4P30A

Structure of navms mutant in presence of pi1 compound
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
92
structure length
92
Chain Sequence
b'VGSVAALLTVVFYIAAVMATNLYGATFPEWFGDLSKSLYTLFQVMTLESWSMGIVRPVMNVHPNAWVFFIPFIMLTAFTVLNLAIGIIVDAM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ion transport protein
publication title Prokaryotic NavMs channel as a structural and functional model for eukaryotic sodium channel antagonism.
pubmed doi rcsb
source organism Magnetococcus sp.
molecule tags Transport protein
total genus 36
structure length 92
sequence length 92
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-03-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4p30A00
3OR7C 1G4YB 3K04A 5EBMC 4JTAB 4WFEA 2DYRC 3ZJZA 3RW0A 2WLHA 4HZ3A 4QE9A 4MTOA 4I9WA 3FB7C 4R50A 3SPJA 1R3LC 4MW3A 3F7VC 4J9ZB 2HVKC 3OGCC 4PDRA 4WFFA 2A79B 4X88A 4BW5A 4QNHB 3LNMB 3GB7C 1P7BA 4MTFA 4G27B 3K0GA 3PJSK 3ZRSA 2QKSA 2DYSC 4RUFA 1JVMA 2NLJC 4R8CA 2Q67A 1S5HC 4PA7A 5E1AC 3UM7A 2ZD9A 4KFMA 3BEHA 3KG2A 4MVUA 3E8HA 4GX2A 4P30A 3STZC 3LDCA 3SYCA 5EC1C 3K03A 2YEVA 3AG4C 4R7CA 3IFXA 3OR6C 4P9OA 3SYPA 2IH3C 2EIMC 2R9RB 4RUEA 4XDLA 2X6AA 3K06A 2DWDC 4PA3A 4UUJC 1V54C 3SYOA 2WLNA 2A9HA 3ABKC 3E89A 3STLC 1R3KC 2P7TC 4TWKA 4WFHA 3F5WC 4R6ZA 5CBFA 4LBEC 2HVJC 4MVQA 4JTCB 5CBHA 2OCCC 3TCUA 4MVSA 3RBZA 3SPGA 5B3SC 1LNQA 3VOUA 2EILC 3SPHA 1OCRC 1V55C 2A0LA 3ABLC 1OCZC 4X89A 2JK5C 4OXSA 3T2MA 5EBWC 2BOBC 4MS2A 4J9YB 4MTGA 4PA4A 4MVOA 1J95A 1M56C 2ZXWC 3K08A 3R65A 4XDKA 3TETA 1K4DC 3K0DA 4MSWC 5IY5C 1BL8A 1ZWIC 3SYAA 4GX0A 3RVYA 4PA9A 2WLMA 4PDMA 5BZBA 2KB1A 1ORQC 3SPIA 3UKMA 2X6BA 2WLIA 5B1BC 2WLJA 4EKWA 2DWEC 4H37A 2K1EA 5KUMA 4ZBMA 2WLIB 2WLLA 2EIKC 4MVZA 3E86A 5EBLC 1K4CC 5EK0A 2WLLB 2ATKC 4DXWA 4H33A 3SJQC 3WG7C 4RO2A 3JYCA 1KKDA 1R3IC 3RVZA 4WFGA 3ASOC 1R3JC 3E83A 3OUSA 5EC2C 5KUKA 1OCOC 2EINC 4RAIA 2AHZA 3E8FA 3FB5C 4MVRA 3T1CA 1OCCC 5J9PC 4QE7A 4X8AA 3AG2C 3LDDA 4P9PA 2X6CA 3OUFA 4MW8A 4GX1A 3ABMC 4G28B 3T4ZA 1XL6A 3AG1C 1XL4A 3AG3C 3E8BA 3HPLC 2BOCC 3SYQA 3T4DA 3ASNC 3LDEA 3IGAC 2H8PC 2HJFC 3LUTB 4JTDB 5B1AC 2ITDC 3FB8C 2IH1C 2WLKA 1M57C 2HG5C 2QTOA 2Y69C 2Q6AA 3E8GA 4GX5A 4CBCA 5CBGA 3FB6C 4PA6A 4F4LA 1QLEC 2AHYA 4HYOA 3SPCA 2Q69A 4LP8A 3F7YC 4PDVA 2HFEC 2EIJC 3X2QC 4XDJA 3EFFK 4LCUC 2ITCC 2W0FC 4PDLA 4P2ZA 4MVMA 2Q68A
chains in the Genus database with same CATH superfamily
1VQ8V 1K92A 2UUBB 1EFRG 4NTYA 3CCJV 1VIBA 4TT3G 4HZ3A 1R3LC 1RSOB 3OMAB 5BR8B 1EZJA 2AW9A 3ZHUA 3LSQA 1NKDA 4JI3B 4LF6O 4YIPA 3ZHTA 3ABLB 3UO2A 1LUWA 5CMUA 3BEHA 4IT5A 5LYJB 1IXMA 4FZ0A 4DR3O 3IFXA 1SZTA 1Q81W 3OR6C 4GZRB 1JFFB 2QE7G 4QJFB 3I55V 5IJ9A 3H1HH 2EZOA 4PA3A 2WSSG 3ZHVA 2ZIOA 2DQ0A 3F5WC 3ZN1A 2A3QA 2Y48A 5BMVB 3AEIA 1TUBA 4Q20A 2W0XA 1AR1B 3ETEA 1XUQA 4LWSB 1OCZC 5LMNO 1BHAA 2QWPB 5B1OA 3T2MA 1FS0G 1Y66A 4MS2A 4O4LA 5CBHA 1J95A 1KP2A 1Z5VA 2P4VA 1WB8A 3SR2C 1GKFA 1ZLZA 2Q73A 4CH4A 1EM1A 3H1JH 4JI1B 2X6BA 3JCUZ 2RCVA 2YIAA 2YIDA 3E86A 1K4CC 4X65B 2DW4A 4DXWA 2A06H 2EIMB 2Z0AA 1KB9F 2H3OA 3RVZA 1NR7A 4BIUA 1K9MW 3RN4A 4IYIA 3HKBA 3T1YB 1BQZA 2EINC 2AHZA 2HEPA 5JQGA 3AG2C 1FXKA 2HJDA 3FX7A 2X6CA 5EYPB 1XL4A 1WB7A 3K5NA 1KMIZ 1WLEA 4DV6B 5JVDB 3UO3A 1CPYA 4DV0O 1QLEC 4JZ2A 3Q4HA 4NXMB 2L35A 2P22C 1KD1W 3JSNA 4MVMA 1IZ3A 3W7WA 4DW0A 3R66A 1I08A 4GKJB 3SPJA 2BSKB 3GB7C 2OIGA 4R8CA 4LF9B 5L3FA 1NH2B 3UM7A 4NVPA 1HNZO 4YJ2A 4DUYB 3N27A 2ZXWB 5KA5A 1XMOO 1I5XA 2HP8A 1MZFA 1JMKC 3QF7A 5A9GA 3FYIB 4DR4B 2ARHA 4AQYO 2XAGA 5LA6B 1YDXA 3CXHF 2JDIG 2LW1A 4LFBO 3E35A 1FXKC 3EHBB 2CGOA 4LFCO 1R6KA 2EILC 1GN6A 4UV9A 4DR7B 2UXBB 3JALB 3QVNA 4IIJB 1QVFU 4J80A 2AZ0A 3TGUH 1S72V 3J81N 1H2SB 2PGGA 4DV3B 3HB3B 2BCCH 1AB3A 3A0BZ 1FYJA 1AI4A 3AG4B 1HNXO 1Y76B 3W7UA 5KAFZ 1YTFD 1NS1A 1V54B 4NTWA 2ZINA 1BE3H 4TQDA 3ZHSA 1FJGB 4B3TB 3FB5C 2MW2B 2YIBA 4X64O 1PV0A 4MW8A 4ZHQB 5H9CA 4H13B 1XL6A 3KKYA 1RPOA 1H8EG 4PELA 3RT3C 2CUGA 1LUVA 4Z1VA 5JJJB 4NXNO 1VF6C 4GX5A 2F93B 1KBHA 4J7KA 3JARB 4O2BA 3SGIA 4WBNA 5GTIZ 1N32B 1SQXH 3G6EV 1L0NH 4JPRA 1G8MA 1GTOA 2JS3A 2DYRC 1DF4A 4QE9A 2V1DA 3BHPA 3JAMN 3SPGA 2B1IA 2UXXA 1P7BA 4G27B 2OCHA 3VQVA 3CXCU 3A2FA 3LDCA 2ZE6A 1SS3A 5EC1C 1YVWA 1AI7A 1KP3A 1NZ6A 1HW7A 4GLXA 1JPXA 1F4MA 3ETDA 2BTQB 3LSSA 4UVCA 1N36O 1QU7A 4FFBB 1BS3A 1W59A 4AHCA 2R72A 1HR0O 4I4TB 2OCCC 3UQ8A 3RBZA 4JYAB 4DR6O 2L6LA 1NVPD 3ABTA 3ABLC 5CA3A 1IBKO 3JAWA 1AVMA 3TETA 5FLXN 5IY5C 2OYQA 4GYCB 3GWOA 1BT8A 3RYCB 3UKMA 4EKWA 1H2GA 4JI8O 1PP9H 4QGPA 4ZBMA 1NT2B 1VQ9V 4WFBV 4GKKO 3QG5A 1PNKA 5H6RA 4DR3B 2IJJA 3ZN0A 1YTFB 2X7RB 3ASOC 1J5EO 5KUKA 4LF8O 3HKCA 1NI8A 2VWJA 1OCCC 3E2EA 2BSKA 4UCRA 2UUBO 1B06A 3CS5A 4GX1A 3JCZA 4ICGA 1HDJA 2X0LA 2BOCC 3CCRV 2GUZB 3IGAC 5B3SB 4NB5A 2ITDC 5BR8O 4JI0O 2PUSA 2IJIA 1U96A 3EFFK 4DRXA 4JYCA 4BIZA 1JR9A 1M90W 5KLVH 1D5AA 1G6UA 5JH7B 4FMTA 1SQVH 2A79B 1PD3A 2C2AA 3OM3B 4FLWA 1GO3F 1MNGA 1Y6XA 3E8HA 4IIJA 1S3JA 3ZMSA 4RUEA 2OT5A 4E2LA 3ASNB 2F95B 3K06A 2Q0OC 3H9VA 3SYOA 3STLC 1R3KC 4LH7A 5CBFA 5EZYA 1IBLO 3HKDA 4DV0B 1M5IA 3CEIA 3QO8A 1Q86W 2P06A 1PL0A 2ZXWC 4KP4A 3K08A 3J80N 5E79Z 1F4NA 4FLUA 3C3TA 5LOVB 5KHJA 2JEUA 1K5SA 4N23A 4U3JA 5B66Z 5CA0B 5L3CA 3CMAV 4B3SO 4ZOLA 3K5LA 3WG7C 1XMOB 4JF3A 1R3IC 4NXMO 5KHHA 5IYZB 4TUYB 3K79A 1N33B 3NXSA 3CCLV 3OTOO 1F51A 4QE7A 5IYCO 4P9PA 4O4HA 4X1KA 4UV8A 4GKJO 1MZEA 2YSUB 4FLXA 3FFQA 5B5EZ 1VQ4V 1SESA 2LW7A 2Y69C 3E8GA 2RQ6A 1S5JA 1B04A 3K58A 2CH7B 4DUYO 1YJ9V 3CCSV 4CH3A 2F1MA 5DN6G 1Z2GA 2IW5A 4X20A 3CJHA 5GONA 1S0VA 4O4JA 5KX5A 4JTAB 5GTHZ 4R50A 1L8DA 3TK1A 2PYJA 3OW2U 1B3QA 1SQGA 3BA8A 4I0XA 1TA8A 1WP8A 2GDSA 3FAVB 1TVKB 2RMKB 1BMFG 4X64B 4O4IA 3JATB 4DR7O 3RYCA 4XDLA 2X6AA 5FNVB 5EIBD 3TXQA 1LR1A 3ZX6A 4JI5O 3E89A 2Z3YA 4NXNB 2ODMA 2GV9A 4PHZA 5TISZ 1VQ5V 2ZNJA 1JCHA 4LF4O 5LGUA 5BXZA 2F43G 3R65A 4XDKA 1Q5OA 4B3TO 2GUZA 2DYSB 2KB1A 2Q5ZA 3I56V 4I55B 1YEWA 2K1EA 4NTXA 2UU9O 1UFIA 1RPRA 4FM0A 1X4TA 1ZSPA 2EIJB 5EK0A 2KG7A 3K5OA 1RP3B 3OEHG 1N8RW 1YI2V 4H33A 2OTJV 1OJHA 3M7MX 4LC1A 4JI7O 1N32O 4RAIA 3DC6A 1ZTEA 4TV9B 5D5PA 1QHTA 2MK3A 3AG1C 3E8BA 1HWYA 1XHXA 3BABA 2QJ1A 2VRZA 2YDEA 3RYHA 4DR2B 3P30A 4U7NA 3RYFA 1O9HA 1IBKB 3QO7A 2QM4A 5LHGA 5D5QA 2YS8A 3BFRA 1SQPH 3OR7C 1G4YB 3J7AU 3OE7G 3JD0A 3KZIZ 5L3DA 4JI8B 1SF9A 2F23A 5A2QN 3JD4A 4GKKB 1N0NA 4I5SA 3W7TA 4MVUA 1K5QA 5IDJA 4JYAO 4QPJA 4LF8B 1SQFA 2ZE7A 2QTSA 1CEZA 4TV8B 4PJ0Z 4Z2WA 4G2KA 4X1YB 2PI4A 3JASA 1VEWA 5HFMA 4WFHA 1DTOA 4JI0B 2XUMA 4CH6A 1RFYA 3NR7A 3S3XA 4OX9B 1LNQA 5LL6Y 4B3MO 3ZRWB 5CB4B 3GVMA 1M56C 4EB6B 1US6A 2N05A 2W6IG 5CA1B 1DLBA 4LNUB 2HHHB 5DECA 4XBFA 1K7DA 1BL8A 3SYAA 5BZBA 3ZMZA 2PZSA 2WLIA 2QM8A 2DWEC 5KUMA 4MVZA 2CH7A 4J11A 2RJZA 3QNEA 1P49A 4I9QA 2N04A 4L8JA 5KAIZ 2NR5A 3CYOA 3E8FA 2Y4UA 3FD9A 4MVRA 1GAXA 3KCXA 3T4ZA 1NTZH 2Q0AA 1IBLB 3LDEA 3LUTB 4JTDB 2Q4PA 1K3EA 1D2DA 3RYIB 5FL7G 1XNQB 3TJTA 2AHYA 1SA0A 1EBOA 1AI6A 1PPJH 3K59A 4MT8A 2YI8A 5FNVA 2Q68A 2LJ2A 2EULA 4I50B 2JS5A 2FTKA 2JRIA 3RW0A 4JYBA 4UXNA 1EN4A 3OGCC 2Q7GA 2PF4E 3H1KH 1Q8IA 4B3SB 1ZAUA 4NYKA 1HP8A 3THOA 3STZC 1NTMH 4RWUA 1YSCA 3M8AA 1K33A 3SJCC 3ABMB 4JZGA 3OTOB 2XNDG 1FAFA 1UPGA 3U0ZA 1AI5A 3G80A 2AZ2A 4UUJC 3CCQV 2ZE8A 1I7FA 5LXTB 4PI2A 2EIKB 4R6ZA 5LGTA 3CRAA 2B9ZA 3CP1A 5IYBO 1BHBA 3IC9A 4X89A 2EJ7A 2ZR3A 3ZIAG 5EBWC 2BOBC 4PA4A 4DV7B 2N74A 2OTLV 5H2FZ 1XMQO 3ML0A 4CH5A 1N33O 1VF6A 1OV9A 2KKWA 4GX0A 3RVYA 3DXRA 3DC5A 2XTAA 4WCEV 5J2UA 1FFTB 2WA4A 4FFKA 4F6RB 3G6BA 5IE9A 5KMGA 2JGDA 3MD0A 1P4RA 1VQNV 4UVBA 3AK1A 3JAKA 1AR4A 2IM9A 4IHJB 1B6QA 1YCIA 3CCVV 3LDDA 4JI5B 4ZI7B 3HPLC 1AILA 3T4DA 1FFXA 3BY6A 2DJVA 2HJFC 4J7JA 3GWKC 3FB8C 4LF4B 2M6YA 5KHIA 4HYOA 1VQ6V 2EIJC 2OWOA 3WB2A 1M4UA 5EBMC 3WB1A 1RSOA 5IJ0B 3W7XA 3FB7C 2QWRB 4PDRA 4WFFA 2UU9B 1YXBA 4DUZO 3F5TA 3K0GA 3VQYA 2QDOA 5LYJA 2K9PA 2UUCO 3ZRWA 2Y0PA 1SRYA 1PL4A 2ZIMA 1JFFA 4O2AB 3CX5F 4JI7B 2PYLA 4X62B 1WP7A 3JD1A 1KU9A 4JI6B 3O65A 4DR5O 2A9HA 1I94O 2ILMA 2P5OA 2DMXA 3VQWA 5BMVA 4J10A 4JTCB 4N21A 1SETA 3X2QB 2YC0A 4LWSA 2E74B 1QLNA 1GN3A 4J7ZA 1R6NA 2HR3A 5LP6B 3N2KB 1R6TA 3QTCA 4GCZA 2AXTZ 3H1LH 4MVOA 2FYUH 1GM8A 1S77D 3DGEA 2D3OW 4YJ3B 1P7GA 2ZDIA 4DR1B 2WLMA 1VQ7V 2WLJA 4JI4B 3E22B 2VQFO 1H2MA 5KHGA 1CP9A 1K97A 4ZIBA 3ZCCA 2D2CB 2WLLB 2ATKC 4DR2O 1IX9A 4BIOA 1WN7A 4WFGA 2PY5A 3W7SA 2XOKG 2UXCB 1AJPA 3H01A 4B08A 3O9OA 5EYPA 4KL1A 1Q43A 3OUFA 4KHPO 2E5LB 3SYQA 5JVDA 4JAUA 2DQ3A 4K0KB 4FJCC 3N2GB 5JCOA 4B3MB 3KCYA 2B1GA 2HFEC 1YJNV 1F23A 1I5YA 4LFAB 2ITCC 2YXLA 3ABKB 4FLYA 1EN5A 1QNMA 2FKXA 2CDYA 3L9DA 4ASUG 3HKEB 3LNMB 3A8TA 4MTFA 4NKGB 1M9NA 2WWWA 5H5NA 1V55B 2ZDIC 2NLJC 4RUFA 1OHHG 3A0RA 2M7WA 3D8CA 2CTRA 3DTUB 3L74H 5LHIA 4OX9O 1JJ2U 2YEVB 2EIMC 2R9RB 2IJHA 4UCVA 5LA6A 4FM1A 2HHHO 1HNWB 4OPHA 4GUNA 1YIJV 2HVJC 2R70A 2KSDA 2IU0A 5L3GA 4FLVA 1KC8W 2R9IA 1IVSA 2XAFA 3JALA 2GTAA 1WPBA 4J9YB 2ADQB 3T1HO 5DEDA 5JCOC 1K4DC 3K0DA 4DV2B 3SJAC 3ZEDA 1H2KA 3SPIA 5HFLA 5BY1A 4H37A 1Y76A 2Q7HA 1K73W 2ZKOA 2EIKC 3BA9A 4UCOA 4FM2A 2CTQA 4W4KA 1XNQO 5FPOA 1Q82W 1NVPB 1VF7A 3U10A 4BW9A 4ZHQA 1R1BA 3T1CA 4UCTA 3D3QA 4K35A 4AI8A 2XAJA 3QO5A 1SQQH 2QTOA 1OCZB 3JARA 5CBGA 3U11A 2O57A 3F7YC 4PV1B 2W0FC 4P2ZA 5KA6A 1K34A 1XMQB 1FPOA 2IJKA 1JQ0A 5J2TB 4CC5A 5C8YB 3OGIB 4MTOA 4F6EA 1QVGU 2DE0X 1VF5B 4UB6Z 4JAAA 3SJBC 1DGSA 2FMLA 4C7UA 3ZMTA 2EINB 4P30A 3MAQA 2CE4A 3K03A 3AG4C 3AG2B 2BTQA 4FK5C 4B7KA 2ZNIA 4FFBA 4DV7O 4DV5O 1V54C 1TUEB 3HR0A 2WLNA 2B5UA 2V7QG 4I4TA 4U3FH 4IL6Z 4BAYA 1Y74B 3CRCA 1TUBB 1E1QG 1OCOB 3SPHA 3L70H 1VQOV 4YIOA 2ADPA 4O4LB 4JASA 2ZQMA 1BGYH 4FZ1A 5B1AB 4PDMA 1W2BU 4DUZB 4IYHA 1SKVA 1L1FA 1AP6A 2UUCB 3ZRXA 1K8AW 2UUAB 5LP6C 4QIWF 1OZ0A 3HKBB 5K1PA 2YIBD 4DR5B 4BR6A 1I94B 4YXWG 5JQGB 1DF5A 1W0JG 1FXKB 4H0LB 5CN0A 1BSMA 1FXVA 2H8PC 3K5MA 1NBMG 2CTWA 2IH1C 2CGNA 1ZX3A 4PDVA 3CCEV 3Q4HB 2WAMA 3CC7V 2VWKA 5JH7A 1YF2A 4X62O 1DK1A 3B40A 1CXZB 1IXBA 4JI6O 2VQFB 4K3AA 1VQKV 4YHHO 4QPKA 1JVMA 1S5HC 4B3RB 1SZXA 4E4EA 2GHYA 1Q6UA 3SDLA 5IYDO 4EEQA 3APQA 4YJ2B 2HKOA 2AGAA 4R7CA 1H2LA 4CC6A 1RM1B 2Q8VA 2VQEB 3AG7A 4A5UB 1EN6A 5B1BB 1L0LH 4KHPB 4KUMA 3C3SA 3ABKC 1D5NA 1KQSU 1QCEA 5JJNB 4DR1O 3AK3A 1FKAO 2G38A 5IT9N 3CC2V 4JI4O 1VQMV 5FPRA 5B3SC 1V55C 3K3WA 3EVKA 5ITZB 4I7ZB 2P4KA 1XDCA 2JEXA 4OGQB 2QKCA 4MSWC 2UXCO 1ZWIC 5LOVA 1VMGA 4J41A 3BCCH 5CA0A 2E5LO 2QWOB 3P32A 5EBLC 1Q3EA 4K0KO 3WU2Z 1SC5B 5IYZA 4TUYA 4RO2A 3JYCA 2XAHA 1XILA 1ZUQA 1EZVH 3ABUA 1H8HG 2XAQA 2ZCEA 4LFAO 5C8YA 1AJQA 2YI9A 2LO1A 3B8MA 1GM9A 1QR9A 4LH6A 2OCCB 4X66B 5LGNA 3ASNC 1NH2D 2R9AA 3OFNG 3D36A 3PN1A 5JWPA 1N0JA 2JVDA 5IWAO 5JJEB 2Q69A 4CS2A 4XDJA 4O2BB 5IY5B 2XHBA 4WBNB 1BQ0A 4GT1A 2H94A 3FKSG 3T1HB 4LF5O 3VBBA 2CK3G 1JJOA 2UXDB 1N34B 3ETQA 3OAAG 4MW3A 3F7VC 1AJNA 1HNWO 4X88A 2JJ2G 3CCMV 1Y74A 1Y67A 1I0HA 2Q67A 5E1AC 3ASOB 3KG2A 1MSWD 1NU1H 1NR1A 3FAVA 1TVKA 1OCCB 3JATA 5F2VO 1GM7A 1COWG 4DV2O 3ETGA 4JV5B 3M99B 4TWKA 1MG1A 4ZKIA 4LBEC 4MVQA 3OT7A 4DV1O 1E79G 2Z5UA 4PD4F 3VOUA 2RN9A 4WF9V 2E76B 3D36C 2LFRA 3JAWB 3CMEV 3B2EE 4ABMA 2CTPA 4I55A 4JAVA 1KECA 2OIEA 3B8NA 1ZL8B 1WAZA 1Y4MA 3CRRA 2QKAA 3IAYA 4CZZA 1R3JC 3JD2A 3EXAA 4TV9A 1OCOC 2LGWA 2JJ1G 4DV5B 2WPDG 5J9PC 3HKCB 4DW1A 1XNRB 4G28B 4FLTA 2DN9A 2F4VB 4Z1MG 5B1AC 3B09A 2HG5C 2WLKA 3CRMA 4F4LA 1AP5A 2QR4A 1WA8B 2YICA 1Q7YW 1JX9A 4B7EA 2EBOA 1QR8A 4PDLA 5L3BA 4DRXB 1N4CA 1FXHA 2GTSA 1GK9A 4D7SA 1MOFA 2ZM6B 1R73A 3S3WA 1NQTA 1VQLV 1IBMB 5LMUO 3WG7B 4UVAA 2Y0IA 2DYSC 5ITZA 2CAZC 1MSDA 1T5EA 2EZPA 4GX2A 3SYCA 4TV8A 1BZKA 4DO2A 3RGBA 4H44B 4X1YA 4UCSA 4YY3B 4OPAA 2Y69B 2QGNA 3H1IH 4DV4B 1FD9A 3B77A 5EZYB 3HKDB 1Q6HA 1GN2A 3K9AA 5CB4A 1XOUA 3FYEB 4EB6A 5CA1A 4OXSA 4TOIA 4LNUA 4D6TH 3I5DA 4LR3A 2UUAO 4EFBA 3ZHRA 2EX3A 4JI2B 3G4SV 1RM1C 2Q9LA 4AILC 1ROPA 5B1BC 4YHHB 1WJZA 3WFVA 4U3JB 1UJWB 1JA8A 4ZOLB 1MMMA 3IJ4A 4U7OA 2ZR2A 2FL4A 1H38A 3BVOA 4X8AA 1JOYA 4FLZA 4O4HB 1AR5A 4X1KB 3RYIA 2JIZG 3ZS8C 5EIBC 3JD3A 3CRQA 3RWRD 4B3RO 4HNAB 4I50A 2UXNA 3MHHC 3OEEG 4X20B 3CJHB 5GONB 4O4JB 2VQEO 5KX5B 2HVKC 4BW5A 3CE2A 2W6JG 2QEXV 3ZRSA 2QKSA 1OCRB 3BPZA 2FB5A 4KFMA 4I0XB 4LF7O 2IU3A 4FVMA 4HBNA 4UFZA 2PTMA 3AG1B 2VS0A 5LXTA 4O4IB 2BE3A 2YXYA 3C90A 1GRJA 1ZL8A 4J42A 2GSMB 4HAMA 4LF6B 1KKCA 1V9PA 3UT5B 2LGQA 5IWAB 3ZRVA 5L3EA 4LF5B 2YXHA 3K9SA 1IURA 2F66C 3AG3B 2Q7EA 3ICXA 3G67A 3JSLA 1M57B 1ORQC 2NN4A 4X66O 4K8XA 3L75H 2P67A 4F6RA 1WA8A 2PI5A 4JI3O 4DYLA 5LMNB 2KG7B 1XI1A 1F7YA 2QSAA 5EC2C 4IHJA 1P84F 1O9GA 2ETNA 4ZI7A 1KYOF 3ABMC 2UXDO 1N34O 1S76D 1XEQA 4DK0A 4FPPA 1MA1A 4DV1B 1S5LZ 1THZA 1GH6A 4PI0A 3FB6C 4CS3A 4PA6A 1WNSA 2WA3A 3RYHB 2GBOA 1M56B 3L71H 1VARA 3SPCA 4LP8A 1XBLA 1PNMA 3RYFB 2RNBA 4FIPC 1VP7A 3CD6V 3ZHQA 5IJ0A 3K04A 4KXRA 4WFEA 4W4LA 2LFSA 4I9WA 4J9ZB 1Q90D 2RDCA 3L73H 4JV5O 4X9QA 4JI1O 3PJSK 3P3PA 3D3IA 5LHHA 4X1IB 3CSXA 3LNNA 4O2AA 4X65O 1G1XB 1AROP 4P9OA 3SYPA 1YITV 2Y4TA 3T1YO 2E3CA 1XREA 2P7TC 3OMIB 1M1KW 1H2NA 3JASB 2XT9A 2QM7A 4TQFA 4RQFA 1HNZB 3TCUA 4DV6O 5LP6A 2QA4V 3N2KA 2NNUA 2LQTA 1SERA 1E1RG 2ZT9B 1TAEA 4DK1A 2A0LA 4UCUA 2QWNB 1GMGA 2JK5C 4MTGA 5K1XA 4YJ3A 1PM9A 3BAAA 4AQYB 3RFRA 1X59A 4Q6GA 5IJ9B 3E22A 1A32A 1ENVA 4LFBB 1XNRO 5LMUB 5GW7A 5DM6V 1QLEB 2F4VO 3CB2A 2WLIB 2WLLA 4LFCB 1QQCA 4HNAA 4LF9O 3MHSC 3ZMUA 5AG2A 4TSFG 1PKXA 4BWAA 4DR4O 2P90A 3CHXA 4JYYA 1GN4A 2ZM6O 1HNXB 3N2GA 3TXSA 2Q6AA 1IBMO 3MDSA 3ZBHA 5KHKA 2P6JA 1WPXA 1SA0B 3X2QC 4NR1A 4LCUC 3BRCA 3OD4A 3L72H 3WB0A 3CWBH 2UXBO 1XQ8A 2LP7A 3B4SA 4JGSA 1XHZA 4MTXA 3ZJZA 2EJRA 3K57A 2WLHA 3HKEA 5B1NA 2YUAA 4YY3O 4DV3O 3UT5A 4QNHB 3IC7A 2JGUA 2EILB 4DV4O 1NTKH 1URFA 4PA7A 4UB8Z 2ZD9A 1M93A 1Z5WA 3CCUV 1Q6IA 2A7WA 1SQBH 2E75B 2BTOA 2YEVA 4L87A 3VQXA 2HLDG 2IH3C 1VQPV 3AK2A 1FJGO 1NJIW 2DWDC 3UCSC 3OMNB 4D7TA 4JI2O 4WFAV 2KQXA 4MVSA 4RQEA 1OCRC 1IDSA 1QBZA 1TGOA 1MABG 5LBQA 4IGGA 1N36B 3A0HZ 2DOSA 1KUQA 3LSUA 4PA9A 1HR0B 3DXRB 1YHQV 4K8ZA 5J2UB 4EFEA 4DR6B 2V4DA 2IBZH 1YJWV 2QWQB 4LF7B 1PNLA 1YZBA 3DSQA 3SJQC 5KMGB 3G71V 1KKDA 2JGDB 3E83A 5C93A 3OUSA 3ZMVA 3CC4V 2XASA 2DYRB 3JAKB 1W0KG 2ZE5A 3OTFA 3AG3C 4X1IA 1FFXB 1M57C 1U97A 4CBCA 4CS4A 3CPWU 3APOA 1BCCH 1J5EB 3P3NA 5H6QA 5J2TA
chains in the Genus database with same CATH topology
1VQ8V 1K92A 3ABKB 1EFRG 2IW5A 3CCJV 1S0VA 1FXHA 4TT3G 4JTAB 4HZ3A 1GK9A 1MOFA 4R50A 1R3LC 3OMAB 4ASUG 3TK1A 1EZJA 1R73A 3LNMB 1NQTA 3OW2U 1VQLV 4MTFA 3WG7B 4UVAA 3LSQA 1NKDA 1M9NA 2DYSC 2WWWA 1V55B 2ZDIC 2NLJC 3ABLB 4RUFA 1OHHG 3A0RA 5CMUA 2M7WA 3BEHA 2EZPA 1IXMA 4GX2A 3SYCA 3DTUB 5LHIA 3IFXA 1SZTA 1Q81W 3OR6C 1JJ2U 4DO2A 2QE7G 1BMFG 2YEVB 4QJFB 2EIMC 2R9RB 3I55V 2IJHA 4XDLA 2X6AA 2EZOA 4PA3A 2WSSG 2Y69B 3E89A 1YIJV 2Z3YA 2DQ0A 3F5WC 3ZN1A 2HVJC 2Y48A 3AEIA 3B77A 1VQ5V 4Q20A 1JCHA 2IU0A 5L3GA 1AR1B 3ETEA 1KC8W 2R9IA 3K9AA 2XAFA 1OCZC 3FYEB 1BHAA 4OXSA 5B1OA 5LGUA 3T2MA 1FS0G 1Y66A 4MS2A 4J9YB 5CBHA 2F43G 1J95A 1KP2A 3R65A 4XDKA 1GKFA 1K4DC 3K0DA 3G4SV 1RM1C 2DYSB 2KB1A 3SPIA 5HFLA 1ROPA 2X6BA 5B1BC 3I56V 4H37A 2K1EA 1K73W 1RPRA 2EIKC 3E86A 2EIJB 1K4CC 3WFVA 5EK0A 2DW4A 3OEHG 4DXWA 1N8RW 1YI2V 1UJWB 4H33A 2EIMB 2OTJV 3RVZA 4U7OA 1Q82W 1NR7A 2ZR2A 4BIUA 1NVPB 1K9MW 4LC1A 2EINC 1H38A 4RAIA 2AHZA 3T1CA 4X8AA 3AG2C 1FXKA 2MK3A 2X6CA 1JOYA 3AG1C 1XL4A 3E8BA 1HWYA 1WLEA 2JIZG 2XAJA 3QO5A 1CPYA 1OCZB 2QTOA 3JD3A 5CBGA 3P30A 4U7NA 1QLEC 3F7YC 3QO7A 1KD1W 5LHGA 2W0FC 4P2ZA 5KA6A 1K34A 4MVMA 2UXNA 3W7WA 2IJKA 1JQ0A 3MHHC 3OR7C 3OEEG 1G4YB 3OE7G 3JD0A 4MTOA 3SPJA 5L3DA 2HVKC 4BW5A 3GB7C 1QVGU 2W6JG 2QEXV 3JD4A 3ZRSA 2QKSA 1OCRB 4R8CA 5L3FA 1NH2B 3UM7A 3ZMTA 4KFMA 4I5SA 3W7TA 2EINB 4MVUA 1K5QA 4P30A 2ZXWB 5IDJA 4QPJA 2IU3A 3K03A 3AG4C 5KA5A 3AG2B 4FK5C 1I5XA 3AG1B 1CEZA 3FYIB 4G2KA 2XAGA 1V54C 1TUEB 2WLNA 2B5UA 2PI4A 2V7QG 5HFMA 4WFHA 2GSMB 2JDIG 4HAMA 1DTOA 3E35A 1FXKC 3EHBB 3ZRVA 4BAYA 1E1QG 1LNQA 1OCOB 1R6KA 2EILC 3SPHA 5L3EA 3ZRWB 1VQOV 4UV9A 1M56C 2W6IG 1DLBA 4JASA 4XBFA 3AG3B 2ZQMA 1QVFU 1K7DA 1BL8A 3SYAA 1S72V 5B1AB 5BZBA 4PDMA 3ZMZA 1M57B 3HB3B 1ORQC 1W2BU 2WLIA 2QM8A 2DWEC 1L1FA 5KUMA 1AI4A 2P67A 3AG4B 2PI5A 4MVZA 3W7UA 3ZRXA 1YTFD 1K8AW 3QNEA 1V54B 5EC2C 4QIWF 3E8FA 3CYOA 1OZ0A 3FB5C 4MVRA 4MW8A 3ABMC 4YXWG 5H9CA 3T4ZA 1DF5A 1W0JG 1XL6A 1FXKB 5CN0A 1RPOA 1S76D 1H8EG 4PELA 4FPPA 3LDEA 1FXVA 2H8PC 3LUTB 4JTDB 1NBMG 1THZA 1K3EA 2IH1C 4GX5A 3FB6C 5FL7G 4PA6A 1M56B 2AHYA 1EBOA 1AI6A 3SPCA 4LP8A 4PDVA 3CCEV 1PNMA 2WAMA 3CC7V 4FIPC 4MT8A 3G6EV 3CD6V 2Q68A 4JPRA 1G8MA 1GTOA 3K04A 2FTKA 4WFEA 2DYRC 1DF4A 3RW0A 4QE9A 2V1DA 4JYBA 2LFSA 4I9WA 4UXNA 3SPGA 2B1IA 4J9ZB 3OGCC 2UXXA 1P7BA 1VQKV 4G27B 4QPKA 3PJSK 3D3IA 1JVMA 5LHHA 1S5HC 2GHYA 3CXCU 5IYDO 3STZC 1AROP 3LDCA 5EC1C 2HKOA 1YSCA 4R7CA 1AI7A 1K33A 1KP3A 4P9OA 3SYPA 1YITV 3ABMB 2XNDG 1JPXA 1RM1B 1F4MA 3ETDA 1AI5A 3LSSA 4UVCA 4UUJC 5B1BB 4KUMA 3CCQV 3ABKC 1KQSU 1QCEA 2EIKB 2P7TC 3OMIB 1M1KW 4R6ZA 5LGTA 2QM7A 3CC2V 4RQFA 3CP1A 1VQMV 2OCCC 3TCUA 2QA4V 2NNUA 3RBZA 1SERA 1E1RG 5IYBO 1BHBA 5B3SC 1NVPD 3ABTA 1V55C 2A0LA 3ABLC 3K3WA 5CA3A 4X89A 1GMGA 2JK5C 2ZR3A 3ZIAG 5EBWC 2BOBC 4MTGA 4PA4A 2OTLV 2JEXA 3TETA 3ML0A 4MSWC 5IY5C 1ZWIC 3GWOA 4GX0A 3RVYA 1ENVA 3UKMA 4WCEV 4EKWA 1FFTB 1H2GA 5GW7A 5DM6V 1QLEB 4ZBMA 2WLIB 3P32A 2WLLA 5EBLC 4WFBV 1VQ9V 1PNKA 3MHSC 3ZMUA 5H6RA 3MD0A 1P4RA 1VQNV 4RO2A 3JYCA 2IJJA 2XAHA 3ZN0A 1YTFB 2X7RB 3ASOC 4UVBA 3ABUA 1H8HG 2XAQA 4TSFG 5KUKA 1AJQA 1PKXA 1B6QA 1OCCC 3CCVV 3E2EA 3LDDA 3B8MA 1GM9A 4GX1A 1QR9A 3JCZA 2OCCB 2P90A 2X0LA 5LGNA 3HPLC 2BOCC 3T4DA 3CCRV 3ASNC 3BY6A 3IGAC 5B3SB 2HJFC 1NH2D 2ITDC 3FB8C 3OFNG 3D36A 2Q6AA 4HYOA 2IJIA 2Q69A 1VQ6V 2EIJC 1WPXA 2P6JA 4XDJA 3EFFK 3X2QC 4JYCA 4LCUC 4BIZA 5IY5B 4GT1A 2H94A 3FKSG 3VBBA 1M90W 2CK3G 2LP7A 4JGSA 5EBMC 4MTXA 3ZJZA 2EJRA 4FMTA 2WLHA 3W7XA 3FB7C 3OAAG 4PDRA 4MW3A 3F7VC 1AJNA 4WFFA 5B1NA 4X88A 2A79B 1PD3A 2JJ2G 4QNHB 2C2AA 3IC7A 3OM3B 3CCMV 3K0GA 2EILB 2Q67A 4PA7A 1GO3F 3ASOB 5E1AC 2ZD9A 3ZRWA 3CCUV 3KG2A 1MSWD 1SRYA 3E8HA 1NR1A 1OCCB 2YEVA 4L87A 1S3JA 2HLDG 3JD1A 2IH3C 3ZMSA 1VQPV 1GM7A 2OT5A 4RUEA 4E2LA 3ASNB 1NJIW 3K06A 2DWDC 3OMNB 1COWG 3ETGA 3SYOA 2A9HA 3M99B 3STLC 1R3KC 4TWKA 1MG1A 4WFAV 4ZKIA 5CBFA 4LBEC 4MVQA 4JTCB 4N21A 1SETA 3X2QB 1E79G 4MVSA 4RQEA 1QLNA 1R6NA 2HR3A 2Z5UA 3VOUA 1OCRC 4GCZA 1QBZA 4WF9V 1MABG 3QO8A 1Q86W 1PL0A 4MVOA 5LBQA 2ZXWC 1GM8A 4KP4A 3K08A 1S77D 2LFRA 3DGEA 3CMEV 2D3OW 2ZDIA 1F4NA 4PA9A 2WLMA 1VQ7V 4JAVA 2WLJA 1KECA 1YHQV 2JEUA 1K5SA 4N23A 3B8NA 1CP9A 1K97A 5L3CA 3ZCCA 1Y4MA 3CMAV 1YJWV 2WLLB 2ATKC 1PNLA 3SJQC 3WG7C 3G71V 1KKDA 4JF3A 1R3IC 4CZZA 4WFGA 3E83A 1R3JC 5C93A 3OUSA 3ZMVA 3JD2A 3W7SA 2XASA 3K79A 2DYRB 1OCOC 2XOKG 3NXSA 3CC4V 3CCLV 1AJPA 2JJ1G 3H01A 1F51A 2WPDG 1W0KG 4QE7A 5J9PC 5IYCO 4P9PA 3OUFA 4G28B 4UV8A 3AG3C 2YSUB 3SYQA 1VQ4V 1SESA 4Z1MG 4JAUA 5B1AC 1M57C 2DQ3A 2HG5C 2WLKA 2Y69C 3E8GA 4CBCA 3CPWU 4FJCC 4F4LA 2B1GA 1JX9A 1Q7YW 2HFEC 5H6QA 1F23A 2EBOA 1QR8A 1I5YA 1YJ9V 1YJNV 2ITCC 4PDLA 3CCSV 5L3BA 5DN6G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OR7 C;  1G4Y B;  3K04 A;  5EBM C;  4JTA B;  4WFE A;  2DYR C;  3ZJZ A;  3RW0 A;  2WLH A;  4HZ3 A;  4QE9 A;  4MTO A;  4I9W A;  3FB7 C;  4R50 A;  3SPJ A;  1R3L C;  4MW3 A;  3F7V C;  4J9Z B;  2HVK C;  3OGC C;  4PDR A;  4WFF A;  2A79 B;  4X88 A;  4BW5 A;  4QNH B;  3LNM B;  3GB7 C;  1P7B A;  4MTF A;  4G27 B;  3K0G A;  3PJS K;  3ZRS A;  2QKS A;  2DYS C;  4RUF A;  1JVM A;  2NLJ C;  4R8C A;  2Q67 A;  1S5H C;  4PA7 A;  5E1A C;  3UM7 A;  2ZD9 A;  4KFM A;  3BEH A;  3KG2 A;  4MVU A;  3E8H A;  4GX2 A;  4P30 A;  3STZ C;  3LDC A;  3SYC A;  5EC1 C;  3K03 A;  2YEV A;  3AG4 C;  4R7C A;  3IFX A;  3OR6 C;  4P9O A;  3SYP A;  2IH3 C;  2EIM C;  2R9R B;  4RUE A;  4XDL A;  2X6A A;  3K06 A;  2DWD C;  4PA3 A;  4UUJ C;  1V54 C;  3SYO A;  2WLN A;  2A9H A;  3ABK C;  3E89 A;  3STL C;  1R3K C;  2P7T C;  4TWK A;  4WFH A;  3F5W C;  4R6Z A;  5CBF A;  4LBE C;  2HVJ C;  4MVQ A;  4JTC B;  5CBH A;  2OCC C;  3TCU A;  4MVS A;  3RBZ A;  3SPG A;  5B3S C;  1LNQ A;  3VOU A;  2EIL C;  3SPH A;  1OCR C;  1V55 C;  2A0L A;  3ABL C;  1OCZ C;  4X89 A;  2JK5 C;  4OXS A;  3T2M A;  5EBW C;  2BOB C;  4MS2 A;  4J9Y B;  4MTG A;  4PA4 A;  4MVO A;  1J95 A;  1M56 C;  2ZXW C;  3K08 A;  3R65 A;  4XDK A;  3TET A;  1K4D C;  3K0D A;  4MSW C;  5IY5 C;  1BL8 A;  1ZWI C;  3SYA A;  4GX0 A;  3RVY A;  4PA9 A;  2WLM A;  4PDM A;  5BZB A;  2KB1 A;  1ORQ C;  3SPI A;  3UKM A;  2X6B A;  2WLI A;  5B1B C;  2WLJ A;  4EKW A;  2DWE C;  4H37 A;  2K1E A;  5KUM A;  4ZBM A;  2WLI B;  2WLL A;  2EIK C;  4MVZ A;  3E86 A;  5EBL C;  1K4C C;  5EK0 A;  2WLL B;  2ATK C;  4DXW A;  4H33 A;  3SJQ C;  3WG7 C;  4RO2 A;  3JYC A;  1KKD A;  1R3I C;  3RVZ A;  4WFG A;  3ASO C;  1R3J C;  3E83 A;  3OUS A;  5EC2 C;  5KUK A;  1OCO C;  2EIN C;  4RAI A;  2AHZ A;  3E8F A;  3FB5 C;  4MVR A;  3T1C A;  1OCC C;  5J9P C;  4QE7 A;  4X8A A;  3AG2 C;  3LDD A;  4P9P A;  2X6C A;  3OUF A;  4MW8 A;  4GX1 A;  3ABM C;  4G28 B;  3T4Z A;  1XL6 A;  3AG1 C;  1XL4 A;  3AG3 C;  3E8B A;  3HPL C;  2BOC C;  3SYQ A;  3T4D A;  3ASN C;  3LDE A;  3IGA C;  2H8P C;  2HJF C;  3LUT B;  4JTD B;  5B1A C;  2ITD C;  3FB8 C;  2IH1 C;  2WLK A;  1M57 C;  2HG5 C;  2QTO A;  2Y69 C;  2Q6A A;  3E8G A;  4GX5 A;  4CBC A;  5CBG A;  3FB6 C;  4PA6 A;  4F4L A;  1QLE C;  2AHY A;  4HYO A;  3SPC A;  2Q69 A;  4LP8 A;  3F7Y C;  4PDV A;  2HFE C;  2EIJ C;  3X2Q C;  4XDJ A;  3EFF K;  4LCU C;  2ITC C;  2W0F C;  4PDL A;  4P2Z A;  4MVM A;  2Q68 A; 
#chains in the Genus database with same CATH topology
 1VQ8 V;  1K92 A;  2UUB B;  1EFR G;  4NTY A;  3CCJ V;  1VIB A;  4TT3 G;  4HZ3 A;  1R3L C;  1RSO B;  3OMA B;  5BR8 B;  1EZJ A;  2AW9 A;  3ZHU A;  3LSQ A;  1NKD A;  4JI3 B;  4LF6 O;  4YIP A;  3ZHT A;  3ABL B;  3UO2 A;  1LUW A;  5CMU A;  3BEH A;  4IT5 A;  5LYJ B;  1IXM A;  4FZ0 A;  4DR3 O;  3IFX A;  1SZT A;  1Q81 W;  3OR6 C;  4GZR B;  1JFF B;  2QE7 G;  4QJF B;  3I55 V;  5IJ9 A;  3H1H H;  2EZO A;  4PA3 A;  2WSS G;  3ZHV A;  2ZIO A;  2DQ0 A;  3F5W C;  3ZN1 A;  2A3Q A;  2Y48 A;  5BMV B;  3AEI A;  1TUB A;  4Q20 A;  2W0X A;  1AR1 B;  3ETE A;  1XUQ A;  4LWS B;  1OCZ C;  5LMN O;  1BHA A;  2QWP B;  5B1O A;  3T2M A;  1FS0 G;  1Y66 A;  4MS2 A;  4O4L A;  5CBH A;  1J95 A;  1KP2 A;  1Z5V A;  2P4V A;  1WB8 A;  3SR2 C;  1GKF A;  1ZLZ A;  2Q73 A;  4CH4 A;  1EM1 A;  3H1J H;  4JI1 B;  2X6B A;  3JCU Z;  2RCV A;  2YIA A;  2YID A;  3E86 A;  1K4C C;  4X65 B;  2DW4 A;  4DXW A;  2A06 H;  2EIM B;  2Z0A A;  1KB9 F;  2H3O A;  3RVZ A;  1NR7 A;  4BIU A;  1K9M W;  3RN4 A;  4IYI A;  3HKB A;  3T1Y B;  1BQZ A;  2EIN C;  2AHZ A;  2HEP A;  5JQG A;  3AG2 C;  1FXK A;  2HJD A;  3FX7 A;  2X6C A;  5EYP B;  1XL4 A;  1WB7 A;  3K5N A;  1KMI Z;  1WLE A;  4DV6 B;  5JVD B;  3UO3 A;  1CPY A;  4DV0 O;  1QLE C;  4JZ2 A;  3Q4H A;  4NXM B;  2L35 A;  2P22 C;  1KD1 W;  3JSN A;  4MVM A;  1IZ3 A;  3W7W A;  4DW0 A;  3R66 A;  1I08 A;  4GKJ B;  3SPJ A;  2BSK B;  3GB7 C;  2OIG A;  4R8C A;  4LF9 B;  5L3F A;  1NH2 B;  3UM7 A;  4NVP A;  1HNZ O;  4YJ2 A;  4DUY B;  3N27 A;  2ZXW B;  5KA5 A;  1XMO O;  1I5X A;  2HP8 A;  1MZF A;  1JMK C;  3QF7 A;  5A9G A;  3FYI B;  4DR4 B;  2ARH A;  4AQY O;  2XAG A;  5LA6 B;  1YDX A;  3CXH F;  2JDI G;  2LW1 A;  4LFB O;  3E35 A;  1FXK C;  3EHB B;  2CGO A;  4LFC O;  1R6K A;  2EIL C;  1GN6 A;  4UV9 A;  4DR7 B;  2UXB B;  3JAL B;  3QVN A;  4IIJ B;  1QVF U;  4J80 A;  2AZ0 A;  3TGU H;  1S72 V;  3J81 N;  1H2S B;  2PGG A;  4DV3 B;  3HB3 B;  2BCC H;  1AB3 A;  3A0B Z;  1FYJ A;  1AI4 A;  3AG4 B;  1HNX O;  1Y76 B;  3W7U A;  5KAF Z;  1YTF D;  1NS1 A;  1V54 B;  4NTW A;  2ZIN A;  1BE3 H;  4TQD A;  3ZHS A;  1FJG B;  4B3T B;  3FB5 C;  2MW2 B;  2YIB A;  4X64 O;  1PV0 A;  4MW8 A;  4ZHQ B;  5H9C A;  4H13 B;  1XL6 A;  3KKY A;  1RPO A;  1H8E G;  4PEL A;  3RT3 C;  2CUG A;  1LUV A;  4Z1V A;  5JJJ B;  4NXN O;  1VF6 C;  4GX5 A;  2F93 B;  1KBH A;  4J7K A;  3JAR B;  4O2B A;  3SGI A;  4WBN A;  5GTI Z;  1N32 B;  1SQX H;  3G6E V;  1L0N H;  4JPR A;  1G8M A;  1GTO A;  2JS3 A;  2DYR C;  1DF4 A;  4QE9 A;  2V1D A;  3BHP A;  3JAM N;  3SPG A;  2B1I A;  2UXX A;  1P7B A;  4G27 B;  2OCH A;  3VQV A;  3CXC U;  3A2F A;  3LDC A;  2ZE6 A;  1SS3 A;  5EC1 C;  1YVW A;  1AI7 A;  1KP3 A;  1NZ6 A;  1HW7 A;  4GLX A;  1JPX A;  1F4M A;  3ETD A;  2BTQ B;  3LSS A;  4UVC A;  1N36 O;  1QU7 A;  4FFB B;  1BS3 A;  1W59 A;  4AHC A;  2R72 A;  1HR0 O;  4I4T B;  2OCC C;  3UQ8 A;  3RBZ A;  4JYA B;  4DR6 O;  2L6L A;  1NVP D;  3ABT A;  3ABL C;  5CA3 A;  1IBK O;  3JAW A;  1AVM A;  3TET A;  5FLX N;  5IY5 C;  2OYQ A;  4GYC B;  3GWO A;  1BT8 A;  3RYC B;  3UKM A;  4EKW A;  1H2G A;  4JI8 O;  1PP9 H;  4QGP A;  4ZBM A;  1NT2 B;  1VQ9 V;  4WFB V;  4GKK O;  3QG5 A;  1PNK A;  5H6R A;  4DR3 B;  2IJJ A;  3ZN0 A;  1YTF B;  2X7R B;  3ASO C;  1J5E O;  5KUK A;  4LF8 O;  3HKC A;  1NI8 A;  2VWJ A;  1OCC C;  3E2E A;  2BSK A;  4UCR A;  2UUB O;  1B06 A;  3CS5 A;  4GX1 A;  3JCZ A;  4ICG A;  1HDJ A;  2X0L A;  2BOC C;  3CCR V;  2GUZ B;  3IGA C;  5B3S B;  4NB5 A;  2ITD C;  5BR8 O;  4JI0 O;  2PUS A;  2IJI A;  1U96 A;  3EFF K;  4DRX A;  4JYC A;  4BIZ A;  1JR9 A;  1M90 W;  5KLV H;  1D5A A;  1G6U A;  5JH7 B;  4FMT A;  1SQV H;  2A79 B;  1PD3 A;  2C2A A;  3OM3 B;  4FLW A;  1GO3 F;  1MNG A;  1Y6X A;  3E8H A;  4IIJ A;  1S3J A;  3ZMS A;  4RUE A;  2OT5 A;  4E2L A;  3ASN B;  2F95 B;  3K06 A;  2Q0O C;  3H9V A;  3SYO A;  3STL C;  1R3K C;  4LH7 A;  5CBF A;  5EZY A;  1IBL O;  3HKD A;  4DV0 B;  1M5I A;  3CEI A;  3QO8 A;  1Q86 W;  2P06 A;  1PL0 A;  2ZXW C;  4KP4 A;  3K08 A;  3J80 N;  5E79 Z;  1F4N A;  4FLU A;  3C3T A;  5LOV B;  5KHJ A;  2JEU A;  1K5S A;  4N23 A;  4U3J A;  5B66 Z;  5CA0 B;  5L3C A;  3CMA V;  4B3S O;  4ZOL A;  3K5L A;  3WG7 C;  1XMO B;  4JF3 A;  1R3I C;  4NXM O;  5KHH A;  5IYZ B;  4TUY B;  3K79 A;  1N33 B;  3NXS A;  3CCL V;  3OTO O;  1F51 A;  4QE7 A;  5IYC O;  4P9P A;  4O4H A;  4X1K A;  4UV8 A;  4GKJ O;  1MZE A;  2YSU B;  4FLX A;  3FFQ A;  5B5E Z;  1VQ4 V;  1SES A;  2LW7 A;  2Y69 C;  3E8G A;  2RQ6 A;  1S5J A;  1B04 A;  3K58 A;  2CH7 B;  4DUY O;  1YJ9 V;  3CCS V;  4CH3 A;  2F1M A;  5DN6 G;  1Z2G A;  2IW5 A;  4X20 A;  3CJH A;  5GON A;  1S0V A;  4O4J A;  5KX5 A;  4JTA B;  5GTH Z;  4R50 A;  1L8D A;  3TK1 A;  2PYJ A;  3OW2 U;  1B3Q A;  1SQG A;  3BA8 A;  4I0X A;  1TA8 A;  1WP8 A;  2GDS A;  3FAV B;  1TVK B;  2RMK B;  1BMF G;  4X64 B;  4O4I A;  3JAT B;  4DR7 O;  3RYC A;  4XDL A;  2X6A A;  5FNV B;  5EIB D;  3TXQ A;  1LR1 A;  3ZX6 A;  4JI5 O;  3E89 A;  2Z3Y A;  4NXN B;  2ODM A;  2GV9 A;  4PHZ A;  5TIS Z;  1VQ5 V;  2ZNJ A;  1JCH A;  4LF4 O;  5LGU A;  5BXZ A;  2F43 G;  3R65 A;  4XDK A;  1Q5O A;  4B3T O;  2GUZ A;  2DYS B;  2KB1 A;  2Q5Z A;  3I56 V;  4I55 B;  1YEW A;  2K1E A;  4NTX A;  2UU9 O;  1UFI A;  1RPR A;  4FM0 A;  1X4T A;  1ZSP A;  2EIJ B;  5EK0 A;  2KG7 A;  3K5O A;  1RP3 B;  3OEH G;  1N8R W;  1YI2 V;  4H33 A;  2OTJ V;  1OJH A;  3M7M X;  4LC1 A;  4JI7 O;  1N32 O;  4RAI A;  3DC6 A;  1ZTE A;  4TV9 B;  5D5P A;  1QHT A;  2MK3 A;  3AG1 C;  3E8B A;  1HWY A;  1XHX A;  3BAB A;  2QJ1 A;  2VRZ A;  2YDE A;  3RYH A;  4DR2 B;  3P30 A;  4U7N A;  3RYF A;  1O9H A;  1IBK B;  3QO7 A;  2QM4 A;  5LHG A;  5D5Q A;  2YS8 A;  3BFR A;  1SQP H;  3OR7 C;  1G4Y B;  3J7A U;  3OE7 G;  3JD0 A;  3KZI Z;  5L3D A;  4JI8 B;  1SF9 A;  2F23 A;  5A2Q N;  3JD4 A;  4GKK B;  1N0N A;  4I5S A;  3W7T A;  4MVU A;  1K5Q A;  5IDJ A;  4JYA O;  4QPJ A;  4LF8 B;  1SQF A;  2ZE7 A;  2QTS A;  1CEZ A;  4TV8 B;  4PJ0 Z;  4Z2W A;  4G2K A;  4X1Y B;  2PI4 A;  3JAS A;  1VEW A;  5HFM A;  4WFH A;  1DTO A;  4JI0 B;  2XUM A;  4CH6 A;  1RFY A;  3NR7 A;  3S3X A;  4OX9 B;  1LNQ A;  5LL6 Y;  4B3M O;  3ZRW B;  5CB4 B;  3GVM A;  1M56 C;  4EB6 B;  1US6 A;  2N05 A;  2W6I G;  5CA1 B;  1DLB A;  4LNU B;  2HHH B;  5DEC A;  4XBF A;  1K7D A;  1BL8 A;  3SYA A;  5BZB A;  3ZMZ A;  2PZS A;  2WLI A;  2QM8 A;  2DWE C;  5KUM A;  4MVZ A;  2CH7 A;  4J11 A;  2RJZ A;  3QNE A;  1P49 A;  4I9Q A;  2N04 A;  4L8J A;  5KAI Z;  2NR5 A;  3CYO A;  3E8F A;  2Y4U A;  3FD9 A;  4MVR A;  1GAX A;  3KCX A;  3T4Z A;  1NTZ H;  2Q0A A;  1IBL B;  3LDE A;  3LUT B;  4JTD B;  2Q4P A;  1K3E A;  1D2D A;  3RYI B;  5FL7 G;  1XNQ B;  3TJT A;  2AHY A;  1SA0 A;  1EBO A;  1AI6 A;  1PPJ H;  3K59 A;  4MT8 A;  2YI8 A;  5FNV A;  2Q68 A;  2LJ2 A;  2EUL A;  4I50 B;  2JS5 A;  2FTK A;  2JRI A;  3RW0 A;  4JYB A;  4UXN A;  1EN4 A;  3OGC C;  2Q7G A;  2PF4 E;  3H1K H;  1Q8I A;  4B3S B;  1ZAU A;  4NYK A;  1HP8 A;  3THO A;  3STZ C;  1NTM H;  4RWU A;  1YSC A;  3M8A A;  1K33 A;  3SJC C;  3ABM B;  4JZG A;  3OTO B;  2XND G;  1FAF A;  1UPG A;  3U0Z A;  1AI5 A;  3G80 A;  2AZ2 A;  4UUJ C;  3CCQ V;  2ZE8 A;  1I7F A;  5LXT B;  4PI2 A;  2EIK B;  4R6Z A;  5LGT A;  3CRA A;  2B9Z A;  3CP1 A;  5IYB O;  1BHB A;  3IC9 A;  4X89 A;  2EJ7 A;  2ZR3 A;  3ZIA G;  5EBW C;  2BOB C;  4PA4 A;  4DV7 B;  2N74 A;  2OTL V;  5H2F Z;  1XMQ O;  3ML0 A;  4CH5 A;  1N33 O;  1VF6 A;  1OV9 A;  2KKW A;  4GX0 A;  3RVY A;  3DXR A;  3DC5 A;  2XTA A;  4WCE V;  5J2U A;  1FFT B;  2WA4 A;  4FFK A;  4F6R B;  3G6B A;  5IE9 A;  5KMG A;  2JGD A;  3MD0 A;  1P4R A;  1VQN V;  4UVB A;  3AK1 A;  3JAK A;  1AR4 A;  2IM9 A;  4IHJ B;  1B6Q A;  1YCI A;  3CCV V;  3LDD A;  4JI5 B;  4ZI7 B;  3HPL C;  1AIL A;  3T4D A;  1FFX A;  3BY6 A;  2DJV A;  2HJF C;  4J7J A;  3GWK C;  3FB8 C;  4LF4 B;  2M6Y A;  5KHI A;  4HYO A;  1VQ6 V;  2EIJ C;  2OWO A;  3WB2 A;  1M4U A;  5EBM C;  3WB1 A;  1RSO A;  5IJ0 B;  3W7X A;  3FB7 C;  2QWR B;  4PDR A;  4WFF A;  2UU9 B;  1YXB A;  4DUZ O;  3F5T A;  3K0G A;  3VQY A;  2QDO A;  5LYJ A;  2K9P A;  2UUC O;  3ZRW A;  2Y0P A;  1SRY A;  1PL4 A;  2ZIM A;  1JFF A;  4O2A B;  3CX5 F;  4JI7 B;  2PYL A;  4X62 B;  1WP7 A;  3JD1 A;  1KU9 A;  4JI6 B;  3O65 A;  4DR5 O;  2A9H A;  1I94 O;  2ILM A;  2P5O A;  2DMX A;  3VQW A;  5BMV A;  4J10 A;  4JTC B;  4N21 A;  1SET A;  3X2Q B;  2YC0 A;  4LWS A;  2E74 B;  1QLN A;  1GN3 A;  4J7Z A;  1R6N A;  2HR3 A;  5LP6 B;  3N2K B;  1R6T A;  3QTC A;  4GCZ A;  2AXT Z;  3H1L H;  4MVO A;  2FYU H;  1GM8 A;  1S77 D;  3DGE A;  2D3O W;  4YJ3 B;  1P7G A;  2ZDI A;  4DR1 B;  2WLM A;  1VQ7 V;  2WLJ A;  4JI4 B;  3E22 B;  2VQF O;  1H2M A;  5KHG A;  1CP9 A;  1K97 A;  4ZIB A;  3ZCC A;  2D2C B;  2WLL B;  2ATK C;  4DR2 O;  1IX9 A;  4BIO A;  1WN7 A;  4WFG A;  2PY5 A;  3W7S A;  2XOK G;  2UXC B;  1AJP A;  3H01 A;  4B08 A;  3O9O A;  5EYP A;  4KL1 A;  1Q43 A;  3OUF A;  4KHP O;  2E5L B;  3SYQ A;  5JVD A;  4JAU A;  2DQ3 A;  4K0K B;  4FJC C;  3N2G B;  5JCO A;  4B3M B;  3KCY A;  2B1G A;  2HFE C;  1YJN V;  1F23 A;  1I5Y A;  4LFA B;  2ITC C;  2YXL A;  3ABK B;  4FLY A;  1EN5 A;  1QNM A;  2FKX A;  2CDY A;  3L9D A;  4ASU G;  3HKE B;  3LNM B;  3A8T A;  4MTF A;  4NKG B;  1M9N A;  2WWW A;  5H5N A;  1V55 B;  2ZDI C;  2NLJ C;  4RUF A;  1OHH G;  3A0R A;  2M7W A;  3D8C A;  2CTR A;  3DTU B;  3L74 H;  5LHI A;  4OX9 O;  1JJ2 U;  2YEV B;  2EIM C;  2R9R B;  2IJH A;  4UCV A;  5LA6 A;  4FM1 A;  2HHH O;  1HNW B;  4OPH A;  4GUN A;  1YIJ V;  2HVJ C;  2R70 A;  2KSD A;  2IU0 A;  5L3G A;  4FLV A;  1KC8 W;  2R9I A;  1IVS A;  2XAF A;  3JAL A;  2GTA A;  1WPB A;  4J9Y B;  2ADQ B;  3T1H O;  5DED A;  5JCO C;  1K4D C;  3K0D A;  4DV2 B;  3SJA C;  3ZED A;  1H2K A;  3SPI A;  5HFL A;  5BY1 A;  4H37 A;  1Y76 A;  2Q7H A;  1K73 W;  2ZKO A;  2EIK C;  3BA9 A;  4UCO A;  4FM2 A;  2CTQ A;  4W4K A;  1XNQ O;  5FPO A;  1Q82 W;  1NVP B;  1VF7 A;  3U10 A;  4BW9 A;  4ZHQ A;  1R1B A;  3T1C A;  4UCT A;  3D3Q A;  4K35 A;  4AI8 A;  2XAJ A;  3QO5 A;  1SQQ H;  2QTO A;  1OCZ B;  3JAR A;  5CBG A;  3U11 A;  2O57 A;  3F7Y C;  4PV1 B;  2W0F C;  4P2Z A;  5KA6 A;  1K34 A;  1XMQ B;  1FPO A;  2IJK A;  1JQ0 A;  5J2T B;  4CC5 A;  5C8Y B;  3OGI B;  4MTO A;  4F6E A;  1QVG U;  2DE0 X;  1VF5 B;  4UB6 Z;  4JAA A;  3SJB C;  1DGS A;  2FML A;  4C7U A;  3ZMT A;  2EIN B;  4P30 A;  3MAQ A;  2CE4 A;  3K03 A;  3AG4 C;  3AG2 B;  2BTQ A;  4FK5 C;  4B7K A;  2ZNI A;  4FFB A;  4DV7 O;  4DV5 O;  1V54 C;  1TUE B;  3HR0 A;  2WLN A;  2B5U A;  2V7Q G;  4I4T A;  4U3F H;  4IL6 Z;  4BAY A;  1Y74 B;  3CRC A;  1TUB B;  1E1Q G;  1OCO B;  3SPH A;  3L70 H;  1VQO V;  4YIO A;  2ADP A;  4O4L B;  4JAS A;  2ZQM A;  1BGY H;  4FZ1 A;  5B1A B;  4PDM A;  1W2B U;  4DUZ B;  4IYH A;  1SKV A;  1L1F A;  1AP6 A;  2UUC B;  3ZRX A;  1K8A W;  2UUA B;  5LP6 C;  4QIW F;  1OZ0 A;  3HKB B;  5K1P A;  2YIB D;  4DR5 B;  4BR6 A;  1I94 B;  4YXW G;  5JQG B;  1DF5 A;  1W0J G;  1FXK B;  4H0L B;  5CN0 A;  1BSM A;  1FXV A;  2H8P C;  3K5M A;  1NBM G;  2CTW A;  2IH1 C;  2CGN A;  1ZX3 A;  4PDV A;  3CCE V;  3Q4H B;  2WAM A;  3CC7 V;  2VWK A;  5JH7 A;  1YF2 A;  4X62 O;  1DK1 A;  3B40 A;  1CXZ B;  1IXB A;  4JI6 O;  2VQF B;  4K3A A;  1VQK V;  4YHH O;  4QPK A;  1JVM A;  1S5H C;  4B3R B;  1SZX A;  4E4E A;  2GHY A;  1Q6U A;  3SDL A;  5IYD O;  4EEQ A;  3APQ A;  4YJ2 B;  2HKO A;  2AGA A;  4R7C A;  1H2L A;  4CC6 A;  1RM1 B;  2Q8V A;  2VQE B;  3AG7 A;  4A5U B;  1EN6 A;  5B1B B;  1L0L H;  4KHP B;  4KUM A;  3C3S A;  3ABK C;  1D5N A;  1KQS U;  1QCE A;  5JJN B;  4DR1 O;  3AK3 A;  1FKA O;  2G38 A;  5IT9 N;  3CC2 V;  4JI4 O;  1VQM V;  5FPR A;  5B3S C;  1V55 C;  3K3W A;  3EVK A;  5ITZ B;  4I7Z B;  2P4K A;  1XDC A;  2JEX A;  4OGQ B;  2QKC A;  4MSW C;  2UXC O;  1ZWI C;  5LOV A;  1VMG A;  4J41 A;  3BCC H;  5CA0 A;  2E5L O;  2QWO B;  3P32 A;  5EBL C;  1Q3E A;  4K0K O;  3WU2 Z;  1SC5 B;  5IYZ A;  4TUY A;  4RO2 A;  3JYC A;  2XAH A;  1XIL A;  1ZUQ A;  1EZV H;  3ABU A;  1H8H G;  2XAQ A;  2ZCE A;  4LFA O;  5C8Y A;  1AJQ A;  2YI9 A;  2LO1 A;  3B8M A;  1GM9 A;  1QR9 A;  4LH6 A;  2OCC B;  4X66 B;  5LGN A;  3ASN C;  1NH2 D;  2R9A A;  3OFN G;  3D36 A;  3PN1 A;  5JWP A;  1N0J A;  2JVD A;  5IWA O;  5JJE B;  2Q69 A;  4CS2 A;  4XDJ A;  4O2B B;  5IY5 B;  2XHB A;  4WBN B;  1BQ0 A;  4GT1 A;  2H94 A;  3FKS G;  3T1H B;  4LF5 O;  3VBB A;  2CK3 G;  1JJO A;  2UXD B;  1N34 B;  3ETQ A;  3OAA G;  4MW3 A;  3F7V C;  1AJN A;  1HNW O;  4X88 A;  2JJ2 G;  3CCM V;  1Y74 A;  1Y67 A;  1I0H A;  2Q67 A;  5E1A C;  3ASO B;  3KG2 A;  1MSW D;  1NU1 H;  1NR1 A;  3FAV A;  1TVK A;  1OCC B;  3JAT A;  5F2V O;  1GM7 A;  1COW G;  4DV2 O;  3ETG A;  4JV5 B;  3M99 B;  4TWK A;  1MG1 A;  4ZKI A;  4LBE C;  4MVQ A;  3OT7 A;  4DV1 O;  1E79 G;  2Z5U A;  4PD4 F;  3VOU A;  2RN9 A;  4WF9 V;  2E76 B;  3D36 C;  2LFR A;  3JAW B;  3CME V;  3B2E E;  4ABM A;  2CTP A;  4I55 A;  4JAV A;  1KEC A;  2OIE A;  3B8N A;  1ZL8 B;  1WAZ A;  1Y4M A;  3CRR A;  2QKA A;  3IAY A;  4CZZ A;  1R3J C;  3JD2 A;  3EXA A;  4TV9 A;  1OCO C;  2LGW A;  2JJ1 G;  4DV5 B;  2WPD G;  5J9P C;  3HKC B;  4DW1 A;  1XNR B;  4G28 B;  4FLT A;  2DN9 A;  2F4V B;  4Z1M G;  5B1A C;  3B09 A;  2HG5 C;  2WLK A;  3CRM A;  4F4L A;  1AP5 A;  2QR4 A;  1WA8 B;  2YIC A;  1Q7Y W;  1JX9 A;  4B7E A;  2EBO A;  1QR8 A;  4PDL A;  5L3B A;  4DRX B;  1N4C A;  1FXH A;  2GTS A;  1GK9 A;  4D7S A;  1MOF A;  2ZM6 B;  1R73 A;  3S3W A;  1NQT A;  1VQL V;  1IBM B;  5LMU O;  3WG7 B;  4UVA A;  2Y0I A;  2DYS C;  5ITZ A;  2CAZ C;  1MSD A;  1T5E A;  2EZP A;  4GX2 A;  3SYC A;  4TV8 A;  1BZK A;  4DO2 A;  3RGB A;  4H44 B;  4X1Y A;  4UCS A;  4YY3 B;  4OPA A;  2Y69 B;  2QGN A;  3H1I H;  4DV4 B;  1FD9 A;  3B77 A;  5EZY B;  3HKD B;  1Q6H A;  1GN2 A;  3K9A A;  5CB4 A;  1XOU A;  3FYE B;  4EB6 A;  5CA1 A;  4OXS A;  4TOI A;  4LNU A;  4D6T H;  3I5D A;  4LR3 A;  2UUA O;  4EFB A;  3ZHR A;  2EX3 A;  4JI2 B;  3G4S V;  1RM1 C;  2Q9L A;  4AIL C;  1ROP A;  5B1B C;  4YHH B;  1WJZ A;  3WFV A;  4U3J B;  1UJW B;  1JA8 A;  4ZOL B;  1MMM A;  3IJ4 A;  4U7O A;  2ZR2 A;  2FL4 A;  1H38 A;  3BVO A;  4X8A A;  1JOY A;  4FLZ A;  4O4H B;  1AR5 A;  4X1K B;  3RYI A;  2JIZ G;  3ZS8 C;  5EIB C;  3JD3 A;  3CRQ A;  3RWR D;  4B3R O;  4HNA B;  4I50 A;  2UXN A;  3MHH C;  3OEE G;  4X20 B;  3CJH B;  5GON B;  4O4J B;  2VQE O;  5KX5 B;  2HVK C;  4BW5 A;  3CE2 A;  2W6J G;  2QEX V;  3ZRS A;  2QKS A;  1OCR B;  3BPZ A;  2FB5 A;  4KFM A;  4I0X B;  4LF7 O;  2IU3 A;  4FVM A;  4HBN A;  4UFZ A;  2PTM A;  3AG1 B;  2VS0 A;  5LXT A;  4O4I B;  2BE3 A;  2YXY A;  3C90 A;  1GRJ A;  1ZL8 A;  4J42 A;  2GSM B;  4HAM A;  4LF6 B;  1KKC A;  1V9P A;  3UT5 B;  2LGQ A;  5IWA B;  3ZRV A;  5L3E A;  4LF5 B;  2YXH A;  3K9S A;  1IUR A;  2F66 C;  3AG3 B;  2Q7E A;  3ICX A;  3G67 A;  3JSL A;  1M57 B;  1ORQ C;  2NN4 A;  4X66 O;  4K8X A;  3L75 H;  2P67 A;  4F6R A;  1WA8 A;  2PI5 A;  4JI3 O;  4DYL A;  5LMN B;  2KG7 B;  1XI1 A;  1F7Y A;  2QSA A;  5EC2 C;  4IHJ A;  1P84 F;  1O9G A;  2ETN A;  4ZI7 A;  1KYO F;  3ABM C;  2UXD O;  1N34 O;  1S76 D;  1XEQ A;  4DK0 A;  4FPP A;  1MA1 A;  4DV1 B;  1S5L Z;  1THZ A;  1GH6 A;  4PI0 A;  3FB6 C;  4CS3 A;  4PA6 A;  1WNS A;  2WA3 A;  3RYH B;  2GBO A;  1M56 B;  3L71 H;  1VAR A;  3SPC A;  4LP8 A;  1XBL A;  1PNM A;  3RYF B;  2RNB A;  4FIP C;  1VP7 A;  3CD6 V;  3ZHQ A;  5IJ0 A;  3K04 A;  4KXR A;  4WFE A;  4W4L A;  2LFS A;  4I9W A;  4J9Z B;  1Q90 D;  2RDC A;  3L73 H;  4JV5 O;  4X9Q A;  4JI1 O;  3PJS K;  3P3P A;  3D3I A;  5LHH A;  4X1I B;  3CSX A;  3LNN A;  4O2A A;  4X65 O;  1G1X B;  1ARO P;  4P9O A;  3SYP A;  1YIT V;  2Y4T A;  3T1Y O;  2E3C A;  1XRE A;  2P7T C;  3OMI B;  1M1K W;  1H2N A;  3JAS B;  2XT9 A;  2QM7 A;  4TQF A;  4RQF A;  1HNZ B;  3TCU A;  4DV6 O;  5LP6 A;  2QA4 V;  3N2K A;  2NNU A;  2LQT A;  1SER A;  1E1R G;  2ZT9 B;  1TAE A;  4DK1 A;  2A0L A;  4UCU A;  2QWN B;  1GMG A;  2JK5 C;  4MTG A;  5K1X A;  4YJ3 A;  1PM9 A;  3BAA A;  4AQY B;  3RFR A;  1X59 A;  4Q6G A;  5IJ9 B;  3E22 A;  1A32 A;  1ENV A;  4LFB B;  1XNR O;  5LMU B;  5GW7 A;  5DM6 V;  1QLE B;  2F4V O;  3CB2 A;  2WLI B;  2WLL A;  4LFC B;  1QQC A;  4HNA A;  4LF9 O;  3MHS C;  3ZMU A;  5AG2 A;  4TSF G;  1PKX A;  4BWA A;  4DR4 O;  2P90 A;  3CHX A;  4JYY A;  1GN4 A;  2ZM6 O;  1HNX B;  3N2G A;  3TXS A;  2Q6A A;  1IBM O;  3MDS A;  3ZBH A;  5KHK A;  2P6J A;  1WPX A;  1SA0 B;  3X2Q C;  4NR1 A;  4LCU C;  3BRC A;  3OD4 A;  3L72 H;  3WB0 A;  3CWB H;  2UXB O;  1XQ8 A;  2LP7 A;  3B4S A;  4JGS A;  1XHZ A;  4MTX A;  3ZJZ A;  2EJR A;  3K57 A;  2WLH A;  3HKE A;  5B1N A;  2YUA A;  4YY3 O;  4DV3 O;  3UT5 A;  4QNH B;  3IC7 A;  2JGU A;  2EIL B;  4DV4 O;  1NTK H;  1URF A;  4PA7 A;  4UB8 Z;  2ZD9 A;  1M93 A;  1Z5W A;  3CCU V;  1Q6I A;  2A7W A;  1SQB H;  2E75 B;  2BTO A;  2YEV A;  4L87 A;  3VQX A;  2HLD G;  2IH3 C;  1VQP V;  3AK2 A;  1FJG O;  1NJI W;  2DWD C;  3UCS C;  3OMN B;  4D7T A;  4JI2 O;  4WFA V;  2KQX A;  4MVS A;  4RQE A;  1OCR C;  1IDS A;  1QBZ A;  1TGO A;  1MAB G;  5LBQ A;  4IGG A;  1N36 B;  3A0H Z;  2DOS A;  1KUQ A;  3LSU A;  4PA9 A;  1HR0 B;  3DXR B;  1YHQ V;  4K8Z A;  5J2U B;  4EFE A;  4DR6 B;  2V4D A;  2IBZ H;  1YJW V;  2QWQ B;  4LF7 B;  1PNL A;  1YZB A;  3DSQ A;  3SJQ C;  5KMG B;  3G71 V;  1KKD A;  2JGD B;  3E83 A;  5C93 A;  3OUS A;  3ZMV A;  3CC4 V;  2XAS A;  2DYR B;  3JAK B;  1W0K G;  2ZE5 A;  3OTF A;  3AG3 C;  4X1I A;  1FFX B;  1M57 C;  1U97 A;  4CBC A;  4CS4 A;  3CPW U;  3APO A;  1BCC H;  1J5E B;  3P3N A;  5H6Q A;  5J2T A; 
#chains in the Genus database with same CATH homology
 1VQ8 V;  1K92 A;  3ABK B;  1EFR G;  2IW5 A;  3CCJ V;  1S0V A;  1FXH A;  4TT3 G;  4JTA B;  4HZ3 A;  1GK9 A;  1MOF A;  4R50 A;  1R3L C;  3OMA B;  4ASU G;  3TK1 A;  1EZJ A;  1R73 A;  3LNM B;  1NQT A;  3OW2 U;  1VQL V;  4MTF A;  3WG7 B;  4UVA A;  3LSQ A;  1NKD A;  1M9N A;  2DYS C;  2WWW A;  1V55 B;  2ZDI C;  2NLJ C;  3ABL B;  4RUF A;  1OHH G;  3A0R A;  5CMU A;  2M7W A;  3BEH A;  2EZP A;  1IXM A;  4GX2 A;  3SYC A;  3DTU B;  5LHI A;  3IFX A;  1SZT A;  1Q81 W;  3OR6 C;  1JJ2 U;  4DO2 A;  2QE7 G;  1BMF G;  2YEV B;  4QJF B;  2EIM C;  2R9R B;  3I55 V;  2IJH A;  4XDL A;  2X6A A;  2EZO A;  4PA3 A;  2WSS G;  2Y69 B;  3E89 A;  1YIJ V;  2Z3Y A;  2DQ0 A;  3F5W C;  3ZN1 A;  2HVJ C;  2Y48 A;  3AEI A;  3B77 A;  1VQ5 V;  4Q20 A;  1JCH A;  2IU0 A;  5L3G A;  1AR1 B;  3ETE A;  1KC8 W;  2R9I A;  3K9A A;  2XAF A;  1OCZ C;  3FYE B;  1BHA A;  4OXS A;  5B1O A;  5LGU A;  3T2M A;  1FS0 G;  1Y66 A;  4MS2 A;  4J9Y B;  5CBH A;  2F43 G;  1J95 A;  1KP2 A;  3R65 A;  4XDK A;  1GKF A;  1K4D C;  3K0D A;  3G4S V;  1RM1 C;  2DYS B;  2KB1 A;  3SPI A;  5HFL A;  1ROP A;  2X6B A;  5B1B C;  3I56 V;  4H37 A;  2K1E A;  1K73 W;  1RPR A;  2EIK C;  3E86 A;  2EIJ B;  1K4C C;  3WFV A;  5EK0 A;  2DW4 A;  3OEH G;  4DXW A;  1N8R W;  1YI2 V;  1UJW B;  4H33 A;  2EIM B;  2OTJ V;  3RVZ A;  4U7O A;  1Q82 W;  1NR7 A;  2ZR2 A;  4BIU A;  1NVP B;  1K9M W;  4LC1 A;  2EIN C;  1H38 A;  4RAI A;  2AHZ A;  3T1C A;  4X8A A;  3AG2 C;  1FXK A;  2MK3 A;  2X6C A;  1JOY A;  3AG1 C;  1XL4 A;  3E8B A;  1HWY A;  1WLE A;  2JIZ G;  2XAJ A;  3QO5 A;  1CPY A;  1OCZ B;  2QTO A;  3JD3 A;  5CBG A;  3P30 A;  4U7N A;  1QLE C;  3F7Y C;  3QO7 A;  1KD1 W;  5LHG A;  2W0F C;  4P2Z A;  5KA6 A;  1K34 A;  4MVM A;  2UXN A;  3W7W A;  2IJK A;  1JQ0 A;  3MHH C;  3OR7 C;  3OEE G;  1G4Y B;  3OE7 G;  3JD0 A;  4MTO A;  3SPJ A;  5L3D A;  2HVK C;  4BW5 A;  3GB7 C;  1QVG U;  2W6J G;  2QEX V;  3JD4 A;  3ZRS A;  2QKS A;  1OCR B;  4R8C A;  5L3F A;  1NH2 B;  3UM7 A;  3ZMT A;  4KFM A;  4I5S A;  3W7T A;  2EIN B;  4MVU A;  1K5Q A;  4P30 A;  2ZXW B;  5IDJ A;  4QPJ A;  2IU3 A;  3K03 A;  3AG4 C;  5KA5 A;  3AG2 B;  4FK5 C;  1I5X A;  3AG1 B;  1CEZ A;  3FYI B;  4G2K A;  2XAG A;  1V54 C;  1TUE B;  2WLN A;  2B5U A;  2PI4 A;  2V7Q G;  5HFM A;  4WFH A;  2GSM B;  2JDI G;  4HAM A;  1DTO A;  3E35 A;  1FXK C;  3EHB B;  3ZRV A;  4BAY A;  1E1Q G;  1LNQ A;  1OCO B;  1R6K A;  2EIL C;  3SPH A;  5L3E A;  3ZRW B;  1VQO V;  4UV9 A;  1M56 C;  2W6I G;  1DLB A;  4JAS A;  4XBF A;  3AG3 B;  2ZQM A;  1QVF U;  1K7D A;  1BL8 A;  3SYA A;  1S72 V;  5B1A B;  5BZB A;  4PDM A;  3ZMZ A;  1M57 B;  3HB3 B;  1ORQ C;  1W2B U;  2WLI A;  2QM8 A;  2DWE C;  1L1F A;  5KUM A;  1AI4 A;  2P67 A;  3AG4 B;  2PI5 A;  4MVZ A;  3W7U A;  3ZRX A;  1YTF D;  1K8A W;  3QNE A;  1V54 B;  5EC2 C;  4QIW F;  3E8F A;  3CYO A;  1OZ0 A;  3FB5 C;  4MVR A;  4MW8 A;  3ABM C;  4YXW G;  5H9C A;  3T4Z A;  1DF5 A;  1W0J G;  1XL6 A;  1FXK B;  5CN0 A;  1RPO A;  1S76 D;  1H8E G;  4PEL A;  4FPP A;  3LDE A;  1FXV A;  2H8P C;  3LUT B;  4JTD B;  1NBM G;  1THZ A;  1K3E A;  2IH1 C;  4GX5 A;  3FB6 C;  5FL7 G;  4PA6 A;  1M56 B;  2AHY A;  1EBO A;  1AI6 A;  3SPC A;  4LP8 A;  4PDV A;  3CCE V;  1PNM A;  2WAM A;  3CC7 V;  4FIP C;  4MT8 A;  3G6E V;  3CD6 V;  2Q68 A;  4JPR A;  1G8M A;  1GTO A;  3K04 A;  2FTK A;  4WFE A;  2DYR C;  1DF4 A;  3RW0 A;  4QE9 A;  2V1D A;  4JYB A;  2LFS A;  4I9W A;  4UXN A;  3SPG A;  2B1I A;  4J9Z B;  3OGC C;  2UXX A;  1P7B A;  1VQK V;  4G27 B;  4QPK A;  3PJS K;  3D3I A;  1JVM A;  5LHH A;  1S5H C;  2GHY A;  3CXC U;  5IYD O;  3STZ C;  1ARO P;  3LDC A;  5EC1 C;  2HKO A;  1YSC A;  4R7C A;  1AI7 A;  1K33 A;  1KP3 A;  4P9O A;  3SYP A;  1YIT V;  3ABM B;  2XND G;  1JPX A;  1RM1 B;  1F4M A;  3ETD A;  1AI5 A;  3LSS A;  4UVC A;  4UUJ C;  5B1B B;  4KUM A;  3CCQ V;  3ABK C;  1KQS U;  1QCE A;  2EIK B;  2P7T C;  3OMI B;  1M1K W;  4R6Z A;  5LGT A;  2QM7 A;  3CC2 V;  4RQF A;  3CP1 A;  1VQM V;  2OCC C;  3TCU A;  2QA4 V;  2NNU A;  3RBZ A;  1SER A;  1E1R G;  5IYB O;  1BHB A;  5B3S C;  1NVP D;  3ABT A;  1V55 C;  2A0L A;  3ABL C;  3K3W A;  5CA3 A;  4X89 A;  1GMG A;  2JK5 C;  2ZR3 A;  3ZIA G;  5EBW C;  2BOB C;  4MTG A;  4PA4 A;  2OTL V;  2JEX A;  3TET A;  3ML0 A;  4MSW C;  5IY5 C;  1ZWI C;  3GWO A;  4GX0 A;  3RVY A;  1ENV A;  3UKM A;  4WCE V;  4EKW A;  1FFT B;  1H2G A;  5GW7 A;  5DM6 V;  1QLE B;  4ZBM A;  2WLI B;  3P32 A;  2WLL A;  5EBL C;  4WFB V;  1VQ9 V;  1PNK A;  3MHS C;  3ZMU A;  5H6R A;  3MD0 A;  1P4R A;  1VQN V;  4RO2 A;  3JYC A;  2IJJ A;  2XAH A;  3ZN0 A;  1YTF B;  2X7R B;  3ASO C;  4UVB A;  3ABU A;  1H8H G;  2XAQ A;  4TSF G;  5KUK A;  1AJQ A;  1PKX A;  1B6Q A;  1OCC C;  3CCV V;  3E2E A;  3LDD A;  3B8M A;  1GM9 A;  4GX1 A;  1QR9 A;  3JCZ A;  2OCC B;  2P90 A;  2X0L A;  5LGN A;  3HPL C;  2BOC C;  3T4D A;  3CCR V;  3ASN C;  3BY6 A;  3IGA C;  5B3S B;  2HJF C;  1NH2 D;  2ITD C;  3FB8 C;  3OFN G;  3D36 A;  2Q6A A;  4HYO A;  2IJI A;  2Q69 A;  1VQ6 V;  2EIJ C;  1WPX A;  2P6J A;  4XDJ A;  3EFF K;  3X2Q C;  4JYC A;  4LCU C;  4BIZ A;  5IY5 B;  4GT1 A;  2H94 A;  3FKS G;  3VBB A;  1M90 W;  2CK3 G;  2LP7 A;  4JGS A;  5EBM C;  4MTX A;  3ZJZ A;  2EJR A;  4FMT A;  2WLH A;  3W7X A;  3FB7 C;  3OAA G;  4PDR A;  4MW3 A;  3F7V C;  1AJN A;  4WFF A;  5B1N A;  4X88 A;  2A79 B;  1PD3 A;  2JJ2 G;  4QNH B;  2C2A A;  3IC7 A;  3OM3 B;  3CCM V;  3K0G A;  2EIL B;  2Q67 A;  4PA7 A;  1GO3 F;  3ASO B;  5E1A C;  2ZD9 A;  3ZRW A;  3CCU V;  3KG2 A;  1MSW D;  1SRY A;  3E8H A;  1NR1 A;  1OCC B;  2YEV A;  4L87 A;  1S3J A;  2HLD G;  3JD1 A;  2IH3 C;  3ZMS A;  1VQP V;  1GM7 A;  2OT5 A;  4RUE A;  4E2L A;  3ASN B;  1NJI W;  3K06 A;  2DWD C;  3OMN B;  1COW G;  3ETG A;  3SYO A;  2A9H A;  3M99 B;  3STL C;  1R3K C;  4TWK A;  1MG1 A;  4WFA V;  4ZKI A;  5CBF A;  4LBE C;  4MVQ A;  4JTC B;  4N21 A;  1SET A;  3X2Q B;  1E79 G;  4MVS A;  4RQE A;  1QLN A;  1R6N A;  2HR3 A;  2Z5U A;  3VOU A;  1OCR C;  4GCZ A;  1QBZ A;  4WF9 V;  1MAB G;  3QO8 A;  1Q86 W;  1PL0 A;  4MVO A;  5LBQ A;  2ZXW C;  1GM8 A;  4KP4 A;  3K08 A;  1S77 D;  2LFR A;  3DGE A;  3CME V;  2D3O W;  2ZDI A;  1F4N A;  4PA9 A;  2WLM A;  1VQ7 V;  4JAV A;  2WLJ A;  1KEC A;  1YHQ V;  2JEU A;  1K5S A;  4N23 A;  3B8N A;  1CP9 A;  1K97 A;  5L3C A;  3ZCC A;  1Y4M A;  3CMA V;  1YJW V;  2WLL B;  2ATK C;  1PNL A;  3SJQ C;  3WG7 C;  3G71 V;  1KKD A;  4JF3 A;  1R3I C;  4CZZ A;  4WFG A;  3E83 A;  1R3J C;  5C93 A;  3OUS A;  3ZMV A;  3JD2 A;  3W7S A;  2XAS A;  3K79 A;  2DYR B;  1OCO C;  2XOK G;  3NXS A;  3CC4 V;  3CCL V;  1AJP A;  2JJ1 G;  3H01 A;  1F51 A;  2WPD G;  1W0K G;  4QE7 A;  5J9P C;  5IYC O;  4P9P A;  3OUF A;  4G28 B;  4UV8 A;  3AG3 C;  2YSU B;  3SYQ A;  1VQ4 V;  1SES A;  4Z1M G;  4JAU A;  5B1A C;  1M57 C;  2DQ3 A;  2HG5 C;  2WLK A;  2Y69 C;  3E8G A;  4CBC A;  3CPW U;  4FJC C;  4F4L A;  2B1G A;  1JX9 A;  1Q7Y W;  2HFE C;  5H6Q A;  1F23 A;  2EBO A;  1QR8 A;  1I5Y A;  1YJ9 V;  1YJN V;  2ITC C;  4PDL A;  3CCS V;  5L3B A;  5DN6 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...