5ZA 4Y96A 4BEQA 3SFKA 1XM3A 3NIYA 4JTJA 5I3FA 2XFRA 4DBDA 1XXXA 4O4WA 5EB8A 4UFMA 4HHLA 3CL7A 4HPXA 5K9DA 1ONWA 2OVLA 1R3RA 3WCZA 4C6IA 1EXPA 4C6KA 2PP3A 1JPKA 3IIPA 4IMEA 1TMQA 1SSGA 2E6AA 3OA5A 1VCGA 2Z26A 2HK0A 1VRDA 4J3VA 1E6SM 4QGCA 3UPBA 3BLPX 4Y7EA 3P6LA 3TC3A 5CPSA 3N11A 1TJ0A 3BCJA 4RE2A 4O28A 5FI8A 5IFPA 3IWPA 2EJAA 3UR8A 1PCWA 4HPGA 3B40A 5ECUA 1RZMA 1HF6A 1MNSA 1NWSA 4JTKA 4LPCA 2CBVA 3W73A 4GABA 3WH6A 4TMCA 1DJGA 1B57A 3MV11 3TQVA 1YLVA 2FDSA 2PDUA 3B8DA 5C54A 3VNDA 3GNDA 2CIPA 5J5DA 3AMLA 4GVGA 1FBAA 3B8SA 4CNOA 4W86A 4CN4A 4MKVA 4PMJA 4FX6M 4PL1A 3CZKA 1T5AA 4D6DA 3L7RA 4B16A 1UKSA 3M9YA 2Z4GA 1VC4A 1JNDA 4FX8A 3W2MA 1HO1A 3KBWA 3DI0A 5H2ZA 3LHVA 4UR8A 3LENA 1ICQA 4QSHA 1DQXA 1UR1A 2NV2A 2ACRA 2XVKA 2G96A 3W1AA 3AIVA 4BI7A 4O4VA 4XZMX 4CLMA 1QHZA 2OLSA 3UWYA 5CBIA 1EGMA 3BG3A 4BQ4A 1TIMA 4JQ3A 5BNKA 1P6BA 2XZ7A 3M64A 3CPUA 5HK4A 3LNPA 4X0NA 1X1ZA 1YBQA 3GFYA 4XAZA 1TA3B 4C6BA 2BWGA 1EOMA 1PSCA 4A22A 2QUMA 4OQVA 5A6MA 3GRIA 3QW3A 1KTNA 4GYPA 4UFKA 4DPQA 3QM3A 2FJUB 4OIFA 5HMDA 2V5CA 1VFLA 2TAAA 2WMFA 4HOWA 4JQAA 3N17A 3N9RA 2DU2A 2W63A 5H6HA 1W1IE 2G3FA 4OVXA 1UOKA 3WH7A 1Q85A 3LZ5A 3ZR6A 1YADA 1OABA 3R12A 3QC0A 1H49A 4TVCA 4ZE4A 2Z7GA 3W2KA 2C13A 1JCXA 3QPYA 2GVYA 4BCEA 1WKEA 2WQDA 3NQGA 2C8NA 4ZFMA 1DJNA 3S83A 3N6JA 3WLHA 1GPFA 3DHFA 3ZLFA 3BLDA 5CCZA 3RCNA 5EMYA 3KVJA 4IMAA 3WLRA 1HO4A 5FL1A 1QI2A 2VMFA 3DECA 3VINA 1WDSA 3UWEA 3BSHA 4HU3A 4I3GA 1J0YA 3W07A 3W71A 2PEVA 3TMLA 5BRBA 3QEZA 5AY7A 4RE3A 1TCDA 2ZICA 4HMNA 1JYVA 3PTQA 3N1AA 4UR9A 5BW6A 2PWGA 4X60A 2AL2A 1EGZA 3UCQA 3RCMA 4F0RA 3MSYA 3WLIA 7ODCA 2GVJA 1WCGA 1B31A 4J7RA 3UNDA 2OQYA 1BF2A 1VJSA 1R2RA 3IANA 1S46A 1K03A 3TJLA 4INFA 2ZUWA 3POHA 4OHQA 4B5NA 1FHLA 3DXIA 4ACZB 3PB0A 3CM4A 5AC4A 3FJ6A 2R1PA 1VFHA 5C7VA 4A29A 5I3JA 3TYBA 3SB0A 4HA0A 2XZ9A 2E5CA 1V3KA 4MGGA 2BZNA 3STGA 4KIRA 4P8XA 3AAMA 1XSIA 3TNOA 1EIBA 2FMNA 3VNZA 3W86A 4XV0A 3DKLA 3M41A 4L5ZA 1S2CA 1VD6A 4YL2A 1V51A 2G3IA 2YDAA 4X9SA 2FHBA 3ARYA 1H41A 2FZ9A 4FLQA 4ZQCA 1C9DA 2Z1VA 2NX3A 3RO8A 1A47A 1X38A 3BAXA 3VOHA 1P48A 3VKCA 1ZQ5A 3AMGA 4IPLA 4G2DA 4XD3A 3GAKA 3ITLA 5KEZA 4AIUA 2PTZA 1E0WA 1NWRA 4DELA 3FDGA 4FB7A 4PMZA 3TNBA 1CTNA 1RJRA 3PPGA 3AC0A 1SO4A 2IQTA 4S3FA 3UG5A 4TMBA 1C8QA 1FA2A 1UC4A 4KEVA 5D9NA 5A6SA 4NHVA 3ZVIA 4LUSB 1RUSA 4J2MA 1WDPA 4U4MA 2ZUNA 3M44A 1QWGA 1XD1A 3VIHA 2O0TA 3NL3A 4F2BA 4R3UA 2WANA 4KRTA 5AYXA 5LXXA 4UXDA 2E25A 3GU1A 4DM2A 1CENA 1GJUA 1GG0A 2RAGA 3SY5A 2WC7A 1S2VA 5B7ZA 5A3HA 1MW3A 1MO0A 1SZRA 3B8TA 3WNMA 3RITA 2OSXA 2IPJA 1E9IA 2FJKA 1ONXA 4G8TA 1OFRA 2Z1WA 3JRKA 3VKDA 1CYGA 4S3BA 3SY1A 5EA9A 4UZSA 1FFRA 5B7YA 1E40A 3MWAA 3CHVA 3EDKA 3M0ZA 3N04A 3W2LA 1O95A 3OZMA 1UKOA 3ZT7A 1BD0A 3N19B 4CQCA 2ISDA 3W1MA 3VX0A 1FHUA 2E6FA 1JZ8A 1OK4A 1M6JA 2I56A 3ELFA 4IMFA 5XINA 1IF2A 4WDUA 1ECQA 1REQB 1ME7A 4IIFA 3EMQA 3QLDA 3GR7A 5AC5A 4N2YA 2CZDA 5D8WA 4RL3A 1XYCA 3FA3A 4LYKA 4TV6A 5F2IA 1YBQB 3OVPA 1PS9A 1O12A 2WPBA 2PLJA 3BJTA 3OP2A 3HB9A 3WLPA 4CN6A 1TQJA 3NQMA 5I3GA 2OSYA 5ECVA 4WKAA 3ME3A 3AZRA 4IISA 1SFSA 3KBVA 3C52A 2VEIA 1OYCA 1UBSA 3HMCA 3PWAA 1LYXA 3GWQA 2BGQA 1V7YA 4FMVA 4AMCA 2GDUA 2QCNA 4JTFA 1XH0A 3VNIA 1S1RA 2PURA 2OZTA 4NIRA 2ZRZA 1SR0A 1GTEA 3PTDA 2CEQA 1QPNA 5H8UA 2Z24A 3KDOA 1K8XA 1LDCA 1BVWA 2CC0A 1TR9A 4UOJA 2PUZA 4LNYA 5D02A 3C56A 1ZLPA 4RDZA 3AIQA 4L1GA 2ISWA 2QDHA 1RCXB 2VTFA 3PNZA 5HUPA 3VOIA 1W5MA 3KE0A 3ARXA 3LHYA 2D24A 2BVYA 1XGZA 3VD7A 2GPTA 3T9PA 1VEPA 5CKSA 4PGLA 1QNSA 4NAEA 4U5KA 4LY8A 4NUWA 5CGTA 5AHIA 3UEQA 1HJVA 5A6JA 5F2GA 1P0NA 1TO3A 5C55A 2OOGA 3GNNA 3OLGA 1YNYA 3UXLA 4GOAA 4W87A 4QS5A 2HNEA 3VOFA 1PB0A 4AXNA 4O18A 2WMIB 1XKJA 2Y7EA 2HRWA 1IEXA 3F5LA 5I6SA 3AHVA 3T81A 1V79A 1E6XM 4XVDA 1AH3A 2DQXA 4PMRA 4M5PA 4W8BA 1GYNA 4XQ6A 4E2BA 1WPCA 5H91A 3WFZA 3TJXA 3L12A 1WX0A 5G4EA 4AC7C 4PBEA 2AQVA 4CD4A 2WQPA 3GHSA 2WM1A 3S1UA 1D2KA 3URAA 4WD0A 3EOUA 2Z2BA 3LI0A 2VNCA 2EKGA 1V02A 3TDFA 5FJRA 4GKTA 4LS0A 3QQWA 3C4UA 3O15A 3TA6A 3NTYA 4A3HA 4IQDA 3BGJA 2FZMA 1U5JA 2HK1A 3MS8A 4QJ5B 3L4YA 4R88A 4NY2A 4WUIA 3WMBA 5EMKA 3AIWA 5CEWA 3NVDA 1BWVA 3ARWA 3UR7A 4MG4A 2REQB 3T4CA 6XIMA 2PGEA 1I2PA 3GG7A 3TW7A 3W7EA 3WQOA 2NV1A 1F9CA 3LBMA 3VXGA 4GVFA 3R89A 4B5TA 4ZQMA 2CZVA 2F8QA 2ISVA 4XTDA 5I09A 3EOSA 3GVVA 4KESA 1QOXA 2P0OA 3ITYA 3FGCA 3AXMA 4D6CA 1G7VA 5BCAA 3FHQA 1KFEA 4XD6A 4C1NB 3EEZA 4NX5A 3ARPA 3W7KA 2BODX 3WQGA 3C0QA 2VDIA 4JTGA 4LYPA 3EKZA 1ISVA 4BF9A 3P5ZA 1AW1A 2YCIX 1E4NA 1EJUC 4KF1A 1VFFA 3HQ1A 2J7BA 4MUPA 5LKYA 2INEA 1GTHA 3LRMA 3GM8A 2PBGA 1R3SA 3NFUA 3QGKC 4GE8A 5DX7A 4KPLA 3WUFA 2INFA 3E5PA 3D46A 3BCDA 5E0CA 3LPOA 3W2JA 1XISA 3UESA 1O6IA 3SN4A 1NEYA 1JGIA 1Y65A 4AZ5A 1FRBA 2J7FA 3M1ZA 4K37A 2ZC1A 1O1ZA 3N3TA 2ZUUA 4WZHA 1K7FA 3T6CA 1NTHA 1J18A 4DEFA 3V5OA 5HOSA 4DBUA 2FKPA 1EO7A 4HMCA 3QQ0A 3K4WA 1NWTA 1PZ1A 4XZNX 3L5MA 3TW9A 4I8DA 1Q6CA 3EPNA 4JHZA 3KL3A 1V3HA 3GXPA 1DJXA 3RM9A 1MQPA 5ABEA 5I07A 3D0CA 5M17A 1EH9A 2WPGA 1KXQA 3QR3A 5LNRA 3WH5A 3PULA 1C9WA 3P62A 3QBUA 1TG7A 3O9NA 5J5RA 1T96A 4H19A 3UGVA 1A0EA 4HPHA 2CBJA 2GWNA 2ZZ3A 5C9ZA 2FQIA 1J8VA 3POCA 2CLPA 2WHLA 2CERA 3LHZA 3RFAA 4Q7BA 1SW7A 3TH6A 3VUSA 1KD0A 1W5NA 2L5HA 1E9ZB 3STCA 3KWSA 3MCNA 3H2EA 4UQ9A 4F66A 4GY1A 2ISSA 4J40A 1UZ1A 4AWEA 3G1VA 1ZL1A 2OJPA 3D5HA 3QVQA 4LV4A 5GQBA 3OGVA 1JQVA 3QHMA 1GOIA 5DEZA 3V7PA 4GFIA 3NL2A 2ACSA 4QRNA 4GQRA 4C90A 3L4VA 1QW7A 3GG8A 4AZIA 2DW6A 1VRXA 4HPNA 1A5NC 1RALA 3RX2A 4KW2A 4HNTA 2E8ZA 5IBXA 4XZWA 1TTJA 5EKYA 3GDKA 2DDXA 2ZVRA 1PIGA 5K7JA 2VEGA 4AX7A 3VGGA 5AOUA 1HL2A 1E1CB 1FHVA 1YPFA 4LWWA 1ADDA 3AMKA 4EPEC 3MP3A 1C8VA 2XM1A 4X22A 1Q66A 1TX0A 3VNLA 3URNA 1AQ0A 2VT0A 4X2RA 4AC1X 4B15A 3ZJ6A 3QV8A 3GG1A 5AYBA 1HKIA 1M1BA 1Z32X 3O6YX 3H55A 3H4WA 4HCLA 3B0XA 3C8NA 1E4MM 3GHTA 4IIGA 5AECA 1G1YA 4DPPA 3GVQA 2SFPA 5LNWA 4MADA 5I23A 3C0LA 3QFWA 2VGFA 2CLKA 3MJMA 1UMYA 1V3JA 3Q2DA 4WSKA 1L2UA 1KRCC 2V0TA 1TWSA 5FAGA 1TMLA 5LGXA 3EWXA 2G3JA 3NO5A 5ABGA 3APYA 1SZEA 3S2LA 3SY8A 2OFJA 1WKYA 5FA5A 3HOJA 4R5EA 3ZYZA 1OM0A 1NDVA 2CLOA 4P61A 4KQNA 1EQPA 4JCMA 3HQOA 3PZVA 4S38A 9RUBA 5EMMA 4DBSA 1P0BA 1J5TA 1ITUA 1QU4A 1R0MA 4H8VA 3B8UA 1PYMA 4ZOAA 4UBPC 1DIDA 4EXQA 4YIWA 2YB4A 3LOTA 3NQVA 4Z1YA 4PUUA 1BHGA 3B4YA 1G4EA 5HULA 5E5CA 1I2OA 4WJ8A 4M19A 2GLKA 2ZZ6A 2VQTA 4DWSC 3UG4A 5SWUA 3W38A 4ZODA 1EF2A 1P4CA 1AJZA 1EWDA 3I6RA 2BHZA 1NFGA 1IYXA 4YTSA 4MKSA 1I60A 3S9ZA 5D2TA 3CQKA 1B3XA 1CIUA 5DBUA 2ZXAA 4PYSA 3M43A 4UUIA 1D7KA 4H7ZA 4MFDA 1N8IA 3SEPA 1J0ZA 2GUYA 1GJWA 4JD4A 4RNFA 5JBDA 4JN8A 2XHYA 3M0HA 3M46A 1RBLA 3AYRA 4LCSA 4NSBA 1V5XA 1S38A 1G5AA 1VZWA 1W9PA 3BE7A 2OTDA 1IQ8A 3U4FA 1BFNA 2WHKA 4MYXA 4WY0A 3C86A 3HG2A 1ZALA 3CASA 4HZMA 1OIMA 2Y5EA 1VBRA 3B03A 2WSPA 2XIOA 3WDIA 4DB7A 5C2CA 4UQAA 2XFYA 3C2FA 3PSVA 3RMJA 3R79A 4HA3A 1NWUA 3QMRA 3TCEA 4H2CA 1QATA 1W1YA 5TBOA 4UTLA 2B4GA 1JFXA 1KFCA 4OJYA 1JCJA 3VZZA 4DJDC 1UQYA 5IHSA 2VOMA 4JTDA 3B9EA 4PMVA 3FXGA 3WD1A 1MFVA 2NVCA 1CGTA 3EX2A 1TSIA 5HANA 1AMYA 3N3MA 3BV4A 4ZQOA 2RDTA 5A8MA 2PCEA 3EXTA 2ZWYA 1BYCA 1Z89A 3LTSA 4LUTA 4DN1A 1FP9A 1SO5A 3DFTA 4NNBA 1BG4A 1TZ7A 1KKRA 1Q6GA 3PSWA 2WWCA 4DO5A 1FDYA 1N8FA 4JNYA 4M7TA 2QJMA 4DF1A 5HWNA 2E9MA 4PB4A 1XX1A 2BBFA 2ZRXA 3NO3A 5IBXC 1VIWA 3M4HA 1R9XA 2IPGA 4PZVA 3A13A 2OR2A 1TTPA 3KL5A 3CWHA 1CGUA 4JHMA 5DCDA 2D20A 1VS1A 2RFGA 1UCWA 1JDCA 1Z7AA 2FFIA 1BYBA 1GVRA 5K4ZA 1OC5A 1D3CA 4J28A 3CQIA 1OC6A 1GKRA 1KLYA 1V0LA 1VH7A 1XH2A 3Q4DA 1DTUA 4Q8NA 4RW3A 3M07A 1FHDA 4ZSUA 3VIOA 4H00A 3CIXA 4PA8A 4YTQA 4W7UA 3PZGA 2WBGA 3P2VA 4UTTA 1OGBA 2A21A 1FQ0A 4LAUA 2ZWZA 2AQOA 3GXFA 4HOXA 5A5WA 4K8GA 5CPNA 3ISIX 3M0KA 4V33A 1TPUA 1JDFA 1P6WA 3QPEA 1XIIA 3VO0A 1PJ9A 3GIYA 3SCTA 5A6BD 3IUIA 4I7UA 2IXVA 1XJBA 5JBFA 3MKCA 1N7KA 5DMLA 4HMDA 2Y1HA 1MNZA 2NQ5A 3FNDA 2DFAA 3L2IA 3R43A 3LU2A 2NUYA 3GZAA 5EFDA 3CUIA 2JBMA 1PIFA 2Z6JA 1ZS2A 4PMOA 4LFYA 1SFLA 1ZJBA 3U2CA 3KTSA 3FGCB 4F0HA 2VKZG 4ECLA 5F2MA 1RQEA 1UBPC 4MAVA 3ATYA 1Q13A 3P74A 3AIBA 3AYTA 2QCDA 3LBOA 1M7XA 4GY0A 4GNVA 5CC3A 1ZBVA 3H7VA 1F7BA 5FIPA 1IEWA 5AB3A 3HO8A 3F5JA 4GI9A 2HROA 4I9JA 5HNRA 5D4YA 1XCXA 4EPKA 3BW3A 2VWSA 1X6LA 2J7GA 5CZJA 3GTXA 1MUWA 1RA5A 4JN6A 1Z41A 2NXIA 3SM0A 5CGMA 4RE0A 3V0UA 2WMKA 3UWWA 3BWWA 1KGXA 3BVJA 4BQ3A 2FZDA 1BKSA 2QR6A 2WJFA 1G6CA 2WNQA 2OU4A 3I3BA 2ZX6A 3CHDA 2ABAA 4N6EA 3UWQA 4Q6XA 4JXCA 5U4NA 4LH8A 2DZTA 4ADUA 1TKKA 3VOJA 2IQ0A 1M41A 3WUEA 3ZVHB 4XUGA 4MJZA 4N7QA 4CEXC 2Y8KA 1J2WA 3WNKA 1KRMA 5LZLA 2OZ0A 4LF1A 3WBEA 1BTCA 1DWIM 4UNKA 5DBTA 1L6SA 1UOZA 4EXAA 3R0DA 1R3YA 4AIBA 5CJ5A 3CMGA 3GW0A 4M6QA 4CCEA 2YW3A 1XL9A 5CJMA 5FESA 3DX5A 4NZFA 1D3HA 4AWSA 4RNJA 4DXVA 5IM51 4H9ZA 2VZOA 4GRSA 2PDJA 2QAFA 2JIEA 4ZTXA 1K3UA 1OF8A 1B9BA 4M1RA 1ITCA 3OLIA 2J13A 5LIUX 3NVTA 1P7TA 2WXDM 1DTNA 2ATMA 2O9PA 1A3HA 3APGA 4X0VA 3ITTA 4QS6A 1SO3A 1J5SA 2VM8A 1NSJA 3N6HA 5EBAA 4C7GA 1AL8A 3F2BA 3L5LA 4JKMA 4S3CA 4LY4A 2DSUA 5A2CA 3TU9A 3VIFA 4Q8OA 1WO2A 4RW5A 3W7IA 3IUHA 2E40A 3L4XA 3N25A 1E15A 1CX9A 2AMGA 3A3WA 2ADAA 2FB3A 1YW1A 3TIMA 2QJHA 5JBEA 1GHRA 4LUTB 3A22A 3S6OA 3HJEA 3B8IA 1TVPA 3U4AA 4GI4A 1HJUA 3I4EA 3L4ZA 3PWIA 3G1SA 5CSSA 3TXVA 1AH0A 3EGJA 3SQLA 1S2TA 1TRDA 1GG1A 2B31A 2YX0A 3LTPA 3W1LA 4FR6A 1XIBA 3M5VA 1QO2A 3H12A 2CLEA 3UWVA 1HKJA 3IIVA 2EG7A 1JPMA 5DELA 2XGBA 3EOEA 3UWZA 1GGOA 4PTVA 3AU6A 3QXBA 1EJWC 3TOPA 2OWXA 1CBGA 3WNNA 2DZWA 3CTLA 3LRLA 4GH1A 3BJSA 4MNLA 1E6NA 3A4JA 4HHPA 4WKHA 3ZXWA 3B0PA 2BFGA 4AX6A 2ZQ0A 5A6KA 1XRVA 1R6WA 1VYPX 4U3AA 1IIHA 3H22A 1LRQA 3MUCA 2IMRA 4WJXA 2A5HA 2HDJA 3FYPA 2DVUA 2QCEA 1XICA 3URBA 3UFYA 4Y9NA 1Q45A 2G3MA 1UWUA 2CLIA 3MW7A 1SJCA 1S5NA 1BYDA 4DNHA 3VDBA 5E70A 3WBXA 5EMJA 4C6NA 4DWSB 4HOZA 5BZAA 4CD8A 1Z3NA 3VOCA 3ZLHA 3EWZA 1XYMA 4ZO6A 3IGSA 1KWKA 1CEOA 1K8YA 5HWJA 1FWJC 1W8GA 3T1GA 3SGUA 2E67A 1W1TA 5EYWA 3PR2A 4HB7A 1S5VA 1PTGA 4HQVA 1OQFA 1KQZA 4J3TA 2O92A 2F6KA 1AJ2A 3KOZA 3B0UX 3OIHA 3EBVA 1RLCL 3IEBA 4JTUA 3V1PA 1L6FA 3NZ1A 3BPWA 2QF7A 5LNUA 1XI3A 4ZSTA 2P10A 2GVEA 1OFDA 3H7RA 2GSHA 2V63A 3NM1A 1S2AA 4HU0A 1X97A 1M03A 5LSMA 4C5ZA 2NLYA 5FOOA 3H4XA 1LLOA 3HPXA 1ENUA 4ZR8A 3N9SA 2C16A 2X05A 5M2FX 1RA0A 5GPRA 2X1RA 5TAOA 5H8PA 4UCGA 1UWIA 2UY5A 2DZBA 1DXFA 3WQDA 4LOCA 5I7GA 3BOFA 2C15A 3O0FA 2VEPA 2E9BA 4XD5A 2IKHA 4HKPA 4NI3A 1CB2A 4UIOA 1MI3A 4FNSA 3WF3A 3GW3A 3MSGA 4A8NA 3SCSA 3VIIA 1GQLA 3L65A 1K02A 1VEMA 3IJ7A 3KOXA 4PUMA 3VGDA 2J27A 5JMUA 4JIIX 3VU2A 2OYKA 1DEDA 3QV9A 1UQZA 4CQ9A 2AAMA 1EB3A 1FX6A 5J8LA 3P67A 4E4FA 4KS0A 1U33A 3GKFA 3H54A 4OECA 3LPFA 5ENLA 1DPMA 4FXFA 2PDGA 5LYRA 3I65A 2ZZ2A 1DHKA 1DIOA 3PJXA 2R8WA 4F40A 4MPQA 5C9WA 1J01A 2ZVIA 1JRBA 5FAJA 3B9OA 3SJ3A 2PWHA 3MY9A 1QFEA 2G97A 4ICCX 2HMCA 2ZX5A 1E0UA 2BXYA 3NYZA 4ZXLA 1EJXC 3UG3A 4G1NA 3BUVA 4OKDA 3V18A 3VX1A 1JRCA 5A95A 4JTIA 3FDKA 1OYBA 2QCMA 3CHCA 3KDNA 4BEUA 1HKKA 2QGHA 1VB9A 3V4BA 1IXPA 5DO8A 2NW0A 3MP5A 3WQ4A 4DXXA 3COTA 1EHNA 2HBVA 1F3WA 3WH9A 3VCCA 3SURA 3DFHA 5FSDC 4E0CA 3CAKA 2PDMA 3RJXA 3IK4A 3MWCA 1R2TA 4M6VA 4LYRA 1UH4A 4HNVA 4NZ3A 1RD6A 4RE4A 3GS6A 5HXMA 3DKJA 2EPNA 1SW3A 2EO7A 4PTXA 4HZ8A 3A5FA 3N9KA 5T9BG 5FD0A 3WO8A 4HA1A 4LAZA 4XIMA 2YDQA 3NOEA 2Q3RA 1KCZA 4WOZA 1R85A 4MHBA 1ZAIA 4LJ3A 4ZO9A 2JEPA 5LIYX 5HUOA 1F6KA 1GONA 4FAMA 1TZZA 3A4XA 3G0UA 1O60A 1XQKA 1AZ2A 4FLSA 3VDAA 4M1BA 1ZZMA 3W00A 4Y8EA 1E55A 4ERAA 3WLLA 1F5ZA 3FSTA 3S6TA 3W7QA 4C5YA 2RH9A 1C8YA 3S0CA 1DWFM 4IIDA 5FJJA 1ZJAA 3W27A 5D32A 3MSDA 3VGFA 2X1TA 1H63A 4XZ9A 2BGSA 2FLIA 1O5KA 3VCRA 5A94A 4AD5A 2W27A 1XLCA 2QZRA 1S1PA 5M1TA 3V0SA 2CHOA 1KNWA 1DE6A 2Z28A 2PD5A 2YFOA 3SCPA 5H8MA 3GY1A 2QMJA 3NQ6A 2D2JA 4DJDA 2PFHA 1MW1A 1X6UA 3UVIA 2CKRA 1MEIA 3FEQA 4H83A 1SPQA 4W4QA 4J9JA 3UZJA 1BSIA 3W7LA 1XLIA 3G1HA 5AYZA 3R0KA 4TR9A 2J79A 4MSSA 1LL6A 2Y7DA 3WK3A 4N02A 1AG1O 5XIMA 4GJJA 4WXZA 2VCBA 3CZGA 2GVGA 4DO4A 1W9BM 5FF7A 1U5HA 2V30A 5CLTA 4FXRA 3P0WA 2PD9A 4GA8A 1TPEA 1H7PA 3G0SA 3IIOA 2Y5SA 2W62A 4ZENA 2D0GA 3BW4A 3TAOA 1WBJA 3SUSA 3GVGA 1YPIA 5DT7A 1XS2A 4LBRA 1NDZA 1XLJA 1Q7MA 4AIOA 4H6KA 1CCWB 3FCPA 5BWAA 2V3DA 2P5NA 2DJLA 5HNTA 2J7CA 1OEPA 3CIVA 1A5CA 3KCOA 3ABQA 5KINA 2WHJA 4QCEA 3ORWA 3GH5A 1W56A 3L2MA 5EGRA 4UFIA 1PVNA 2VZTA 3CT7A 1FKXA 4H8UA 1P0KA 1ZU8A 4PBGA 4EACA 4GINA 3CTTA 3PAJA 4MNKA 1RHCA 2P3ZA 2AKMA 1EP2A 2QCDB 5CZ0A 2F2KA 1C7TA 4ZZ9A 4Q7IA 3WLJA 1H1YA 1LBMA 4NXKA 4JTEA 3G1RA 3LXAA 3SADA 3W53A 5D8ZA 1FY6A 4KEUA 1FH9A 3BK0A 2OQHA 3U48A 3E2RA 4ONVA 4C6FA 4RPQA 5DY2A 2Y85A 3WF4A 4UB9A 3LI1A 2X7VA 3GVWA 3ZQ9A 2PTYA 1W5OA 2FPTA 3PG9A 4RR4A 3OOQA 1XC6A 1DJIA 4K2SA 3N2OA 3UP8A 3EPMA 3N29A 1CT5A 3C5QA 4JTHA 1PKLA 3NDOA 4FX7A 3W7CA 1UD8A 3WIJA 9CGTA 3A23A 4UCFA 1QI3A 2C3ZA 1WAUA 4JOMA 4L4MA 3CYVA 3TSDA 1XIGA 1SJAA 4Q33A 1KXTA 2XVNA 2CITA 5HPOA 4NZCA 2EXOA 1TYGA 4M7SA 4KGJA 3VTRA 3NQ2A 3MT1A 4MVAA 3MU7A 3N4FA 3DHPA 1JQXA 1WE5A 3JZEA 1J2BA 4XO7A 1XGDA 3W7OA 3QMTA 3EXSA 3SUTA 4L65A 3TE9A 3PPFA 2Y89A 1F07A 1ZTVA 3H24A 4U33A 3TMQA 3C2EA 1W3LA 3IAPA 3N2BA 6CGTA 2YDSA 2GOKA 1GEQA 1UUQA 3ZS4A 2GGIA 3VIMA 1PX8A 1WAWA 4LEQA 1LUCA 1XLEA 1JI2A 4LEFA 1A5AA 2A1YA 1CXHA 1VCVA 3BAJA 3QGAC 1WZKA 2XH2A 1TR1A 5D30A 3L2LA 1C29A 1OK6A 2DT2A 2PC8A 4ZCWA 3OHIA 1ZAHA 1RXOB 4DXKA 1M65A 4HZ7A 1BVZA 3FY1A 4LUSA 1Y5VA 1S3TC 4BZYA 2PWVA 1ODUA 2XH0A 3LN3A 4PODA 3BXWA 3AHXA 4Q4MA 3OHMB 3T0DA 3SECA 3PAOA 3JU2A 4DJDD 3FEMA 4N9BA 3RPDA 4UOQA 3IRDA 4JNZA 3VVGA 5E9AA 2HEJA 4Q8VA 1F76A 3S46A 1I45A 3CL6A 4JL1A 5I2UA 4JHOA 3UJ2A 3W7JA 3E12A 3W1RA 5LA2A 1WKFA 2PMQA 3TKFA 3V1HA 2CYGA 4HJFA 4KFOA 2PDIA 3OVRA 2Y7GA 2DY3A 3LQGA 4HCHA 3MHUA 4ADSA 2J7HA 7PTDA 4DWDA 3WLTA 3GB6A 4AU0A 2J8GA 2XIQA 5E6ZA 2FVLA 1LCOA 1PZ0A 1SMAA 3VZYA 3INPA 4JEJA 2WSRA 3IS4A 1YXYA 4P8UA 4O16A 2V3GA 1TZ9A 1JXKA 3LY0A 3BZGA 1XLMA 1LOLA 5LA1A 2DH3A 4E2VA 4EP8C 1V6UA 2OLAA 5KITA 4LYQA 3IGXA 4PTWA 1GW9A 3WD0A 1W9UA 1Z6KA 1TRIA 1XBVA 1GCYA 3LM3A 4QQ3A 3PZIA 3RX4A 3TN6A 1E71M 3RIKA 4MYAA 4GWEA 2ZIDA 4NZ5A 4JEQA 3DI1A 4Q8UA 1OCJA 3WH8A 1NDYA 4YVVA 5LIXX 1WDWA 4H6QA 4Q4KA 2NQ9A 1MSSA 3W29A 5LHEA 3U5YA 4AZCB 2EPKX 1I4NA 3GC4A 3NXFA 3WQ5A 3E9AA 2J9ZA 3KXQA 4HN8A 1RBOB 1GQKA 2FYMA 2GGJA 4QCFA 2TSYA 3W70A 1JD9A 1KBBA 3LMYA 2PDLA 4QBXA 5JQ9A 4DUXA 2PZ0A 3HV8A 4GFSA 5D33A 2J7DA 1NF0A 2E6YA 4DZAA 3TFCA 4L1XA 4NF7A 4FEZA 3RAOA 3F4CA 3PVFA 3SCQA 3A4AA 2RKXA 3OPSA 3WYZA 1KO0A 3MI2A 2WVUA 4UTHA 3IVSA 1N2VA 3UNTA 1G4TA 2B7OA 1LUCB 2WSKA 3XISA 1UW9A 2ZX9A 4A2SA 2NV9A 4XX6A 3KVLA 1GVOA 3VNJA 1KM5A 1A80A 3ZVHA 3S5ZA 4Y6GA 3OW1A 4KBXA 5DFAA 4ENLA 2ZRWA 4DF2A 2DP3A 1T7LA 4GX9A 4TU1A 4GC4A 2DV0A 4D6IA 4JQ2A 1SW0A 1FP8A 3GVRA 2IS7A 1YNQA 2QVHA 4CU6A 3EX6A 1ITXA 1DJHA 2AQWA 2XJ7A 3GC5A 3LS9A 3XIMA 5LIKX 2VFFA 3CUHA 3WF2A 1OFOA 1RQBA 3UZZA 1Q8AA 3D6NA 3W1PA 2PDXA 3K8KA 3KM8A 3VMPA 1H7OA 4LC6A 3AROA 4C7FA 4EKJA 4UQCA 2EGZA 2J7EA 3ZLGA 2RDWA 3FKKA 2EPLX 2X09A 3UZXA 2OZ8A 2IXUA 3VM7A 2WM0A 1QJWA 3IJIA 3E74A 4GVIA 3G6LA 3C0SA 4Z1AA 1QUMA 5C8BB 4FP1A 5FKYA 1LWHA 4IIHA 3GXNA 3F4WA 1AQFA 2PPGA 3PZ9A 4R27A 3B04A 3VZXA 3F1QA 3MUY1 3QY8A 1MWOA 3NQ7A 4Y8FA 3WUGA 2P1FA 3QOMA 4HIBA 2ZA1A 4DO7A 4ORIA 3P81A 3GIQA 3T08A 5F2LA 1YXCA 3IIZA 1YTKA 3OODA 3UG8A 5D9MA 4ZXOA 1MYRA 4D6HA 1I1XA 1W3TA 2ZZ4A 2W61A 2ZKMX 3AISA 3CUFA 2I16A 3VKKA 2EQDA 1VAHA 3DBPA 1B54A 3GDTA 4P5UA 4AH7A 4UQBA 4UOZA 4JIRA 1NF7A 5AC7A 1IR1A 4D8AA 1EBGA 3SO7A 4IWWA 4W8AA 3T42A 4L7ZA 5FEPA 3G2GA 3GFZA 5ABFB 2QNEA 3BG5A 4MDPA 2EBNA 1C93A 3WELA 3DYMA 1ISYA 1YDVA 3OLDA 1X8CA 4FA3A 2VDHA 4JKLA 5G5IA 1BGAA 3HFYA 3DYOA 3KVMA 4O1DA 5D09A 3IVTA 1V02E 1HJWA 3GR4A 1OINA 5AHNA 1I0DA 3RCYA 4GYFA 3W75A 3UF9A 4YS1A 4CCZA 4GACA 5FSEC 1C7SA 1Q4WA 2GYIA 3RNDA 1WA3A 3O0KA 5I3KA 1QXLA 2VVNA 1H11A 5FF2A 2D23A 3FA4A 1AD4A 4PCTA 2WCGA 2QT3A 1BRLA 1IZKA 1QRQA 5DRIA 2GSEA 2E8YA 4XK2A 2YB1A 1VCFA 4GIEA 3T40A 4RDWA 1SFJA 1LLZA 1F6PA 3PK7A 4IJRA 1XRSA 3GDLA 4N42A 1Q4NX 4JYDA 4B90A 3G8RA 1ONEA 2PA6A 3O3RA 4JTSA 3TN3A 1KM0A 3LPGA 4HNCA 2CFFA 1K4HA 3AUJA 2VFHA 1HW6A 2O9RA 3T2OA 2IPWA 3CZEA 2GJRA 4MTVA 3R10A 3SSJA 2X30A 1W6TA 2BP1A 5KZ6A 5DANA 2PDYA 2OX1A 3THQA 2EHHA 4O0QA 2C19A 3EDFA 1L0PA 5CBBA 1QOPA 2X7WA 4NASA 1XYBA 4GKLA 3LCWA 2WNNA 3MUZ1 3R13A 3P80A 4GQQA 5A2BA 4DJFA 1KCXA 4OU1A 2WMGA 4EX4A 5C2GA 5GJPA 5FEZA 4XSLA 3QFEA 4Z1BA 3ABOA 4EAYA 4Y9OA 1VBHA 2GJPA 3PPCA 2V82A 4D1IA 5CSRA 3HJZA 3IRSA 4UTUA 3MMUA 1TTQA 4J4KA 1VF8A 3WFAA 2BVTA 2XN0A 4FS9A 1A5BA 1H7XA 4MOZA 4IQLA 2G95A 1XPGA 3CHFA 1KM3A 4IOTA 3VI2A 4CVWA 2Y61A 5KSWA 5XIAA 4GQGA 2H3BA 5DY3A 1DJYA 3H2NA 4ZA0A 1I6NA 3BO9A 5CZTA 1KXVA 2Z1BA 3O05A 3UXKA 1GKPA 4UFJA 3KS6A 2VCAA 1R7AA 4GQ0A 5BOFA 5D2WA 3CWOX 1R86A 4OV4A 4YU1A 2GJXA 3HA1A 4JQ1A 3IGHX 2BXZA 3PB2A 3SUVA 3L9CA 4CU8A 4GZIA 3S47A 5CG0A 1P5BA 1HXJA 3UJFA 4GI6A 4ACZA 1A50A 3BDKA 3NNTA 1E70M 5HR7A 1AH4A 4D1JA 2VFDA 4PRWA 4G7EA 1ICSA 1GOXA 1E1CA 3STFA 1XD0A 3C2RA 4D6FA 4ZGYA 1XP3A 1IWBA 5G2HA 1THFD 3S8HA 2WMJA 1GZGA 1H50A 1RK6A 1RJQA 4E4PA 1QI0A 2E77A 2ZADA 3CL8A 4OGZA 4TTUA 3WLNA 1QPQA 3BOXA 6PTDA 1XIJA 1M5WA 4ZO7A 4D71A 3HQNA 2CLLA 5BOEA 3ZM8A 4NJGA 3VFCA 2VFIA 4YWSA 2WLZA 5CSYA 4FALA 5CZSA 4GC3A 2PRHA 2UY4A 3QW4B 1HGYA 2YLLA 1WXYA 4S39A 2W66A 2Z27A 2WZEA 5A8PA 3W1NA 1GYMA 3PN8A 5EU9A 2VP8A 4OUEA 1X7IA 2CXEA 1TV3A 1EHAA 2PBOA 1TPH1 1X1OA 2C0AA 4U2ZA 4Z08A 1ZJIA 4J35A 3YPIA 3VE7A 3CV1A 1LOSA 1XSJA 3W76A 3QQ1A 4HD5A 1W3JA 2A3CA 4ML9A 3VD4A 3C8FA 3AJ7A 1LBFA 2W92A 3MMTA 3A12A 3MQTA 1R3VA 1FWGC 4RK8A 1R5YA 1B3YA 1XINA 3G8EA 1N55A 1BQCA 1U1UA 3WEMA 3KZSA 4FNQA 3OJGA 1YX1A 4O50A 3W1QA 1OFQA 4IX0A 1QOQA 4JY8A 3WJXA 3LYEA 3N12A 1R2SA 2QCLA 3AXXA 2GUUA 3OB8A 5E93A 2RDXA 4Q32A 4B91A 2CZFA 1QI5A 5BXSA 3DZ1A 1ZENA 2HWGA 4R9XA 1BQGA 2HBXA 3LSCA 2ISFA 5CG7A 3GDRA 9XIAA 3QTPA 6A3HA 4ADTA 2CLFA 3CMJA 1BSLA 4EVZA 3KLKA 5HMFA 1KTCA 4PRTA 2VR4A 4DJEA 4DRSA 5F1VA 3SGGA 3KAOA 3G1XA 3AHTA 1CGYA 7A3HA 4QEHA 1AW2A 2BB0A 3UZWA 3EZ4A 1Q5MA 4PC8A 4DZIA 1ISWA 2V2DA 4I6VA 1YDOA 1J96A 4HP5A 4HNLA 3L4WA 2H8XA 1XLBA 2OSWA 3KW3A 1EA9C 4GNJA 5D2YA 1E73M 1UWTA 3EX3A 4RZ5A 5RUBA 3CBWA 4JKKA 4DJFD 2H9AA 2OG9A 3SRDA 3GG0A 4L4LA 4NJHA 3S42A 4A4AA 3LXBA 4QQUA 2V9DA 4AY8A 1EXBA 3BICA 1H0GA 2QPSA 3P84A 1FDZA 4UNLA 2REQA 2JF6A 3GXMA 4WGXA 2PDQA 1DHPA 4B2DA 4MWAD 5F7UA 3B3DA 2QF8A 1XFCA 1HUVA 3V36A 3W2NA 3NZQA 2PS2A 4JICA 4XZLX 1M7JA 4FK9A 3KBSA 2ALRA 4GXWA 2J25A 3LDVA 4J5NA 1QT1A 1EO5A 4J3XA 4UQDA 4H9MA 3WF1A 1J4EA 1TA3A 2WBKA 1CLXA 1RBAA 1ZB5A 2ZXQA 4AFYA 1HX0A 1EIXA 1P0DA 2Q02A 4QJ4B 3OG3A 4JTLA 2GL5A 5I02A 3CAWA 1PKYA 5C70A 4YCPA 4NKCA 5C9UA 1CW2A 2FHFA 2QIIA 1NQ6A 4F48A 1W1B1 3RRAA 4U28A 1GOKA 3KCLA 4IQJA 4O15A 4QG9A 4HYVA 1VBGA 2V38A 3M0JA 1QVBA 4BQ2A 2YXXA 3HGRA 3LLFA 1LROA 2D69A 3BURA 5BWFA 1PZ2A 3O07A 3H2MA 4IXXA 3STEA 2PDBA 3ID7A 1EWEA 3RF9A 4J2PA 3E6EA 2TRSA 4D6EA 4UTIA 5FF4A 4K38A 3HZ3A 2VC9A 2J88A 2QULA 3VD9A 4EWND 2CWNA 1PDZA 2QDDA 1E0VA 1L9WA 2VI0A 5HJYA 1FOBA 5G4WA 4GGBA 4PCFA 3W1TA 4AVNA 1WNOA 4XSMA 3GBEA 4IFKB 1OWQA 3S5SA 2PCQA 5HAOA 5HQEA