4P2VA

Structure of the ai-2 processing enzyme lsrf in complex with the product of the lsrg reaction p-hpd
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
281
structure length
281
Chain Sequence
b'DGKDFRTDQPQKNIPFTLKGCGALDWGMQSRLSRIFNPKTGKTVMLAFDHGYFQGPTTGLERIDINIAPLFEHADVLMCTRGILRSVVPPATNRPVVLRASGANSILAELSNEAVALSMDDAVRLNSCAVAAQVYIGSEYEHQSIKNIIQLVDAGMKVGMPTMAVTGVGKDMVRDQRYFSLATRIAAEMGAQIIATYYVEKGFERIVAGCPVPIVIAGGKKLPEREALEMCWQAIDQGASGVDMGRNIFQSDHPVAMMKAVQAVVHHNETADRAYELYLSE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized aldolase LsrF
publication title LsrF, a coenzyme A-dependent thiolase, catalyzes the terminal step in processing the quorum sensing signal autoinducer-2.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
total genus 79
structure length 281
sequence length 281
chains with identical sequence B, C, D, E, F, G, H, I, K
ec nomenclature ec 2.3.1.245: 3-hydroxy-5-phosphonooxypentane-2,4-dione thiolase.
pdb deposition date 2014-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01791 DeoC DeoC/LacD family aldolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4p2vA00
1VQTA 2VEKA 3DFSA 1HG3A 1G67A 1SU5A 4O18A 5K9DA 2OJPA 1SZNA 3NVTA 3LRKA 3STEA 4AF0A 1H7WA 1P1XA 1XC4A 2R94A 3FKRA 2VC6A 1GEQA 1IIGA 3IRDA 5DY2A 3O6DA 1U83A 4UNLA 3LXAA 1B4KA 4JTJA 4A2RA 4Z08A 2QDGA 3E0IA 5CSRA 1JUKA 3FYOA 3W1AA 4WXZA 3M41A 3I7SA 3TU9A 4FNRA 2CZ5A 2BZNA 1IF2A 1TB3A 3LI0A 5BOOA 3C2OA 2VKZG 4N6EA 2PRLA 4HPJA 1GYLA 1SZFA 3HBLA 2ZZ2A 4FB7A 6TIMA 3N2MA 1FXPA 1THFD 2R8WA 2YSWA 3GNDA 3QYQA 1I2OA 2NXGA 2LLEA 1FDYA 2H3DA 2DU2A 1EUNA 3E12A 3LM7A 3ATZA 1FY6A 4UFLA 5AHEA 1R47A 2ALDA 3DFQA 3CB8A 2W79A 1SR9A 1YADA 3GXTA 1DBTA 3GVGA 2QCCA 3FLUA 3Q94A 1SUXA 1WXJA 2YDAA 3CWNA 3PULA 3FA5A 1TPFA 5D38A 4FXSA 1LTDA 3QEZA 3NGJA 1F6KA 3G24A 1H7NA 1OX6A 2R91A 1TQJA 1K8ZA 1SW0A 3Q58A 1I8JA 4LS1A 3PBUA 4HN4A 3TE9A 4LS2A 4ZQPA 5FEWA 3O63A 3MBFA 4RX0A 1S5WA 5IM51 4Y90A 3MHGA 4AH7A 4N4QA 4FO4A 1DVJA 3AJXA 2W0UA 1KFCA 1HFBA 3PF3A 2Y7DA 3C6CA 4HT3A 4OU1A 2HMCA 1G6CA 3KVKA 2FFCA 1LZOA 1RPXA 3SI9A 4AWUA 3W2JA 2Q8ZA 1H7PA 5K4XA 5F2GA 4OHQA 4XKYB 5AYYA 1OHLA 1LYXA 4LC6A 4EOUA 1W5QA 2I14A 2VFFA 4LY8A 4TMCA 2E5BA 3N73A 1L6WA 3NQFA 2Y63A 2ZZ4A 5C5YA 4CCCA 3CT7A 1O4UA 4Q33A 4ZQNA 3W86A 2V2HA 1PS9A 1RVGA 4R7JA 3CEUA 4UCGA 2NX1A 3UZ5A 2B4GA 3PSVA 3LLDA 2C3ZA 5C55A 3W7PA 5G2IA 1OF6A 2CLOA 5G4WA 2CU0A 5DELA 2BSLA 1K8YA 3A22A 4RZ4A 3W7HA 4GWEA 2FIQA 4JX5A 4IPIA 4IWWA 2Y85A 1AK5A 3KFTA 4I7VA 3W7GA 4M5PA 1A50A 4UTWC 2I1OA 3L0GA 5AYXA 2CLMA 3UWUA 2Z6IA 5D2XA 1TV5A 1HTIA 2WSQA 4EVZA 2C13A 1Q6LA 3FIGA 5U7SA 3SSJA 3AO0A 2YR1A 1P4CA 3NPWA 1Q3NA 5AHMA 4FX7A 4O57A 2VENA 4LWWA 4S2BA 2NLIA 3T4CA 3W1LA 3B0VC 2V0TA 4NXKA 1P0NA 1SZEA 4X3ZA 5C6MA 4Z1AA 2AQWA 4Z1BA 4ALDA 3QQ0A 2ZRWA 1UBSA 2PE4A 3NL6A 3NPVA 3VKJA 3LTPA 5AHNA 3W23A 5I3GA 4ORMA 4AWSA 4IQLA 2CW6A 4X9SA 3M1ZA 4Z1CA 3DENA 4E2DA 3IIZA 1QWGA 5KZEA 4AXKA 1K7EA 4FNSA 2CWNA 1SFJA 3I65A 3E02A 4IMDA 3MYPA 3QSRA 5F4SA 1EP1A 4FNTA 1KM6A 5FF7A 1OX5A 3NO5A 3W7NA 1YTDA 1XDMA 1OVDA 3PUDA 1F7BA 1OK6A 2VELA 4FHAA 4MKNA 2X2GA 3W75A 1QO2A 4K37A 1HL2A 5FESA 1KLZA 4FNQA 3B06A 3BG5A 2E77A 2QR6A 2OT0A 4O1AA 1XBZA 2TYSA 3WK3A 3W85A 3ABOA 3G0UA 1SW3A 5SWUA 5FEPA 1GZGA 4JTHA 1CI1A 4FNUA 1N55A 3BW4A 1B9BA 3GKAA 3QMSA 4JTTA 3EB2A 2GVLA 3S1UA 3W76A 4Q4KA 3WJZA 4XKYA 3FKKA 3HGSA 4DXVA 3G0XA 1D3HA 3C0JA 4HKPA 1EP3A 4XZ9A 1QPQA 4M6VA 1TJPA 1YXDA 2QKFA 2QDHA 4DBEA 2GVGA 3W87A 2V9DA 3W7OA 4M6QA 5FEZA 2PURA 2ZA1A 4JTSA 2XFWA 3IGUA 2CLIA 5HNRA 1NF7A 3MI2A 1GVRA 2Q3OA 3HGOA 1M7OA 4GRSA 1JVNA 3OBKA 4PFMA 4DF1A 2RHGA 3PG8A 4M19A 1VS1A 1XL9A 4OGZA 3VNDA 5D02A 1KM5A 1MEWA 4AHQA 2CFFA 1XI3A 4IMCA 4RCXA 3M0ZA 2WO5A 2QJIA 5FF2A 3GYEA 3LHTA 2RH9A 3U6WA 4K8HA 1LM1A 5D09A 2P10A 2B7PA 1TREA 4A29A 3FFSA 4RJEA 3LGEA 1GJPA 1AL8A 1EB3A 3TAOA 2WNZA 1R2RA 4Y8FA 1X7FA 4JYEA 4HNNA 4IOTA 1XBXA 2WSYA 4CQ9A 2QUUA 1WOAA 1UUOA 5AFDA 3W73A 2DZSA 5DN1A 3W84A 1LOLA 3IVTA 4DO4A 4JTKA 4MZ1A 3BLIA 3GZ3A 3W7CA 2PRMA 2YCEA 3LBMA 5D33A 4UTTC 4CNNA 1U5JA 1EA0A 2E68A 1EX5A 3M6YA 3IGXA 1BEUA 1FWRA 8TIMA 3NG3A 4GUIA 3P60A 3ZWTA 3S8HA 2IQTA 2GPTA 2A6LA 3L68A 4OQVA 3R89A 3DAQA 3W7RA 2V2CA 2ZA3A 4BR1A 1QDSA 4KFPA 4PTNA 4C1KA 3I68A 2NV2A 2H3BA 2Z6JA 3EX2A 3NQGA 4NNCA 4IMGA 1Z44A 4MLRA 2ATMA 1FCBA 1H61A 4GUHA 2ZRYA 4JD4A 5A8GA 4ZZ9A 2DZTA 3SJ3A 3SZ8A 3I6RA 4TO8A 3N2XA 3ABSA 1O95A 1VYPX 3GKFA 1LBLA 1YDNA 4YMZA 1C29A 4EWND 3UWQA 1RD5A 1I45A 1K8XA 4M7TA 2FPYA 3HQ1A 4MUZA 4N02A 4UFKA 1T8XA 3IVUA 1R46A 1BTMA 4ZL1A 1VHCA 3QPZA 3UWVA 2YW3A 4MY9A 2YZRA 3LRMA 2BXVA 3I7RA 3QRHA 1KA9F 2JKEA 3EWYA 1DQWA 2A21A 2V2DA 4GE8A 3GLCA 3QSTA 4WOQA 4K36A 3LOTA 3T78A 3QM3A 3NQCA 5AYZA 2ATSA 3MUXA 1OABA 4AB4A 4O4VA 5LNRA 4PL2A 1SO3A 4BF9A 1YPFA 1SSDA 3R2GA 3B4UA 3IGSA 4DPPA 3ZFHA 1K7XA 1RR2A 3DI1A 1WAUA 4WOZA 4UTWA 2E6YA 2ABAA 4RV8A 3W6YA 7TIMA 3W1QA 1I2PA 4UR8A 2I9EA 4MYXA 1IXPA 1ZAIA 4MZYA 2QF7A 1W3TA 1TPWA 2WPBA 3LCFA 2ISWA 3TUUA 3G3DA 2YGYA 3S0CA 1VCFA 4XTIA 1MO0A 2BWGA 3W1TA 1QMLA 1PCKA 3MHFA 4KWVA 5E0KA 3L2IA 3GAYA 1TMHA 5DLCA 5K3VA 4AVFA 5LNUA 4FEZA 4JTUA 1ICPA 4P2VA 1PHWA 5AC6A 1A53A 3SGUA 1A5BA 1H62A 1B57A 1Y0EA 2HSAA 3UXAA 3QQ1A 1EEPA 2VXNA 5KZDA 3PB0A 2VEIA 5DCDA 3GX9A 3PVFA 5TBOA 1KTCA 2AAMA 2DJXA 3S9YA 2QCHA 3CC1A 3TIMA 3KHJA 1EWEA 1DHPA 3GR7A 5HWMA 1TRDA 2A0NA 4MLJA 2GQ9A 5DCBA 2ZZ5A 3JR2A 1VJIA 3L0KA 4RKAA 5K7JA 1NSJA 4JGDA 5AB3A 4MPQA 1VRDA 3STCA 1SFLA 1I4NA 2XN0A 1FDZA 1W5PA 2KZHA 3W7LA 3HG4A 4CQ8A 1OJXA 4X2RA 4UXDA 4ADSA 3MO7A 4NJKA 1J4EA 1F76A 2ABBA 3DFTA 1EUAA 5K9XA 3S1WA 2ZDRA 4NJGA 4O1BA 1VPXA 5LHFA 4RLIA 3O6YX 1Q6OA 1CW2A 2J27A 2E5CA 4JDBA 2CLLA 3QMTA 3W22A 4E38A 3W83A 1JCXA 5K4ZA 3USBA 1FQ0A 4LNYA 5KMYA 1JR1A 3WK2A 1O60A 3U8GA 2PC4A 3LCXA 3OVQA 4MVAA 2C16A 5HULA 1KBIA 4NNBA 2X16A 3G1HA 1X1ZA 1D3GA 3A23A 4H3DA 2OMAA 3P8JA 1VHNA 2X30A 4ZQCA 5D2YA 3NPUA 2HTMA 1QOPA 4AEOA 1SPQA 3CWOX 1KM0A 4UFJA 1J5TA 2FLIA 5HQEA 3GK0A 3RFAA 5D37A 5CZJA 4O13A 1KV8A 3TW7A 1KM1A 1WDWA 3DZ1A 5H2ZA 1I2NA 2TRSA 1TPUA 5EBUA 4ORIA 3IEBA 3BLEA 4JDYA 4WY0A 1JCYA 1OFDA 3MYOA 4GNJA 3P61A 1JCJA 3W1UA 2OT1A 1K03A 3VI2A 1MEHA 1S5TA 4UTTA 1OFEA 1SO6A 1B4EA 3TDFA 5L9FA 4O12A 1W0MA 3TMQA 2X1SA 3GDTA 2EGZA 4JIQA 1DL3A 1TPC1 1H1YA 4GBUA 2FQIA 1YTEA 3P8IA 3O1NA 2E1DA 3C61A 4FF7A 3NQEA 3W7JA 2Z0IA 2A85A 3R8RA 1HO4A 3OEXA 3UWYA 2Y7GA 3LHZA 2Q8LA 1H60A 3W1MA 1OFQA 1A5CA 3NAVA 3TH6A 3VE7A 2B7NA 1W37A 3GDKA 3D0CA 3NR0A 3EWZA 3VCRA 1GVFA 4TR9A 1WOBA 5FI8A 3NL5A 2WNQA 4MFEA 4Y9AA 2AGKA 1W5NA 1D9EA 2VOMA 2B7OA 4NJIA 4E2BA 3L67A 1R2SA 4UNKA 3G18A 1R2TA 3W88A 5HR7A 2J9XA 1J2WA 4N9CA 3W70A 3CU2A 1LP6A 4FNPA 3LCGA 5CKSA 1ZNNA 1XBYA 3MP4A 5TIMA 2QJGA 4BWLC 4IXHA 3KRUA 3BK0A 2YXGA 3S6DA 1GYNA 1YLVA 5KTLA 3TQVA 2Y70A 2ZZ6A 1RZMA 2X1TA 3F03K 4JY9A 1V7YA 3P74A 4LVBA 1I2QA 3MHUA 1YTKA 1F5ZA 1OG0A 3I7QA 2Y62A 3M44A 4JTLA 1TTPA 4MY1A 4AMAA 3EX3A 3GR8A 1PV8A 3R13A 3KVJA 1TSIA 3TSMA 3P81A 4O19A 3C8FA 2Z1BA 2V5BA 1ZY9A 1IXNA 1RQHA 2ZTKA 1W5OA 4BI7A 3U2OA 2Y61A 4M6PA 4O10A 2ISSA 1OFOA 3PG9A 3EKZA 2QCDB 4LT9A 3O07A 4MJMA 1OX4A 3L65A 3PS7A 1FX6A 1KBJA 1M7PA 3FJLA 5FF4A 3W9ZA 1P5BA 2P1FA 3GNNA 4NVTA 3L5LA 1GVOA 2ZCGA 4MZ8A 1JCMP 2DP3A 3KRSA 4PH6A 1EPXA 3HOJA 5E93A 4I7UA 2JGYA 4DO6A 5D2TA 3BW2A 3KRZA 3QW3A 4N9BA 3W7QA 1Q45A 1BKSA 5FEXA 4I9AA 3DBPA 5DBUA 1QPNA 5G5IA 2Y88A 3VE9A 1GVQA 1GOXA 2VEMA 1JRBA 2ZFAA 5AHIA 3IVSA 5G2HA 1JQXA 4WXYA 1KFLA 2R14A 3C2RA 5D2WA 1GQNA 4RXFA 1FWTA 1TTIA 3STFA 4QSHA 3DKJA 2D73A 2C6QA 2OX1A 3O16A 4O52A 4PEKA 5AOUA 2GUUA 1SSGA 4U28A 3LHWA 5EYWA 4YWIA 1VYRA 2J88A 4C1LA 4MJZA 4NU7A 2DZPA 1X6UA 5F2LA 3BG9A 1A5SA 1G4TA 1PL9A 3W72A 1GTHA 1ZJIA 1SZGA 4HSNA 3CM4A 1G4EA 2QAFA 3OHIA 4EF8A 1KLYA 2ZBTA 3KVMA 3W7IA 3B8DA 3WK1A 4DPQA 2NUXA 3OVPA 1XKYA 1GG1A 3EEGA 2WOQA 3W7DA 4LS0A 4IJBA 1RV8A 4LTSA 5F1UA 2C14A 5FF3A 3M9YA 4GC4A 1UCWA 4YLWA 3G1XA 4HIBA 4JICA 1V5XA 3GIYA 3SR7A 3F4WA 3BW3A 3G1YA 1W56A 3UY8A 3S5NA 5E1QA 2EHHA 4QITA 4Z1DA 1OFRA 1LRNA 3T7VA 3W74A 1LLZA 2YYUA 5DY3A 5LHEA 4UFMA 4O54A 1TV7A 3BGJA 3GDLA 6ALDA 4O50A 4QAIA 3W71A 4ML9A 2J9ZA 3N9RA 2GQ8A 4TU1A 4O8RA 1LRQA 2YFOA 4O15A 3N3MA 2QCDA 3G1SA 1ONRA 1TRIA 3NQ8A 3CLMA 5HJLA 5C2XA 3E9AA 3LX9A 1ALDA 1QPRA 4UTLA 1DV7A 4O1DA 3LB0A 4IPJA 4D2JA 3L9CA 1QOQA 1TPH1 4HNTA 1TYGA 4N9EA 2WQPA 3G8RA 1SO4A 4O28A 1JCNA 3HO8A 4UTMA 2NUWA 4ZQOA 2RDTA 3UWWA 3TROA 1UB3A 3EWBX 1Q6RA 1WBJA 1TPEA 3TW6A 3W1NA 4RZ6A 1QNVA 4U4MA 4UFIA 1W1ZA 1AW1A 1QFEA 3G1FA 3P7YA 2G5WA 3B0UX 2H6RA 3LCWA 4FIQA 3HIJA 4LW7A 1TPB1 2V8ZA 4UIOA 4QJ1A 2A1YA 4RK8A 4POCA 5LKYA 1H7OA 1W5MA 1KM2A 4JTGA 2UV8G 3NQMA 3Q2DA 4QQ3A 3L5MA 3LCLA 1VLIA 1Z41A 3L5AA 3HGJA 3UD6A 4UTJA 1G7VA 3MBDA 2NV1A 1WBHA 3UWZA 1LOSA 3LLFA 5BMWA 3BPWA 1HUVA 1LCOA 4BWLA 4HNUA 3EX1A 1XCFA 2VFHA 4UFHA 3WFAA 3Q37A 4NNAA 3S42A 5HUOA 2NX3A 2NXIA 4FXRA 3TSBA 1MXSA 5I3IA 3SECA 2YW4A 4DEFA 4O0ZA 2X1RA 3O8AA 5A5WA 3MMTA 5CPLA 3BARA 2VFDA 3WJWA 1VR6A 4I7WA 3W7MA 1ME8A 4WJEA 1DORA 3G8EA 3TQKA 1W8SA 4LVDA 1X8FA 4LV9A 4IXXA 3ZWSA 3EWXA 4DELA 4NT0A 3P80A 1F6PA 3PWAA 1KFJA 5I3JA 3QPYA 1FXQA 3S5ZA 4R34A 4WZHA 5EY5A 2WJZA 4JTIA 4G1KA 3HPSA 4O14A 1TCDA 1MEIA 2QCEA 3PSWA 4WY0B 4TMBA 3W2NA 1YDVA 1HO1A 2P0OA 2DJLA 4NJHA 4UTUA 3LHUA 1L6SA 1NVMA 3S5OA 5KINA 4AHPA 1KM4A 1SW7A 2ZRZA 3TXVA 3PY2A 3PBVA 3O6CA 4HPXA 3LV6A 2Q3RA 3P5YA 3UNDA 3BVJA 1W54A 1YYAA 1H50A 4N4PA 3NM3A 4UTHA 2GOUA 1O94A 3ZR4A 4IX2A 5D03A 1PVNA 3NQ7A 5CZSA 5AN7A 4OBTA 2NWRA 3NXFA 1TJRA 2EKCA 5H91A 2CLKA 5U4NA 3NQ2A 2Y7FA 3RLUA 4CNPA 5F2IA 3RMJA 1JRCA 2V81A 3TCEA 1RQBA 4K8EA 4O17A 1F05A 3TJXA 2GJNA 2YYTA 1EP2A 1S5VA 4JS3A 1GPWA 3MW7A 3OIXA 5D32A 3M16A 2VFGA 1P0KA 5G2WA 1ZCOA 3EWUA 1IIHA 3UYCA 3MWAA 1ZFJA 4MFDA 2DZWA 1XM3A 2C18A 1TIMA 4UC5A 3HG5A 5G1TA 5CG7A 1FCQA 4YCOA 5F1VA 3GXPA 4ZVJA 4DO5A 4QIUA 3W7EA 3FS2A 5CPMA 3SIZA 3TR2A 1KTNA 1TO3A 1KFKA 5CPNA 3UY7A 4HHPA 1X1OA 3EX6A 1WA3A 3W1RA 2H8ZA 4O53A 5LNSA 2EAWA 3WJYA 1M5WA 3DH7A 4LUJA 3W2KA 3NNTA 4YL2A 1DOSA 4GUFA 4JTFA 1F73A 2RFGA 2ZQ0A 4QM1A 4LRTA 3RU6A 5LZLA 3CHVA 3MP3A 4Z0SA 1K3UA 3O15A 3P84A 4PCFA 1UJPA 1LOQA 3MJYA 1OFAA 1WYIA 2QCMA 3MP5A 3INPA 3LXCA 3LDVA 2QUVA 2ZRVA 3H54A 3B05A 4RXGA 4XWUA 4ZQMA 3QC3A 1ICSA 5BW6A 1H63A 1W3NA 3T44A 4DF2A 1NFBA 4LC8A 3PUEA 4JIPA 1Z48A 2TPSA 4JX4A 3OVRA 4A22A 5HUPA 3CEPA 1OX4B 1PIIA 1M6JA 3CIXA 4JN6A 1AW2A 2JBMA 2DZXA 4S2CA 4XQ6A 2WV8A 1YXYA 2PCQA 4NUWA 4XTDA 4P61A 1ICQA 3W1XA 3ZS4A 1L6YA 1QCWA 2A7RA 3M47A 3FYPA 5LSMA 1GWJA 4X22A 1ADOA 3EXTA 3W2LA 4HNVA 5J5DA 3CPRA 3A5VA 4ONVA 3TA6A 1FCUA 3RK8A 1OYAA 2GVJA 3R5EA 3KXQA 2JKPA 2ZZ7A 5HR6A 3S5YA 2BLEA 1G69A 4ICNA 3K30A 3JRKA 2ZYFA 1FDJA 4ZMGA 3RNDA 4UMCA 1I2RA 1QAPA 2ZTJA 1C8VA 1W31A 5LGXA 4LRSA 2H90A 5D05A 1LORA 3HMJG 4ZQRA 1K02A 4XBSA 4A21A 4IMEA 2C15A 3O06A 3O05A 2FTPA 4B5NA 1ZHAA 4JNMA 3FEMA 3NDOA 1GTEA 3RLVA 3FOKA 4EF9A 2G96A 3C2FA 2A6NA 1DJQA 2HS8A 4JTEA 3CIWA 3LV5A 1LBMA 4FX6M 4DQWA 3VFLA 1FCVA 4O16A 4AWTA 3M5YA 4WQ6A 1EIXA 3LI1A 1LRTA 4ADTA 5DXYA 3NOEA 5EKYA 2WNNA 5EMUA 3UPWA 5D04C 1MZHA 3LERA 3UZJA 1FWNA 1YDOA 1SQ7A 2ISVA 3QF0A 5EL1A 1MSSA 3LRLA 3OG3A 4XBKA 1H51A 5MHBA 1OFPA 1H5YA 3KX6A 1TV8A 3LBCA 2FJKA 3BGGA 1LDCA 2ZRUA 3H55A 2A7PA 3NL2A 1VYSX 2NX9A 1C9DA 2EPHA 3T40A 1IXQA 3HF3A 3PR2A 4LOCA 1F2JA 1TPDA 1ZAHA 2YFNA 1YXCA 4O4WA 4K7YA 1JQVA 3GXNA 5AC7A 4QNWA 2JKAA 5KITA 1KV5A 4N2YA 2XN2A 1NEYA 2E09A 1PE1A 4YCPA 3TX9A 4S1FA 1OYBA 3NZRA 5LGZA 2H8XA 3ANYA 2QUTA 1T0OA 1TTQA 1TQXA 3P5ZA 1DKWA 2RDUA 3BG3A 3EXSA 2GQAA 1FUYA 4KFOA 3BV4A 3YPIA 3NYZA 3PUOA 4LVGA 4JXCA 1XUZA 3B0PA 3B03A 3TNOA 1G4SA 1T99A 4WUIA 1H7XA 4IMFA 5CZTA 4CLMA 3SGZA 1DJNA 2TSYA 3PBYA 1XDLA 3QFEA 4PA8A 4CQAA 5LNWA 2B0MA 1GVSA 2QJHA 5DCEA 3CTLA 5HWJA 4UTKA 4MOZA 2V82A 5J5RA 1OYCA 4M7SA 1VCVA 3HG3A 1ZAJA 4UR7A 3S1XA 4RR4A 4W9TA 2NUYA 5DBTA 3BO9A 3TKFA 2NZLA 3V1PA 3THQA 5IBXA 3EKLA 5EPDA 2BTMA 1JUEA 1CX9A 4O11A 3NQVA 4NZFA 1ZALA 5CZ0A 3STGA 1YPIA 2DORA 3M5XA 4JYDA 2C0AA 4ADUA 1R30A 5CGQA 2VFEA 3SY5A 4J9JA 5AHLA 3DFNA 1FBAA 2BX7A 3DXIA 3F1QA 3T55A 3MI3A 2YPIA 2TMDA 4O0KA 2DZVA 4K6AA 1L2UA 2CZEA 5F2MA 1JUBA 2Y7EA 4R53A 1TTJA 5F4WA 5T26A 1XUUA 2QAPA 2X1UA 3GB6A 4JR5A 2G97A 3QJAA 3PC0A 4JX6A 1H7RA 3C52A 4CCDA 1JJKA 3CQ0A 4PC8A 5BMXA 1ML1A 1GT8A 2YX0A 3GDMA 4LVFA 4YXGA 2WSRA 4UTIA 2A4AA 1LBFA 5GVJA 4OWGA 1Z42A 3TV8A 3TMLA 5K2ZA 4QNEA 1KFBA 2W6RA 1GG0A 1KW1A 3TC6A 5ABTA 4UMAA 4LVAA 4MY8A 3G0SA 1VGAA 3M5ZA 3ABQA 3WK0A 4GFSA 3TXZA 3DHDA 4Y6GA 1BWLA 3A9IA 1EWDA 5AC8A 1AG1O 1PHQA 2J24A 3IIXA 5I3KA 5L6UA 2QCGA 3W2MA 3IV3A 1XXXA 1XFBA 3ABRA 5F4XA 4DBDA 3FJ6A 3TJLA 3QH2A 4A3UA 3KVLA 4KKXA 3LXBA 3C3NA 3P62A 3M43A 4BFAA 4XUGA 4TIMA 3A21A 1T96A 2J9YA 4MIMA 4EIVA 1ME7A 1Q6QA 3LHVA 2FPVA 4O1CA 4LUIA 4H4IA 5I3FA 4Q32A 1QPOA 2A2IA 3DGRA 3NPXA 3ELFA 1H1ZA 5TQLA 2QCFA 5FF0A 3TFCA 1PCWA 1UASA 4WD0A 3G3MA 4AHOA 3C2EA 4N6FA 3QZEA 1L9WA 4GXMA 4R33A 1NF0A 4TX9A 3NL3A 2JK2A 2O7SA 3N14A 5DXXA 4FIRA 3G1DA 4L4LA 3H53A 1RQEA 2OZ0A 3DFOA 4GJ1A 2FB2A 3W3OA 1KTBA 4CCEA 3TAKA 2V5LA 4GUJA 2O7QA 1OF8A 4NZJA 4QISA 3TFXA 4IUOA 3C56A 4KWWA 1WQ5A 3NM1A 4H6KA 3P82A 5D30A 3G1AA 3PBWA 1O5XA 2GJLA 4E0CA 1BWKA 2FPTA 1VH7A 3IIPA 3LHYA 3C4UA 4N9DA 4PL1A 2A5HA 3SW6A 3QMRA 4HSOA 2B7QA 4GUGA 1VCGA 4NJJA 3EX4A 4NX5A 4KFNA 2C19A 1AMKA 1ME9A 3P67A 3BLFA 1N7KA 1A5AA 3UQNA 3THAA 3W2UA 4DF0A 3EXRA 2DZUA 3MI6A 3GAKA 4Y96A 4K39A 1K7FA 2HS6A 1JULA 1DQXA 1AL7A 2WKJA 3W07A 3HPXA 2OCZA 3GDRA 5CSSA 3WJSA 4AF0B 3TC7A 2F7FA 3HJZA 3PB2A 1LROA 2NWSA 4UMBA 4AAJA 3HGRA 1G4PA 2ZRXA 3OA3A 4FX8A 5G4EA 1B3OA 1OK4A 3DHFA 3W7KA 4OV4A 3HG2A 1XBVA 4L4MA 3E96A 3M5VA 1WX0A 2QCNA 1FWSA 3LCIA 3R12A 4JYFA 3SFKA 5I3HA 3DFPA 3PAJA 2ZZ3A 2EF9A 4K7VA 5D2VA 5G1YA 4NQ1A 4NXSA 3V75A 2J6XA 5KSWA 1LLWA 2XN1A 4Z0JA 1UUMA 2PRHA 4JY8A 1IXOA 3G1VA 1W3IA 2ZZ1A 4OV9A 1WV2A 3NA8A 2QCLA 5AHFA 4JEQA 4BK9A 5BNKA 2Z2UA 4BI6A 2FB3A 3NZ1A 3A5FA 2E6FA 1QO5A 2V30A 3B04A 3IIOA 3G22A 1ZENA 1FWWA 1OFBA 3TK7A 3UXDA 3LCHA 1O5KA 3M7WA 1VLWA 5BRBA 3TQ0A 3HB9A 3NQAA 4OT7A 3W1PA 2Y6ZA 4BI5A 2G95A 3S1VA 3E49A 2ZA2A 3NEVA 3A24A 5LNVA 3EWWA 2E5DA 4CNOA 3ATYA 4PODA 2CZFA 2E6DA 5IBXC 3UPBA 1VZWA 2CLEA 5EA9A 3IIVA 4IX0A 1F74A 2Y89A 5HINA 5HMSA 4K38A 3LTYA 3L66A 3KOFA 1IGSA 2CLHA 3DU0A 2RDWA 2CLFA 4MYAA 3QW4B 2CZDA 1JCLA 1SO5A 1NAL1 2RKXA 3TSDA 3KAOA 3WJXA 2A7NA 2QEZA 3N9SA 3PM6A 3C2VA 3LTSA 2VEPA 3NQDA 3HPZA 4IGHA 2F84A 2VFIA 4WX2A 1AW5A 1S3HA 4LV4A 4WY0F 4RZ5A 2E6AA 1QR7A 1N8FA 3N19B 4LU0A 2C1HA 2JGQA 4UUIA 3DKLA 2FDSA 1VC4A 4NX0A 4A2SA 5CPOA 4OE7A 1KFEA 3F4NA 5K9CA 5HWNA 1TPVA 5C54A 1G7UA 5KZMA 3L21A 3RF9A 1E51A 3DI0A 3N34A 3NQ6A 2NXHA 3JS3A 3L0NA 1KM3A
chains in the Genus database with same CATH superfamily
1UP0A 4JTAA 5CJNA 1XH0A 1HG3A 3RM8A 2I5GA 2WSKA 2OJPA 5A6KA 4Q6XA 4QLJA 1WKFA 3S6TA 1GEQA 1RJPA 4BEQA 4L1GA 3ZVHB 1L8NA 1U83A 3GHUA 1R86A 4J27A 4A2RA 2QDGA 1JUKA 2X05A 1MW2A 4H9YA 3M41A 4DM1A 1H1NA 3I7SA 3TU9A 4FNRA 2CZ5A 3POCA 5FJUA 1IF2A 5I09A 3LI0A 5I2UA 5BOOA 4C90A 3C0LA 4L5ZA 4FB7A 6TIMA 3N2MA 3FXYA 3MUIA 3A4WA 2YSWA 3QYQA 2R1MA 2P8BA 3CBWA 3LM7A 1VIZA 3ATZA 3HV8A 3VM5A 1UZDA 3DFQA 4IG2B 3KOYA 1YADA 1JCTA 4GYPC 3F4VA 2NLYA 2OQYA 2YDAA 1QPKA 3M07A 5D38A 1F6KA 1KXHA 1QW9A 1G5AA 3V35A 3GUGA 1K8ZA 3Q58A 1Q6EA 4DYEA 4MWAC 3PBUA 3RU8X 4W5UA 1YDYA 4XAYA 2WKGA 3CUGA 2Z4GA 1V0MA 4Y90A 3T42A 2MANA 4NG3A 4AH7A 3AJXA 4W93A 4ZO8A 1KFCA 3PF3A 3VMOA 3TWBA 1GOOA 3KTSA 3GW0A 2PDHA 3VYLA 4GG9A 3TZNA 3KZPA 5A94A 4PUNA 2OQHA 1RPXA 2INZA 3SI9A 3CUZA 5DMLA 4OHQA 3MDUA 5B7YA 4EOUA 1W5QA 4LY8A 1L6WA 3NQFA 5D9NA 2IQDA 3CT7A 4GK8A 3UVIA 1HQTA 1PS9A 4R7JA 3UZ5A 2B4GA 2VURA 3LLDA 4RNJA 1NOWA 1OF6A 2CLOA 1J79A 4AISA 4JN7A 4URIA 3KCLA 3I3EA 4DN1A 2V3DA 3OP2A 3R0KA 4RZ4A 1C8XA 3C0QA 2VX6A 3W7HA 1NWRA 3AHYA 7PTDA 3BLLA 4IPIA 4E4FA 5EB8A 4H01A 1WZAA 4GI9A 4L1WA 4M5PA 2QJJA 1UR0A 3L4YA 2YL9A 2RJHA 1TWDA 3L0GA 5T8GA 3UWUA 5D2XA 1TV5A 4AZBA 2PDXA 1HTIA 2Y8VA 3IJ7A 1YX1A 2C13A 1Q6LA 4US6A 1K4HA 3W02A 5D9MA 2W27A 4FX7A 4IT1A 3EOEA 4RPPA 4MWAB 4QCFA 4TTUA 4GIYA 2V0TA 3E5PA 1P0NA 4X3ZA 3UZWA 4D71A 1BSIA 4N0RA 4Z1AA 1LT8A 4IHCA 3QPEA 2AAAA 4DJDA 3PJTA 4Z2JA 1EQCA 4OJYA 4D6DA 4H8HA 3T2PA 1GPFA 3DYPA 4DWSC 4E2DA 2VX4A 2XGBA 1SFJA 2WMIA 2J47A 4IJCA 3MYPA 2VZOA 1AA1B 3Q67A 4MWAD 4FNTA 1KM6A 5CAHA 5FF7A 1K1DA 3W7NA 1YTDA 2O55A 4GIAA 2X2GA 5ABFA 2QS8A 1HL2A 1XBZA 5SWUA 2YB4A 3WO8A 3GXDA 4ZB5A 2WVVA 3QMSA 1OZQA 3WJZA 3N18A 4DXVA 1D7KA 2WHMA 3VKCA 1UQZA 1JGIA 3EBVA 4M6VA 1YXDA 1WAWA 2GGIA 2QDHA 3QKZA 1VBUA 1IE7C 3VGHA 2HROA 2PURA 5IDIA 4BJHA 2YLAA 2CLIA 2ZX9A 5HNRA 3MI2A 1DWFM 2Q3OA 4CD5A 1GHSA 1M7OA 1JVNA 2PDBA 3OBKA 2GLKA 2RHGA 3DCPA 3Q65A 4W8AA 3VNDA 5D02A 4EANA 7REQB 5GNZA 2CFFA 3QY6A 1BHGA 3N04A 1G94A 2WO5A 4PMDA 3TLQA 4M29A 2P10A 3KL0A 4LXFA 1ONWA 2YLLA 1EB3A 3DDMA 3E38A 4KH2A 4MDOA 4HNNA 2IXVA 3QN3A 1LUCB 4CQ9A 1EHNA 1JNDA 2NQ5A 1WOAA 1VFTA 1UUOA 3GBDA 1S38A 4HTBA 1LOLA 3IVTA 2WZIA 3A3HA 4JTKA 3CHCA 2XIMA 3NSMA 1UWAA 1PDZA 3K8MA 4DWSB 1EJRC 5D33A 1PTGA 3R25A 1U5JA 2INFA 1EA0A 1OCBA 4ATWA 1BEUA 3DG7A 1FWRA 1WPCA 2AKMA 3WH5A 8TIMA 2ZUVA 3W4RA 3NG3A 2E4TA 3P60A 3NIYA 2BVYA 3GH4A 2J8GA 4OQVA 4BR1A 4KFPA 4PTNA 4C1KA 2G3JA 2FTYA 4ZFMA 4IMGA 1QT1A 2ATMA 1CB2A 3AS0A 5A8MA 2B81A 2DZTA 4DWSD 1ZJAA 3BLDA 3N2XA 1O95A 1VYPX 2NVAA 3GKFA 2Y24A 2G8ZA 2Z2AA 4EWND 2EQDA 4CQDA 2ACSA 4MHBA 3TTQA 2YL8A 3CUJA 1JF6A 4BS0A 4OBSA 2YZRA 2BXVA 2IXUA 4XV0A 5C70A 3F5KA 2OO6A 3EWYA 2A21A 1E6QM 5HBFA 1M01A 3CNYA 4XIMA 3QM3A 3NQCA 3N15A 3UG5A 4AB4A 1SO3A 4Q7IA 3VKKA 3T1GA 3R2GA 3CL7A 1K7XA 3ARVA 3SRHA 1RR2A 3DI1A 2HDJA 3BMXA 2XINA 4S3BA 4UTWA 2YB1A 3AS1A 2PU1A 1UWQA 3W26A 3BZGA 3R6IA 1W3TA 2PTWA 1TMQA 1TPWA 2J7CA 2YGYA 4XTIA 3W1TA 1GQLA 1Q6DA 5I5RA 2BP1A 3MHFA 1WB0A 1W3HA 3PNZA 4GINA 5LNUA 1ICPA 4PUEA 1PHWA 5AC6A 5BCAA 1VIWA 3SGUA 1UHVA 1UC5A 1H62A 1B57A 1Y0EA 1EEPA 4WRHA 3RCMA 2VXNA 3AALA 2QUNA 5KZDA 2VEIA 3PPHA 3FJ4A 3WSUA 4KEVA 1KTCA 2QCHA 3KHJA 3BLOA 4EACA 1KBKA 2HVMA 4I5UA 3GQYA 1AFSA 2UY2A 1K9FA 4RKAA 5AB3A 4MPQA 1SFLA 5KEZA 1R0MA 3VNIA 4HZ6A 1QHZA 2XN0A 1W5PA 3W7LA 1GKQA 2QDEA 1XJBA 4UXDA 2WPGA 4NJKA 4GH1A 2ODOA 4NJGA 3RILA 4OTKA 3AU2A 1P6WA 3RX4A 1KRCC 2FFIA 2YOCA 3WNLA 4IFKB 3RLHA 1PX3A 4UBPC 2WMHA 1XLLA 3GVQA 2ZVIA 4Q3MA 3H4WA 1JR1A 1U22A 4D6FA 2PZNA 2E9LA 3U8GA 2V5DA 1X1ZA 3VX0A 4LNCA 4B9YA 4I6KA 2X30A 3NPUA 3WDJA 2WZEA 3RN6A 2PDKA 3F2DA 4LYQA 5REQB 1M65A 3KE0A 3WQOA 4HOWA 3GK0A 1TFVA 1KV8A 5ENLA 2IPGA 1KM1A 1FP9A 3DZ1A 4ORIA 4ERIA 1KQYA 3SIMA 1B9ZA 3UT0A 1HF6A 5C2CA 2OT1A 1K03A 3WZ0E 2CYGA 5DQPA 1E4LA 1B4EA 3TDFA 1XG4A 3WD3A 1W0MA 2Z1KA 3TMQA 3FX4A 3UZYA 3GDTA 1DL3A 1TPC1 1PTDA 1POJA 5HOSA 3U2EA 1K9EA 1EOKA 3MVTA 1GOMA 3NQEA 2Z0IA 3W81A 3OEXA 4QJ3B 3UWYA 2Y7GA 2Y1HA 4DJDD 4PUKA 1DIOA 2WHKA 3WQDA 1XLHA 3VC6A 3NR0A 4TTGA 3EWZA 3VILA 3O7UA 2NQLA 2WNQA 3WLHA 2FDMA 4J3XA 3ALGA 4NJIA 3CUXA 3L67A 1MZRA 3PJWA 1CECA 3T8QA 3G18A 1XYZA 4I5RA 5HR7A 3OW1A 2W62A 3CU2A 1PSCA 4HA4A 3AOFA 3MP4A 5TIMA 4AW7A 1HKVA 2Z29A 4DM2A 5LXXA 4EAMA 3BK0A 1QOXA 4GJJA 1RZMA 2HJPA 1K9DA 2X1TA 1I2QA 1IT0A 1F5ZA 1HKMA 3I7QA 3M44A 4A3QA 1S2UA 4MY1A 1PPIA 3K5XA 4CUCA 1OC5A 3PPGA 4O19A 3L4UA 2GDVA 2ZUWA 3PPCA 2PBOA 1N8WA 4PUUA 1HVQA 4O10A 1OFOA 1GOWA 4FA3A 4DZHA 3EKZA 3GTNA 4JTRA 4LT9A 4MADA 4ML4A 5B80A 2VEFA 5C2GA 1Y65A 2EG7A 1KO0A 2YZ5A 3KS6A 1KBJA 5FF4A 4C60A 4BY3A 2ZCGA 4QEEA 3U0HA 3VA8A 1JCMP 2DP3A 3KRSA 4D1JA 1EPXA 3RCNA 4QG9A 2ZUTA 3IK4A 3WD0A 5KZ6A 4A6GA 4DO6A 3KBJA 3VDHA 3SUSA 4IP4A 5D2TA 3A3WA 3QW3A 3WDHA 5D8ZA 1Q45A 1R5YA 4RNHA 1QPNA 5G5IA 2BODX 2CKRA 1GOXA 2VEMA 1JRBA 2ZFAA 3NURA 5AHIA 2DIJA 2EBNA 3NQBA 3C2RA 4IL0A 1PJ9A 1FWTA 3C3UA 4W86A 1JD9A 4O52A 4DJEC 4HNOA 2GUUA 3BMVA 2XU2A 4HTYA 1EDQA 4HMCA 3V0SA 4YWIA 1VYRA 2A3BA 4MJZA 3UXLA 1X6UA 4GYFA 4IFRA 4V2XA 3USZA 2A79A 1OQFA 4KPLA 3KBNA 1PL9A 2J7FA 1GTHA 1E6ZA 1SZGA 1G4EA 4NAEA 4ACZA 1KLYA 3KVMA 3FHQA 4C6LA 4TX8A 3WK1A 1U1UA 1OBAA 2XFRA 1EBHA 3TYAA 3WQ8A 3KRBA 4LTSA 4AX6A 4Q7NA 1H49A 3URQA 4GGHA 4YLWA 3G1XA 4HIBA 3LA4A 3VNZA 3T2OA 3URNA 3FVDA 3UY8A 2FZMA 3BL3A 2R1LA 3S5NA 1A3XA 2EHHA 1QI3A 4QITA 3BCJA 3ZYZA 1KC7A 3T7VA 3K8KA 1PZ3A 4CKQA 4AZCB 1T6MA 1LLZA 5T9CE 5DY3A 1EGZA 1GVIA 3BGJA 3MU7A 3GDLA 4UWMA 6ALDA 1F8MA 5FJTA 2J9ZA 4XZIA 4LAKA 4TU1A 4O8RA 1LRQA 4P8WA 2C91A 1NDVA 1ALDA 5FAJA 1DV7A 1US2A 4GPNA 3L9CA 1ZB5A 4RDZA 4HJFA 1JDAA 2DPEA 3R0DA 4IICA 1UKOA 2PLJA 3VMPA 3GO2A 4UTMA 1FHLA 3UWWA 3BQ6A 3UGRA 3W1NA 3TWAA 3W82A 1QNVA 5I03A 4H7CA 4UQDA 3GS6A 1XQLA 4MNMA 1JDEA 1BXBA 1QFEA 1D7FA 5JH2A 3P7YA 4F2TA 1REQA 4WKFA 2V8ZA 4QJ1A 4HZ7A 2QW5A 3A12A 4RK8A 5HNTA 5HPOA 3UZXA 4WDTA 2UV8G 3Q2DA 1RALA 5M03A 3LCLA 3IJ8A 3K1GA 4JCMA 2G3NA 4DJED 4J3WA 3AS3A 3BSGA 1HUVA 3MVIA 4BWLA 3EX1A 2FZ9A 1XCFA 1NJJA 2OWCA 4NNAA 4H9XA 4PGLA 5EMMA 3VNJA 4JNZA 4O0ZA 4MSSA 1UP3A 1E6RA 5A5WA 3MMTA 5CPLA 1A0DA 4I7WA 2ASHA 3ZWSA 4AG0A 2YCKX 4DELA 5FOOA 3P80A 5C9RA 1KGXA 3PBGA 3VU2A 4WZHA 4N7QA 3DIPA 5EY5A 1QXLA 2WJZA 3IK2A 3IUDA 4YNGA 2J7HA 3N6HA 4O14A 4QCEA 4TMBA 3W2NA 5HA7A 1Q2RA 2P0OA 4NJHA 3FEQA 1M68A 1NVMA 1KCXA 4CN6A 4MB5A 1XLAA 3NOYA 3V16A 3M0MA 3TXVA 3HFYA 3PBVA 4HPXA 2OOGA 3LV6A 3UNDA 5A2BA 3WLLA 3GTXA 4XSMA 3ZR4A 4IX2A 3IJQA 3NQ7A 4OBTA 3NXFA 3G5EA 1TJRA 1TX0A 3ZJKA 2VZTA 4R5EA 2Y7FA 1AH4A 4PZVA 5F2IA 5JIWA 2GUBA 1JRCA 5A2AA 1JAKA 3TCEA 8XIMA 5MF5A 1F05A 3TJXA 2GJNA 5BZAA 1EP2A 4JS3A 3AIBA 2VFGA 1P0KA 1ZCOA 3D3FA 3E2RA 2HV5A 2C18A 1R3TA 3UESA 3GM8A 3HG5A 3ZJ7A 5DMYA 1FCQA 4YCOA 5F1VA 4AD4A 2BV9A 3WQCA 4XVDA 3ZT5A 1Q85A 1KTNA 1TO3A 3VOFA 1KFKA 4XB3A 2PU0A 3GG8A 3UY7A 3HU7A 2DH3A 3LZ3A 4O53A 5LXEA 3ALFA 4LUJA 5FJJA 4XK2A 1DOSA 4WKAA 4E5TA 4QM1A 3CHVA 1K3UA 3O15A 1GVYA 3VNMA 3UG8A 1LOQA 3MJYA 4K2SA 2W3ZA 2GSEA 3MP5A 1F3EA 3ARXA 3LXCA 4I8YA 1UR2A 4RXGA 4CQBA 4ERAA 5BW6A 2E28A 3RPMA 4GNVA 1J0KA 4DF2A 3LD5A 1NFBA 4LC8A 4GI8A 1QBAA 4FPSA 1E4MM 2FZ8A 4JIPA 3R8HA 3UFYA 3OVRA 4GIEA 4XAZA 4JN6A 1AW2A 2QZRA 2PCQA 3QLLA 4HOZA 2QPSA 4P61A 1JZ7A 4V33A 4LCQA 5CQ1A 4QG6A 4DAIA 4X22A 5BXTA 4XZBA 4D9PA 4HNVA 4DNMA 2YBUA 4S3KA 3UWEA 3DN5A 1JZ5A 2BGQA 3A5VA 2PUZA 3OTRA 4F0RA 4B90A 2QLYA 4KQNA 5HR6A 4DB7A 4Q8WA 2BLEA 3RNDA 2VRKA 1QAPA 1I2RA 4JTDA 3BANA 1W31A 3BAJA 2YBTA 3IPWA 1L6GA 5D05A 3HFTA 3HMJG 4L61A 5A8OA 1MW3A 3O06A 3O05A 3WNNA 1ZHAA 4JNMA 1WZMA 3FEMA 2JQXA 1GTEA 4AD1A 4H9ZA 2G96A 1EOMA 2A6NA 3LV5A 3AIUA 4DQWA 1HJUA 4XKMA 4NAEB 1FCVA 3VDBA 1JYWA 2WJFA 3HURA 4H7ZA 4WDWA 1EDGA 3R94A 4ADTA 5DXYA 3NOEA 1DE6A 5EMKA 3LERA 3VDAA 5I23A 3C5QA 1GK8A 1UZHA 2ISVA 3H2AA 1MSSA 3LRLA 4CN4A 3ISIX 1NQKA 1O68A 1H5YA 1TV8A 1OSEA 3BGGA 4HP5A 1ISYA 2X0YA 3PTQA 1HL9A 2A7PA 3B9EA 3NL2A 3TTEA 1C9DA 2YDQA 3U7BA 4GH3A 4B5UA 2OZTA 9CGTA 3VGFA 3MZ2A 1F2JA 1AH0A 1QJWA 2HE5A 3LMYA 3LG3A 2XN2A 4YWSA 1PE1A 1V02E 2CC0A 3TX9A 1OYBA 5LGZA 2H8XA 2ZX7A 2VP8A 1T0OA 3VABA 4KFOA 4ENLA 3NYZA 4FXFA 1UD4A 4JXCA 3B0PA 1A80A 2H9AA 2Z24A 3GXFA 3H12A 4RDVA 4CQAA 1M7JA 2Q6ZA 1I9CB 2OO0A 3CTLA 3PFRA 4UTKA 1Q7QA 3AICA 1QI4A 1OYCA 1VCVA 3HG3A 4UR7A 3S1XA 2ICSA 1PKMA 2NUYA 3BO9A 4OBRA 3TKFA 4B91A 2NZLA 1WZLA 3V1PA 3THQA 5IBXA 4Q8OA 3WNOA 3OPSA 3E2VA 2BTMA 5C9ZA 4JIIX 1NIUA 3R8GA 4GLEA 1R7OA 3R43A 5CZ0A 3H2EA 2DORA 4S3FA 1ITQA 4JYDA 4HPHA 1M41A 4GX8A 2D20A 4QDWA 4J9JA 5AHLA 3DG6A 1FBAA 4XZMX 3EPNA 3TLLA 3PZGA 3T55A 3XIMA 1XLKA 2YPIA 4P8VA 2QVHA 2WZHA 2DZVA 2CZEA 1UZ1A 1OG6A 3HM7A 4R53A 1XUUA 2YCLA 3WH8A 2WCGA 4JR5A 1C8QA 3QJAA 3PC0A 1H7RA 4CCDA 1JJKA 2P0IA 5AVHA 3QLDA 4YXGA 3ZXWA 1LBFA 5GVJA 3TV8A 1EZ2A 1E55A 2QDDA 1GG0A 4DJFC 4UMAA 3KBSA 1IZKA 1VGAA 4JFVA 2GYIA 4GFSA 4C5ZA 3A9IA 1EWDA 1ZP3A 1OT2A 3VDGA 1GZJA 2VI0A 2QCGA 3LYEA 3OYXA 3W2MA 1ITXA 1EJXC 1XXXA 1HNYA 3ABRA 1E0TA 3ZT7A 1I1WA 4G5DA 4KKXA 3P62A 3M43A 2E8YA 1V8EA 3LZ5A 4CEXC 3ABXA 1Z6KA 4B5SA 1HJVA 4RW3A 1Q6QA 4AD2A 3K4AA 4H8NA 3GHRA 2J79A 3RIKA 4LCSA 3W28A 1VBRA 2BVWA 4Q32A 1QPOA 3AROA 3B97A 4DNHA 2A2IA 3URAA 3U5UA 3ELFA 7A3HA 2QCFA 1OGSA 5HDRA 1OCJA 1MQRA 3N4AA 1OCQA 1P7TA 1EBGA 1K6WA 2WVUA 5DXXA 3GH5A 4ZE4A 1Q5MA 3H53A 1J96A 2FB2A 3TAKA 2V5LA 4GUJA 2GVYA 4GX9A 1WQ5A 1NM9A 4FOKA 1A5LC 3PBWA 1TJ2A 3GVWA 3S46A 1O5XA 2GJLA 3T09A 4G7EB 2FPTA 4J5NA 4LBRA 4N9DA 1W3KA 4PL1A 3SB0A 3SW6A 3QMRA 3H4GA 2FVMA 2PGWA 4Q22A 1S2AA 2VD8A 4PUMA 2NT0A 3EX4A 3F7JA 1ECQA 3SRKA 1ME9A 3P67A 4AZGA 3BLFA 4KIEA 1P6CA 2ESCA 1DJIA 3GD6A 4DF0A 4H6EA 4H1ZA 2DZUA 3MI6A 4B3KA 2PLMA 1JULA 2POTA 3PP7A 1DQXA 3MUY1 1W1YA 1XLDA 2FGZA 3HPXA 5CBBA 2XIOA 1J11A 2F7FA 3S5SA 1LROA 1DXIA 4AAJA 1BKHA 2ZRXA 3OA3A 3M6DA 4FX8A 1OK4A 3DHFA 1OIMA 1F4AA 3PUGA 3TYUA 1NWTA 5A8PA 1XBVA 4GCXA 1XRFA 2QCNA 3LCIA 1E72M 4W8LA 3V75A 1AD1A 5KSWA 4G6CA 4W5ZA 1MXDA 1NFGA 3LS9A 1JZ3A 2ZZ1A 3K1DA 3V0TA 1JZ6A 2QIWA 4BI6A 2PAJA 3B04A 2V30A 3CQJA 3IIOA 1ZENA 1OFBA 3TK7A 3O0FA 5BRBA 4ES4A 3U2CA 1WNOA 1V6XA 2D69A 5EGRA 4NI3A 3CAWA 4I3GA 4X2PA 1TVLA 1BXCA 4CNOA 3ATYA 5LIYX 2CZFA 5IBXC 1GOIA 1VZWA 5EA9A 3IIVA 2JEQA 3WQEA 3ANUA 2Y89A 4IX0A 5HINA 3N2BA 1XISA 2I57A 3L66A 1IGSA 2Y5JA 5H1WA 2RDWA 1PIFA 4MYAA 2CZDA 3QY7A 1VENA 2RKXA 3NQDA 5J04A 3RMEA 2F84A 4DRSA 1A5KC 4NAFA 4LV4A 1BVWA 2E6AA 4F40A 3REQA 4RPQA 3N19B 1QUMA 2QGYA 5DMNA 3L4VA 3AYTA 2CBUA 1MFVA 3GG1A 5FJIA 4AMCA 3QYSA 2OOFA 4A2SA 4QDMA 1KFEA 1Y5WA 1G7UA 1A5NC 3CZEA 1E51A 3N34A 4KBXA 2QT3A 2VEKA 3DFSA 1JD7A 5LIXX 1DJGA 4AF0A 4C6CA 1XC4A 2R1NA 2VC6A 3VFCA 1IIGA 2BG5A 3CS2A 3W27A 3AYRA 3S9ZA 2PBGA 1AQFA 1B4KA 4JTJA 4I5XA 4Z08A 2OB3A 2BBFA 3W1AA 2P3ZA 4WXZA 2DVXA 1Z69A 2BZNA 4TOQA 2VKZG 4E8GA 4N6EA 4AIUA 2PRLA 2J13A 5BXRA 2ZZ2A 1X6LA 3HJEA 1DJZA 1Z8AA 3GNDA 1UPPA 3TA9A 1FDYA 1C90A 2H3DA 1OEPA 2DU2A 3E12A 3D3AA 2XFYA 1H4PA 1FY6A 1AQHA 1E6SM 1R47A 1CYGA 2ALDA 4PMNA 4S38A 2PD5A 2WBGA 1SR9A 3EOOA 3RJXA 3GVGA 3TYDA 2QCCA 4LFYA 4YTSA 5C7HA 1WXJA 1NWUA 3FA5A 3FA3A 3HN3A 2O56A 1GORA 1B31A 3NGJA 1H7NA 2REQB 2OU4A 1HGWA 3CHEA 2J7DA 3UBPC 1UPMB 1BF6A 2JFEX 1DJHA 2WM0A 2ZWZA 5FEWA 4R27A 3MA8A 2E9MA 3TTSA 1M04A 2NQZA 2W0UA 3GHSA 5GJMA 4RV3A 4B5WA 3TTOA 4HBKA 3NO3A 4Q8PA 2NQ9A 2PDLA 3ZLGA 3I4KA 2Q8ZA 4AQLA 5F2GA 3CUHA 4Z2GA 1OHLA 2QIIA 4LC6A 4HNLA 4M51A 2E5BA 1WO2A 1TUFA 3B9AA 2ZZ4A 4CCCA 3AU6A 1PUDA 4QP0A 4KERA 4I6VA 3A4XA 5A6MA 3PSVA 2EPKX 4IIFA 2WHJA 1OZMA 5G2IA 5E6YA 3H2NA 1K8YA 3U2ZA 3VIHA 3A22A 1P48A 3O2LA 1MQQA 1UR9A 3S83A 4JX5A 4ZE5A 4IWWA 2G3FA 1AK5A 1WUFA 4I7VA 3W7GA 3TC3A 1HJXA 3SCVA 3T6CA 1YBQB 4LCRA 3LPOA 3FIGA 3NSNA 3NPWA 5AHMA 2VENA 1P7TB 3B8TA 2VVSA 5FL1A 2NLIA 4Z2HA 3CZ8A 2XJ7A 1SZEA 4Y2WA 1F9CA 4C6QA 4Z1BA 3TN5A 2PE4A 1AUSL 3W23A 2AL2A 5I3GA 4AWSA 4RZBA 3M1ZA 3VGBA 2OZ8A 3DENA 4ZENA 2DSWA 3IIZA 1ZL1A 4XUYA 5KZEA 4AXKA 3CMJA 3MMUA 4GQRA 3OBEA 2UY5A 4CNUA 5HPCA 4FXJA 2HZGA 3QSRA 2C0HA 3U9IA 3ONBA 3CT2A 1EP1A 3NO5A 1HL8A 1IEIA 3SUUA 2VELA 3IS4A 3N2CA 3VTRA 1S5MA 1ZZMA 1AODA 3S3GA 1VBHA 3SY8A 5FESA 1KLZA 3B06A 1BRLA 1H0GA 3RXZA 3TOYA 3VC5A 3ABOA 4JTHA 1KRBC 4FNUA 3CZLA 3M0XA 1B9BA 3GKAA 4D6GA 3EB2A 3CO4A 3S1UA 3SQSA 4GQQA 3QGKC 2XIBA 4Q4KA 4XKYA 3QHNA 3FKKA 3HGSA 3H7VA 3T8LA 3C0JA 4XZHA 1TWSA 4Q4SA 4F0MA 4XZ9A 4PTWA 1QPQA 4GOAA 1TJPA 4GVFA 4PRTA 3W7OA 3FA4A 6REQA 3WQFA 3DHUA 4QEHA 3PZQA 2XFWA 3HMCA 5FCZA 4E2VA 4EP8C 3L23A 5EMLA 4WK9A 5FD0A 4P8XA 1PZ2A 1M53A 1YNYA 4PFMA 3ONCA 2FMOA 5EBAA 3PG8A 4IPPA 2IPFA 3PN8A 5T91A 2V3FA 2F2KA 1ISVA 1E3ZA 1XI3A 3D46A 5BXSA 1ADDA 3M0ZA 5FF2A 1W8GA 3GYEA 3LHTA 3M0HA 6XIMA 4KCUA 1BXNA 5D09A 5CBIA 2B7PA 1TREA 1Y8BA 3LGEA 3ID7A 3RPTA 3TN4A 4CGTA 2WNZA 4Y8FA 1X7FA 2HNEA 3SCOA 4IOTA 1XBXA 2WSYA 1PKNA 3MCNA 2QUUA 2W92A 2EXOA 3UZZA 5DN1A 2XDFA 1AQ0A 4DO4A 3EDFA 2IUZA 2YCEA 2QMJA 4UTTC 1JL8A 4JFUA 4QAWA 2A3LA 4CNNA 1HZYA 4LEQA 4WKHA 2E68A 2GOKA 3IGXA 4GZJA 3CV2A 3LNPA 2GK1A 1W9BM 3S8HA 3TR9A 2IQTA 2QNEA 1TR9A 3DAQA 4QBXA 3W7RA 2V2CA 1G9HA 4ZTXA 3NTYA 1YIXA 3UR7A 2NV2A 2Z6JA 3EX2A 5J8LA 2I5QA 5CLWA 3REQB 3SRDA 4QRNA 4JD4A 2ZRYA 2L5HA 5D4YA 4MNJA 3I6RA 3ABSA 2XH0A 3BOXA 4OUIA 1TMLA 3WN6A 3F4CA 1RD5A 1K8XA 5E5CA 4M7TA 2FPYA 2UY3A 1DWIM 3HQ1A 2A3CA 4UFKA 1T8XA 4TUFA 1R46A 1JZ4A 1QNSA 4M8UA 3QPZA 2YW3A 3VAVA 2VM8A 3W00A 1UR4A 3UVAA 4AIBA 2JKEA 1DQWA 1CDGA 3GLCA 3QSTA 4K36A 5A6SA 1J12A 4CU7A 3APGA 3T78A 1A47A 1OABA 3QXBA 1B3ZA 3U48A 4CD6A 4W85A 2XGZA 3B4UA 3ZFHA 4Z2KA 4L64A 3DESA 2E6YA 4XD6A 2ABAA 3EOUA 1IYXA 3L2MA 2DT3A 3W1QA 2VZVA 3MUAA 4L65A 4UR8A 1AJZA 2F8QA 2I9EA 1ZAIA 3KOXA 4Z1YA 2QF7A 1N82A 2ISWA 3G3DA 3OYZA 2VWTA 1VCFA 2BWGA 2CHRA 1QMLA 1CENA 1Q6CA 3L2IA 4C6JA 3GAYA 4YJ5A 1P0DA 4ROQA 4WSHA 1KCKA 2NW0A 2VZUA 3DBNA 5A6AA 4XAPA 2HSAA 2V67A 3UXAA 3EKGA 9XIMA 3F2CA 4KS0A 2AAMA 2DJXA 4QLKA 3CC1A 2UBPC 3S2JA 2GGGA 3GRIA 4MLJA 4DZ5A 4DO7A 4ZB2A 5DCBA 3R4IA 1WZKA 1VJIA 3L0KA 2CESA 1V6UA 5K7JA 3PZ9A 1XGDA 5LIUX 2VTFA 1E6PA 1FDZA 1PZ0A 4AFYA 2I7GA 4KETA 5AC4A 4O0QA 3BCFA 4X2RA 5A69A 1J4EA 1F76A 1XGEA 2ABBA 1RHCA 3UJ2A 5K9XA 2ZDRA 3KLLA 1QBBA 4UOJA 4RLIA 5C9XA 2PWHA 3O6YX 1OADA 3ZSTA 2AMXA 4J28A 4AU0A 1XWYA 2CLLA 3QMTA 3W22A 4QS5A 1WDSA 1W3LA 2UY4A 4GYKA 1HT6A 5KMYA 1E0XA 1EL3A 2C16A 1HKKA 4ICMA 5HULA 5FSEC 3M0VA 4NNBA 3G1HA 4DZAA 3WDPP 1JZ2A 4XD3A 4ATLA 2OMAA 4Q6JA 4ZQCA 5D2YA 4D6IA 1QOPA 4WCJA 2V69A 4HQVA 1H5VA 1J5TA 3MTWA 5HQEA 4ZO7A 5D37A 2HPIA 1TV4A 3TW7A 3A6OA 4B4FA 3WENA 3IEBA 4QQUA 1XLCA 3BLEA 4JDYA 1M7XA 4WY0A 1OFDA 1V93A 3N13A 4RE3A 1JCJA 1L6FA 1S5TA 1OFEA 2CITA 5GQBA 3LU2A 4PFHA 4QSFA 1B54A 1AQMA 5L9FA 4O12A 2X1SA 2EO7A 4JIQA 1L8PA 1KRMA 3WX7A 3RRXA 1FWGC 2R6OA 2XSAA 1YTEA 1XIGA 2X0SA 4FLOA 3PWIA 1UMYA 3SADA 1A49A 1H09A 4W8BA 2NVCA 1EXBA 3SCQA 3VDCA 3S6OA 1WDDA 4JAWA 3R8RA 1XYAA 2HNHA 1WKYA 2XVPA 4LUYA 1DTUA 2Q8LA 1HKIA 1OFQA 1RK5A 2ZUSA 4WGHA 1U5HA 3D0CA 1KKOA 2WNWA 3HTWA 4MWAE 4MJ4A 5A8QA 2AGKA 1QI2A 1W5NA 3CV7A 4E2BA 4A8IA 3EYPA 3FK4A 1V4YA 2VGFA 4UNKA 2PDFA 3SO7A 3KUMA 1R2TA 3W88A 1J2WA 4N9CA 3W70A 1MUCA 1LP6A 4QHRA 2VQTA 4FNPA 4CD4A 3E3HA 3PZIA 1ZNNA 5CXPA 4TVCA 3OZOA 2ZX6A 3FYYA 4UOQA 2J4GA 3T07A 3DYMA 1TELA 1GYNA 4QLLA 5TF0A 4Q4MA 2ZZ6A 1CBGA 1JEZA 2OTDA 1QW8A 1PYFA 2FJUB 3F03K 2RGMA 2D2JA 4LVBA 4ICCX 1YTKA 3F2BA 3AS2A 4U33A 2PODA 4GA8A 1TTPA 2QULA 4HA3A 1VEMA 3EX3A 3GR8A 4L9ZA 3CAVA 3KVJA 3P81A 1LG1A 3CH9A 3C8FA 2BMBA 2XVGA 1LQ2A 3LSCA 1IXNA 4MB3A 4ZXLA 1X1NA 1J0IA 4BI7A 3CUIA 3QVQA 4AYSA 4M6PA 2IQ0A 2QCDB 3AXKA 3W53A 4DXKA 5CC6A 1FX6A 2WK2A 5BXPA 4PYSA 3P0XA 1NOUA 3OOQA 1P5BA 2I5IA 3JZUA 3OODA 3GU1A 3B8WA 4DHGA 3V0UA 2BDQA 1C91A 2FYMA 2D3NA 4I7UA 3WDRA 4QROA 3BW2A 3HQNA 4N9BA 2VGIA 2PDQA 3DBPA 6XIAA 2Y88A 4KEUA 3KEHA 1EF3A 5JUVA 1MDRA 4D8LA 3ZJ6A 4QG8A 1JQXA 4WXYA 2R14A 1GQNA 4RXFA 3STFA 3TP4A 4HZ8A 4LBUA 4QSHA 3DKJA 2ZXBA 4HGXA 3E0WA 1C7SA 2D73A 2C6QA 1YW1A 3O16A 2IKJA 2WBKA 3WMSA 3PZTA 2A3HA 1QWKA 4REQB 3TOPA 2O4QA 5F2LA 2ZXAA 4ZXOA 3SFWA 1A5SA 2X2YA 1GQKA 3W72A 1ZJIA 4Q8MA 3CM4A 2QAFA 3OHIA 2ZBTA 1T41A 3H2FA 1HP4A 2PSNA 5CG0A 1AZ2A 1SR0A 3EEGA 2WOQA 3B9NA 4C6MA 3FJNA 3N1AA 1TA3A 1JXKA 2C14A 3M9YA 5BYWA 3WQ6A 3FDGA 1OC7A 3WLMA 1MMFA 3EMZA 4JICA 1F07A 1UWTA 1V5XA 3GIYA 3SR7A 3AZSA 3VIMA 4IISA 1XC6A 3NYDA 5E1QA 4Z1DA 1OFRA 1LRNA 2HWGA 3AIQA 5LA1A 3QY8A 3FGCB 4MB4A 4D6HA 3WLQA 3ICJA 4UFMA 4O54A 3CWHA 4QAIA 1KR0A 2WLZA 1K9TA 1DQUA 1O66A 2YFOA 3G1SA 4PMQA 3E9AA 4UTLA 1QPRA 2CLPA 2BY0A 1QOQA 3B40A 4D8AA 3AWOA 3G8RA 3I3BA 1SO4A 3H70A 5JBDA 3APYA 3HO8A 2NUWA 3L4WA 4ZQOA 4BQ5A 4JFSA 4JQ4A 1XSJA 3RYSA 4JNYA 4ZODA 2DQXA 2OWWA 1V6YA 3CGTA 4UFIA 2YA1A 1BLIA 1BYAA 1K6AA 1PKYA 2H6RA 3HIJA 1A0EA 1TPB1 3BUVA 4UIOA 4OIFA 3ZT6A 4JHMA 3PAOA 2D23A 1Q4WA 4JTGA 4QQ3A 2FZBA 1BG9A 3L5MA 1E1CA 1JAEA 1VLIA 2Z1VA 3L5AA 3UD6A 1BGGA 3MBDA 3E0FA 5CPSA 3UWZA 1LOSA 1TZ9A 3B9OA 4F0LA 4L1XA 3DEQA 4HNUA 2FGBA 1Q8JA 3S9IA 3Q37A 5HUOA 3A3XA 2NXIA 3TSBA 1MXSA 4X61A 3SECA 5H6HA 3FSUA 3UJSA 1LL6A 3O8AA 3BE7A 2VFDA 1UKPA 3WJWA 2YL6A 1VR6A 2OPJA 3W7MA 3U5YA 3N2OA 2DFAA 1X8FA 2PI6A 1HIZA 2DSVA 3EWXA 4NT0A 3PWAA 1KFJA 1T8QA 2JF7A 1BYDA 4JTIA 4G1KA 2POZA 5JIPA 3F5JA 2HBXA 4QE5A 1TCDA 2QCEA 4WY0B 1G1YA 2GUYA 1YDVA 1YNQA 4AIOA 2DJLA 1VD6A 1MDLA 3LNMA 3WLPA 3U7VA 3AUOA 4KGJA 4FLSA 1KM4A 3EB4A 4KMQA 3PY2A 4K8GA 3BMWA 1DXEA 3T08A 4NI8A 1A5MC 3P5YA 4YYFA 2Z27A 3IACA 2X7VA 4L4OA 3ZZ1A 2FVKA 2GOUA 3G2GA 3KDNA 5AN7A 1RP9A 2NWRA 1Q65A 4PMVA 4ZOCA 3EWDA 4IZGA 1JDCA 3WF1A 5H91A 3B3DA 2CLKA 4HVXA 3PHAA 4KCWA 3UJFA 2WM1A 3RLUA 1UUQA 3TN6A 4MGGA 1U1JA 2XH7A 2YL5A 2J7GA 8A3HA 4M24A 1PYMA 4K8EA 4O17A 3I6TA 2OYKA 1GPWA 5LA0A 3M16A 3OG2A 5G2WA 4PRRA 3EWUA 1IIHA 2GGJA 4B4HA 4UC5A 3QR0A 1AJ0A 5G1TA 5CG7A 4LY4A 4P7QA 4DO5A 1VPQA 1CCWB 3SIZA 3SURA 3HQPA 5C0QA 4KT2A 4D6CA 4H00A 2CERA 5CPNA 3SY1A 4PUDA 1FHDA 4R88A 4H6QA 4WF7A 3IJ6A 1JDDA 2XZ7A 1S3TC 4AD0A 3WJYA 4GUFA 5A6BA 3ZOAA 2C7FA 1F73A 4JTFA 1E0UA 3SUVA 2RFGA 5LZLA 4GVGA 4ZSTA 4J2PA 3T0BA 4LAZA 3INPA 3QQWA 2QUVA 3H54A 4XWUA 4D8ZA 2HK1A 2WSPA 4H9MA 2BFGA 1H63A 1HJWA 3L4XA 3S4TA 2E0PA 1XLFA 1XLGA 2VRQA 2TPSA 3V5FA 3RUBL 3E5BA 1SVDA 2JBMA 4FOUA 4IIBA 3T81A 4XTDA 1FRBA 3AHXA 4JKKA 3IJDA 1L6YA 1RJRA 2A7RA 3FYPA 4UZUA 1GWJA 1ADOA 4DBSA 3HQOA 4C1NB 4ONVA 3WD2A 5A6TC 3RK8A 3ARWA 1DIKA 2FHFA 3R5EA 3CZKA 2ZZ7A 4LJ3A 3OGRA 2PD9A 1NDZA 4ICNA 1G69A 1IQ8A 1VB9A 2ZYFA 4ZMGA 4UMCA 4CU6A 3M0IA 1C8VA 1E4NA 1UR8A 2YKKA 3ZQ9A 5FJRA 4W4QA 1K02A 4JOMA 4XBSA 4XD4A 4IMEA 2C15A 3N17A 1S2VA 3VOHA 2VUYA 3NDOA 3FOKA 2YDSA 2ISDA 1CXKA 4WR3A 3CO8A 2KAUC 1MNSA 3C2FA 1RXOB 4JTEA 3AJ7A 1FWFC 4QJ5B 4YS1A 4FX6M 3WEMA 2PDIA 7CGTA 1EIXA 2VCAA 1QNQA 1CXEA 1V3KA 1RK6A 4S3EA 5EKYA 4HCLA 1UIPA 4S3DA 3V18A 3UZJA 1FWNA 3CYJA 1TA3B 1O6IA 1SQ7A 2PMQA 2OEKA 3QF0A 2WANA 1QASA 1XHGA 4XBKA 5A3HA 3LBCA 3GSMA 1EC7A 2IKIA 2E7FA 4LAOA 3EDDA 4GI4A 3WD1A 3WNKA 2EPHA 3EDKA 1EC9A 1DWJM 3HF3A 4KWOA 1KNWA 1YXCA 2YFNA 1C7TA 4GQ0A 5EMJA 4K7YA 4DBUA 4QNWA 4ECLA 4EPEC 2JKAA 5KITA 3IARA 1NEYA 3NDYA 3GWQA 3MSRA 4YCPA 3NZRA 2VX5A 4YHGA 2QUTA 1TTQA 1CTNA 1DKWA 2RDUA 3BG3A 2R9RA 1VBGA 1XIDA 2GQAA 2P3EA 1WP6A 1MVYA 2HBVA 3UETA 1GONA 4F0HA 3DERA 2PDUA 4LVGA 3ARQA 4H9TA 4NSBA 2P88A 3B03A 4GNKB 4A3HA 3TNOA 1H7XA 4IMFA 4MM1A 3SGZA 1DJNA 2OLHA 1HW6A 2HE8A 2O9RA 4PCPA 1C93A 3WMBA 2OSXA 2QV5A 2CNCA 4UZSA 4O1FA 2Z7GA 4A8LA 3NFUA 4PSPA 1ZAJA 1TCMA 4W9TA 4U2ZA 5EPDA 2PWEA 1TE6A 3EPMA 4FR6A 3AYVA 1KXTA 2OEMA 5M17A 3GNOA 2OSWA 5I00A 3PTMA 1EZWA 2VFEA 3UG3A 4PEEA 3SY5A 2OVLA 4ZOBA 2YCIX 4DI9A 1D8CA 2TMDA 1XDJA 3AXXA 4JKMA 1L2UA 1YNPA 5F2MA 4B92A 1MW1A 3W24A 1XG3A 5F4WA 5T26A 1O7AA 2HRWA 4JX6A 3CHDA 4X63A 4PC8A 3CL6A 3VM7A 1ML1A 1GT8A 5ECVA 2PF8A 3BICA 3GDMA 1HGYA 5IOBA 3G6LA 4GISA 3TONA 1Z42A 2BOFX 3TMLA 5K2ZA 3GNPA 1RBLA 1B30A 1W9VA 2W6RA 4E8CA 1DIEA 4L4PA 3WK0A 5DMMA 1QATA 4BCEA 1AG1O 4X9YA 1PHQA 4D6JA 3E0VA 2PWDA 3VKBA 2ZX8A 1J93A 3IV3A 3OB8A 1XFBA 2EPLX 4PCSA 5F4XA 1IR2A 4DBDA 3GZAA 3QFWA 3QH2A 3CAKA 4A3UA 3LXBA 3C3NA 2J7EA 4BFAA 3BJFA 2E8ZA 4XUGA 1FWEC 3A21A 1T96A 3GYCA 2ZICA 3I4EA 1ME7A 3LHVA 2ZWYA 4Q8QA 3FCPA 4O1CA 4Y9NA 3ITOA 3MSGA 5I3FA 2DW7A 1JPDX 3JVAA 3DGRA 3NPXA 5TQLA 1H1ZA 1XSKA 3TFCA 1UASA 3UR8A 1ZCCA 1W1IE 4AHOA 5DO8A 4ERGA 4GXMA 1E9YB 4R33A 2PB1A 1M03A 4L9YA 4TX9A 4PCNA 3NL3A 1E4IA 2QMKA 1RA5A 9XIAA 1X39A 1D2KA 2F9RA 4XZLX 4HK5A 1RQEA 3PFMA 2OZ0A 3DOPA 1MUWA 3KLKA 3UPMA 3THUA 3TW9A 3CK5A 1I0BA 2PDJA 2BS9A 3WG6A 3IIPA 3KBMA 1YPXA 2A5HA 4PTVA 1TUXA 2B7QA 2VC5A 4GUGA 1NP2A 2XUCA 4NJJA 4KFNA 2VOTA 3EGJA 1A5AA 1CLKA 1EF2A 3CPUA 1ZSXA 4J3VA 1CLVA 4M81A 1FWIC 2V63A 1OWQA 3W07A 4HU3A 3GU2A 3AYSA 3TC7A 2FKPA 2XISA 1FH8A 2NWSA 3VUPA 5HQMA 4C6IA 1G4PA 1PKLA 1B3OA 3TN3A 2HXTA 3W7KA 3HPAA 3IWPA 4XSLA 3M5VA 4QTGA 5M1TA 1FWSA 2GGHA 3SFKA 2RAGA 5TNVA 4AWEA 3PAJA 2Y4SA 2EF9A 5D2VA 5BRQA 4GYJA 1EEXA 5E9AA 1XCWA 2XN1A 3B8VA 4HD5A 2QF8A 1IXOA 2D0HA 2SFPA 4HSHA 3NA8A 2QCLA 3UW6A 3IAPA 3ARPA 5BNKA 3NZ1A 3A5FA 4IPLA 4AD5A 3G22A 2WC4A 1FWWA 1TKKA 3LCHA 2GJRA 3BV7A 1VLWA 1PDYA 4MDPA 3TQ0A 3HB9A 1UD6A 2Y6ZA 3WQGA 3S1VA 3MDWA 1P6BA 3E49A 1VJZA 3NEVA 2Z2BA 3A24A 3AUJA 4AZ5A 4A8RA 2CETA 3OLIA 1EO7A 2PA6A 4PODA 1MRQA 4GHRA 3UPBA 4TX6A 2NSOA 2PDWA 4DJDC 3CLWA 3LTYA 4NZ3A 3URBA 4C6PA 3KOFA 3HZ3A 2CLHA 1CGYA 5H8UA 1J9YA 1UKSA 2J66A 4YN5A 2A7NA 3FDKA 4LSBA 4ZEPA 3PM6A 3C2VA 1W91A 3HPZA 1SJBA 2VFIA 5CPQA 1AW5A 4GJIA 1SM9A 1N8FA 2W91A 4LU0A 4S3CA 5I07A 4NX0A 3BURA 4LUSA 3BCDA 1XINA 5CPOA 5TD4A 4OE7A 4M0XA 1GUVA 1OY0A 4JTQA 1G01A 1W1VA 5C54A 3L21A 3RF9A 1UZ4A 2NXHA 3L0NA 1KM3A 3IUIA 5BROA 2CBVA 3IJ9A 3C8NA 1LWHA 1G67A 1Z7AA 5K9DA 2VCCA 1SZNA 3NVTA 4KF1A 3LRKA 4RNIA 4AYGA 4OUEA 3STEA 1UR1A 1H7WA 1P1XA 3LPFA 2R94A 3D47A 1XLJA 3FKRA 4F2UA 3WDQA 3IRDA 5DY2A 4F2BA 1OCNA 3L4TA 3UG4A 3O6DA 3WEOA 4UNLA 2PS2A 4JTCA 2PPGA 3FYOA 1RSCA 3WUEA 2WW5A 3C86A 4Q4RA 5MKGA 1TB3A 2BY2A 1UIOA 3C2OA 4FK9A 4HPJA 1GYLA 1VFHA 1L0PA 2R8WA 4EPDC 1I2OA 1WUEA 6PTDA 1EUNA 3BAXA 4NYYA 4UFLA 5AHEA 1XRSA 5BOEA 1R3SA 1X6NA 1Q66A 3KW3A 5HNUA 3AC0A 1J18A 1RY8A 5CEWA 1E0VA 5B7ZA 2PP0A 3Q94A 4GD0A 3CWNA 3S2CA 3AMCA 3HA1A 3CL8A 2FH6A 2EJ1A 4FXSA 1LTDA 3MKCA 3G24A 1PX8A 1OX6A 2J77A 2OSYA 2R91A 3M46A 4P7RA 3K4DA 4OFCA 1I8JA 4LS1A 2EJAA 2PDMA 3FAWA 4IPNB 3WQ4A 2VHLA 2WMIB 2HPMA 1JPMA 1NWSA 3TE9A 4LS2A 1PWLA 1IEQA 3SUTA 1YMYA 3MBFA 4EXBA 1S5WA 4F9DA 1WXZA 1JPKA 1CXHA 1DVJA 1HFBA 5ABFB 1E9LA 3B8SA 3KP0A 4I8DA 4E4UA 3IJLA 2JIEA 4PTXA 3C6CA 4OU1A 4Q8TA 1EJSC 1G6CA 2CBIA 4ZOAA 5GNYA 4FLQA 4GY0A 1MNZA 1LZOA 2E25A 1AVAA 4S23A 1Y5XA 2XM2A 4AWUA 2WVVB 1F8IA 2PTXA 3FV9A 2DIKA 1H7PA 3MJMA 1ISWA 1LYXA 3WBXA 2I14A 3VZXA 3OGSA 1W17A 3D6NA 4TMCA 3N73A 5HAOA 4PBEA 2DQWA 2Y63A 8RUCA 1UH3A 1IZJA 5C5YA 1M9HA 1O4UA 3OQ8A 4LQ1A 2V2HA 1RVGA 1JZ8A 1R38A 3CEUA 5BWAA 4UCGA 1P1MA 3LQGA 1OD8A 3W7PA 3C0SA 1ODUA 3UR2A 2WYSA 5DELA 1HX0A 3LMZA 1R6WA 4GWEA 1ZJHA 4H19A 3VXGA 3MO4A 1R87A 2Y85A 2RGLA 1J0ZA 4UTWC 5AYXA 2CLMA 4C6EA 4EVZA 1FHVA 5U7SA 3SSJA 3BZJA 4JCLA 3EOSA 3LUTA 5LA2A 1P4CA 3W38A 1Q3NA 2IS7A 2PCEA 4LWWA 1FKXA 4Z2IA 3B0VC 4GGBA 1EO5A 5C6MA 2Y5EA 4LF2A 2CCRA 3SGGA 4PN2A 4IQJA 5G4HC 2PGRA 4ALDA 2ZRWA 1UBSA 3NL6A 3VKJA 3LTPA 4NRSA 2PEVA 1KD0A 4ORMA 2CW6A 2O9OA 5I78A 1QWGA 1RPKA 3W6MA 5HMDA 3P2VA 3XINA 4B16A 2PWUA 3BAKA 3I65A 4IMDA 2GJPA 1KGUA 3DUGA 4GXWA 1R9YA 1W1B1 1OX5A 4XO7A 1OVDA 3PUDA 3VOIA 4FHAA 4MKNA 3W75A 4K37A 4FNQA 3BG5A 5FACA 2TYSA 3WK3A 2Z7KA 3W85A 3FHAA 3G0UA 1XD1A 1SW3A 1R3VA 3L12A 1N55A 1X96A 3BW4A 3E1F1 4JTTA 2GVLA 1FHUA 4CNSA 2OYMA 3IUHA 2ZE0A 3G0XA 1D3HA 5IHRA 4JIHA 1ZQ5A 1B3YA 2J25A 4DBWA 4B5VA 5CH9A 2QKFA 1XYLA 4DBEA 2GVGA 3W87A 5FEZA 4IQDA 4BF5A 1CGTA 3EEZA 3IGUA 3EMCA 1R3RA 1GVRA 1CEOA 3HGOA 4OECA 4QXIA 1V6VA 4GRSA 1LQAA 4DF1A 4M19A 4MUPA 3GTHA 4DWDA 4OGZA 1XIHA 2R82A 4H9UA 4JZ5A 4IMCA 3SCSA 1GJUA 1PAMA 4QFUA 3H21A 3KOZA 2GVEA 1MW0A 2FHCA 1NELA 4K8HA 4A29A 2HISA 1ONEA 4R9OA 3FFSA 4RJEA 1GJPA 4YU1A 3TAOA 4GYPA 3N6JA 1R2RA 4S3GA 4L6OA 1GKPA 1EQPA 1F3WA 4F4RA 1EYEA 2DZSA 3NVDA 1F61A 2GQ3A 3DFHA 2VC7A 1UW9A 3AXIA 1EX1A 3A47A 3GZ3A 4NIRA 2F6XA 3AFBA 2XH4A 4MWAA 3LBMA 2G41A 4PMXA 1A5UA 1HN1A 2NV9A 1E43A 2VCBA 5KETA 2W61A 2A6LA 3L68A 2EG8A 4HZMA 3R89A 3KCOA 2ZA3A 3EA2A 1QDSA 3I68A 2E40A 2H3BA 3NQGA 4NNCA 5HJXA 4Y9OA 2CKSA 5A8GA 4GUHA 1M1BA 3SJ3A 2EPMX 1L2QA 2ZUUA 4P7OA 1VFMA 1YQ2A 1XH1A 1CGXA 1C29A 1I45A 4R85A 1XRTA 3GG0A 2VRJA 4MUZA 3RR1A 4LH8A 4N02A 1V3IA 3IVUA 1DHKA 1QRQA 3UWVA 3LRMA 3EMQA 2GGEA 1NOFA 3SBFA 3I7RA 1UWSA 3QRHA 1KA9F 4HOXA 3N6QA 2V2DA 2ZC1A 3LOTA 4CVWA 3VIKA 2DT0A 2ONEA 5AYZA 2HXUA 3PANA 1HJQA 3MUXA 3ECQA 4O4VA 5AVNA 5LNRA 4PL2A 4BF9A 2DDXA 5LIKX 3PK7A 3G6MA 1WAUA 4U31A 2BB0A 4WIWA 1GW1A 4WOZA 4EAYA 2WZTA 3PTKA 4RV8A 4CD8A 4IIGA 7REQA 3V1HA 2V5KA 3T0TA 2ANUA 4HK6A 2IW0A 4Q4OA 3QGVA 2V38A 4MZYA 3ES7A 1ODZA 3VIGA 3LCFA 1SGJA 1V0KA 1Z89A 3S0CA 2XIIA 1MO0A 1CT5A 2DEPA 3M0YA 4KWVA 2VR4A 1Q4NX 2RDXA 1TMHA 5K3VA 4FEZA 1ZBKA 1LUCA 1A53A 2VR2A 3NSXA 4YTQA 3U3HA 4B9ZA 2E1WA 5A1AA 3GX9A 2WJEA 3PVFA 2GFTA 3S9YA 7ODCA 4OZOA 1ZJBA 2XVLA 1B90A 1DHPA 3GR7A 1TRDA 2A0NA 4OKDA 1PIGA 4DZIA 2GQ9A 5IFTA 3WNPA 3ZJ8A 2ZZ5A 3JR2A 4KCTA 5CJMA 2A3EA 4UQAA 1NSJA 4JGDA 1VRDA 1FA2A 3STCA 4H41A 2HVOA 4C7DA 3CQKA 1I4NA 1H11A 4F0KA 3BTNA 2WZMA 1KXQA 2KZHA 3HG4A 1OJXA 4JN8A 1EDTA 4ADSA 3T9PA 1B3XA 1UR3M 3VIJA 3R1ZA 3DFTA 1JPIA 1VFLA 3VKDA 3S1WA 5A8NA 4O1BA 1BYCA 5LHFA 2DSZA 4PMOA 4H7VA 1Q6OA 1R3YA 3H6OA 2J27A 4FAMA 4JDBA 2WCSA 1TVNA 4HA0A 4J3TA 3USBA 2PTZA 3WLRA 1FQ0A 1FVPA 3WK2A 1O60A 4HN8A 2PC4A 3B0XA 3LCXA 3OVQA 4LBSA 4IQEA 2X16A 1UJQA 3A23A 4H3DA 4KCVA 2WMFA 3SAZA 4AEOA 3WFZA 3CWOX 1KM0A 4UFJA 3VNKA 2J8TA 4GI6A 2FLIA 3RFAA 4LAMA 5CZJA 4O13A 4E8DA 1WDWA 4GVHA 3II1A 1I2NA 2TRSA 1ISZA 3AMGA 2QJNA 4M1RA 2OKOA 3PZOA 3P61A 2R24A 4W7VA 2XSXA 4PB3A 1MEHA 4M82A 1H41A 3N2TA 2Q09A 4F8XA 4C7GA 3F4DA 2Y2WA 2WC7A 3K13A 1RUSA 3UCCA 3RX2A 2DV0A 2UWFA 1Q8AA 5HMFA 4GBUA 2FQIA 1ZS2A 1Q6FA 4AIEA 3P8IA 1DXFA 4IIHA 5CAKA 2E1DA 3C61A 2XWEA 4FF7A 1Q6GA 3QTPA 2TAAA 3MUZ1 4C6DA 1NU5A 1HO4A 4IUGA 1E9ZB 1HKJA 2I17A 2VVNA 3IANA 2PFHA 5H8PA 3LN3A 1H60A 1A5CA 1AJ2A 3NAVA 3VE7A 1EJ7L 1W37A 4MF4A 5CBJA 3BSMA 4J4KA 1RH9A 1GVFA 4C6NA 1WOBA 3NL5A 1KRAC 1S39A 4IP7A 3J7HA 3UF9A 3LENA 2VOMA 4ACZB 1D9EA 1DTNA 1XICA 2B7OA 4EWJA 2X7WA 1LG2A 1XLBA 3ITTA 4P8UA 1RLDA 5AYBA 2YJQA 1LT7A 3LLXA 2PDPA 5AYIA 3LCGA 4G2DA 3EPOA 4MB1A 1XBYA 4J40A 4LALA 4BWLC 1KWKA 2MUCA 2XG9A 4IFKA 3KRUA 2YXGA 4HPNA 1D8WA 3BC9A 3NEHA 1JFXA 1QI5A 4YVXA 3ZVIA 2QUMA 1OG0A 3FAXA 4JTLA 2FH8A 1UYQA 1V3JA 1VAHA 3GFZA 1KXVA 1A5OC 3TSMA 1WE5A 1ZY9A 4PULA 1RQHA 3ITLA 2HQAA 3KBVA 3U2OA 5REQA 4AXNA 2YIHA 3PG9A 3H7RA 3O07A 4MJMA 2AMGA 3PS7A 5FKYA 1W9DM 3ANVA 4J3ZA 3WF0A 3GTIA 3RO6A 1FOBA 1M7PA 3FJLA 3W9ZA 2A3AA 3GNNA 3P93A 3WLJA 4MZ8A 2IMRA 1ZRQA 4PH6A 4ASTA 3UU0A 3V5CA 2JALA 3B8IA 1W9XA 3B9DA 3KRZA 3W7QA 3SM0A 4I9AA 3HV9A 1TR1A 4RDYA 1GVQA 3VE9A 5I3DA <