4P30A

Structure of navms mutant in presence of pi1 compound
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
92
structure length
92
Chain Sequence
VGSVAALLTVVFYIAAVMATNLYGATFPEWFGDLSKSLYTLFQVMTLESWSMGIVRPVMNVHPNAWVFFIPFIMLTAFTVLNLAIGIIVDAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Prokaryotic NavMs channel as a structural and functional model for eukaryotic sodium channel antagonism.
pubmed doi rcsb
source organism Magnetococcus sp.
molecule tags Transport protein
molecule keywords Ion transport protein
total genus 36
structure length 92
sequence length 92
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-03-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4p30A00
2X6AA 4G27B 1JVMA 5B1BC 5CBFA 3UM7A 3AG1C 3E86A 1G4YB 2Y69C 2WLIA 4PA3A 4X88A 4R7CA 2EINC 2HJFC 2EIKC 2YEVA 3AG3C 5EC1C 1LNQA 3LDDA 4MVZA 3STLC 4J9YB 3LUTB 4P9OA 2R9RB 3E83A 2AHYA 2BOBC 4PDRA 4TWKA 2WLJA 5EBLC 3SYAA 3SYQA 3RVZA 5J9PC 3F7VC 4PA6A 3F5WC 3UKMA 2W0FC 4XDKA 4HZ3A 3E8HA 2Q69A 4BW5A 2EIJC 4MW8A 4GX2A 4MTOA 1V54C 2WLNA 3K0DA 4MVMA 1QLEC 4F4LA 4ZBMA 4P30A 4QE9A 3GB7C 3K08A 1K4DC 4QE7A 3T2MA 2EILC 1BL8A 2EIMC 3AG4C 3OUFA 5CBHA 2WLKA 3IGAC 3OUSA 2A0LA 2WLMA 2WLLB 5KUKA 3SPHA 3TCUA 3IFXA 3ABMC 4PDVA 3RVYA 4CBCA 5CBGA 3LDCA 3OGCC 4UUJC 3TETA 4WFGA 4LP8A 4WFEA 4RO2A 2K1EA 4OXSA 1OCRC 3SYOA 4I9WA 4HYOA 2HVJC 2IH3C 3SPJA 3HPLC 2AHZA 3VOUA 2H8PC 3R65A 4PA7A 1R3JC 1OCOC 2A79B 1R3KC 1M57C 4JTDB 3FB6C 3SPCA 5B3SC 2HG5C 2IH1C 3E89A 3FB8C 3SPGA 3X2QC 1V55C 5EK0A 4KFMA 4XDJA 2ZXWC 3OR6C 3T1CA 5EC2C 2QKSA 4JTCB 3WG7C 1ORQC 4R6ZA 1OCCC 5IY5C 2HVKC 3AG2C 3OR7C 2Q6AA 4MVOA 3LNMB 4PDLA 3ABKC 3RBZA 2JK5C 4RUEA 3ZJZA 3LDEA 2OCCC 4X89A 1R3LC 2WLLA 4MVUA 5KUMA 1J95A 2P7TC 4LBEC 4JTAB 4MS2A 4GX1A 1OCZC 2QTOA 2WLHA 4MVRA 1XL4A 3T4ZA 4R50A 5BZBA 4PA4A 4MVQA 3KG2A 3SYPA 3SPIA 3EFFK 4P9PA 4MW3A 3E8GA 3JYCA 2ZD9A 2ATKC 1ZWIC 4WFFA 4LCUC 1K4CC 5EBMC 3FB7C 2WLIB 4X8AA 3SYCA 4DXWA 3ZRSA 3SJQC 4GX0A 3T4DA 3PJSK 1R3IC 3ABLC 4P2ZA 3E8BA 4MVSA 3K04A 4J9ZB 3K0GA 4MSWC 3K06A 3BEHA 4GX5A 4RAIA 2HFEC 3ASNC 4H37A 3FB5C 2BOCC 5EBWC 3STZC 4MTFA 2DWDC 4EKWA 2Q68A 2Q67A 5E1AC 4PDMA 4G28B 4PA9A 4H33A 3E8FA 1P7BA 2X6BA 1KKDA 1S5HC 3K03A 1M56C 2A9HA 3ASOC 2DYRC 5B1AC 2DWEC 2ITCC 2X6CA 3F7YC 4QNHB 4XDLA 3RW0A 2NLJC 2DYSC 4R8CA 4WFHA 1XL6A 2ITDC 4RUFA 2KB1A 4MTGA
chains in the Genus database with same CATH superfamily
4TV9B 1TUEB 1PNLA 4K8ZA 5L3EA 3SJAC 5EZYB 3KCYA 1JA8A 3STLC 1H2KA 2A06H 2QWRB 4TWKA 1IBLO 4YY3B 5AG2A 2JRIA 5FLXN 4BIOA 4X65O 3UO2A 2QWNB 3S3WA 3K0DA 2P4KA 4LFAO 4DR2O 4GKKB 1TUBB 2ZXWB 3EVKA 2E5LB 2EILC 4LH7A 4X65B 3OUSA 2A0LA 3RYHA 1NH2D 3I56V 3SPHA 3TCUA 3CRAA 1HNWB 1F23A 3HR0A 2KKWA 3JAMN 3OT7A 3CSXA 1B06A 3JD3A 4EEQA 3E35A 4JPRA 3BA8A 4PELA 1AR4A 4JTDB 1Q6UA 4DRXB 1Q90D 2HG5C 4LF8O 2Q0OC 3OTFA 1XHZA 2W6IG 5LP6C 1W2BU 2Q73A 1OCCC 4X64B 2GTAA 1NTZH 4LF9B 2LQTA 4MVOA 1HWYA 4JZGA 5JJJB 1NR7A 4RUEA 4YJ3A 3JD1A 5LHGA 4MS2A 3T4ZA 4KXRA 1QBZA 1K73W 3SPIA 1AR1B 5JQGB 2GTSA 3RYIA 2DYRB 2Z5UA 3ABLC 2YICA 2Y4TA 2NNUA 4MVSA 4X62B 5CA3A 1AP5A 1ZTEA 4MSWC 2K9PA 2QWQB 3K06A 4DR3B 3BRCA 3FB5C 4J7JA 1AROP 3ASOC 2DYRC 5B1AC 1VF7A 4O4HB 1OCRB 3OMIB 5JJEB 3CMAV 4JYCA 1XREA 1GRJA 2QM7A 1KP3A 3N2KB 1TGOA 3F5TA 5EC1C 4BIUA 2EJRA 3UT5B 2R9RB 4PDRA 1Q6IA 3K59A 3D36C 2LGQA 5J9PC 1LR1A 3E22B 4XDKA 1SERA 3K5OA 3K5LA 1DTOA 3OMAB 3FFQA 1EN6A 4MVMA 1CPYA 1RPRA 1QHTA 1EZVH 2FKXA 2OWOA 1BT8A 3ZMUA 4FFKA 3L75H 4LF7O 4CBCA 4H44B 1YEWA 3HKCB 1M57B 1N0NA 3SPJA 2ETNA 2FL4A 3AK3A 3K9SA 2AHZA 3CCMV 1FPOA 4EFEA 4H0LB 2LO1A 4E2LA 5JJNB 3ETGA 4UFZA 2YSUB 3AK1A 1WAZA 2EIKB 2GDSA 4B3SO 4R6ZA 4JAVA 4YHHO 2DJVA 2JK5C 3LDEA 3CWBH 2V4DA 4B3MO 1ROPA 1SQGA 1S0VA 5BZBA 2MW2B 3G6EV 3CRMA 1VQ4V 3JALA 2HHHB 2E76B 4FM2A 2OT5A 3B8NA 5B1BB 2IW5A 3JSLA 1SETA 5B66Z 2X7RB 1BGYH 1PL0A 4X1YB 5LXTA 2HFEC 1WA8A 3HKCA 2X0LA 4DR5O 5JH7A 4FM1A 3PN1A 2DMXA 2X6BA 1OCCB 2ITCC 5DECA 3CCJV 3AEIA 2ILMA 1ORQC 2X6AA 4NXMO 2UXNA 4X88A 4YIPA 1NU1H 4JASA 2R9AA 1WB8A 4W4KA 4NKGB 1IDSA 3RVZA 4JI2O 2UXCO 1QCEA 3S3XA 5GTHZ 1US6A 3OM3B 3CYOA 2F66C 2DOSA 3UT5A 1I94O 4X20B 3K08A 3ZRWB 4UVBA 1GMGA 1Y76B 2EZOA 3OEEG 3FX7A 1HR0B 4RO2A 4X66B 2HJDA 4I4TB 1OJHA 5DEDA 3JSNA 1BCCH 1M9NA 1AI4A 3ABLB 1R3JC 4UV8A 3RN4A 2ZNIA 3RYFB 5LMNB 3FB8C 3G6BA 1Y66A 3G67A 2RMKB 4XDJA 1S5LZ 2UUCO 1NQTA 3CS5A 3RWRD 4FLZA 2YIDA 4NTWA 3VQWA 4QGPA 3LNMB 2YUAA 1SF9A 3ZJZA 1N36O 2QJ1A 2ZKOA 1K92A 4MVRA 2QTOA 2CUGA 1HNXB 4GUNA 3E8GA 4WFFA 2JVDA 2AXTZ 3SYCA 4IYHA 1O9GA 1M5IA 1S76D 3T4DA 5LHIA 4XBFA 1RSOA 3UO3A 1GK9A 3E8BA 3CC7V 3VQXA 4RWUA 5KHGA 4DR7B 4TQFA 4H37A 2PF4E 2KG7B 2AZ2A 4F6EA 4H33A 1N0JA 2JS3A 1S5HC 4LFCO 2Q7EA 4DR4O 1AJPA 4W4LA 1WA8B 3ABKB 3AG2C 2ODMA 2EINB 3C90A 4FZ0A 4PA3A 4FFBB 5TISZ 2OIEA 1GH6A 4LF4B 4FPPA 3TK1A 2PYJA 3U10A 3BCCH 5J2TB 4UVCA 2AHYA 4DV7O 2QGNA 1XI1A 1R6NA 4JI1B 2W0XA 5IJ0A 4K0KB 3U0ZA 1V55B 3CHXA 5JQGA 4QE9A 3T2MA 3ZHRA 3IGAC 2XT9A 5GONA 3IFXA 1B04A 1SKVA 4WFBV 3I5DA 5BR8O 4CH4A 1SQQH 4WF9V 3L72H 3L74H 4I9WA 1YSCA 4O2AB 3ZHSA 4NTYA 3HPLC 4U3JB 3H1JH 1AILA 5LBQA 4PA7A 2QSAA 1F4NA 1YDXA 4ZI7B 3E89A 4LF6B 5EK0A 3GWKC 2Q9LA 2OTJV 5KAFZ 5CA1B 5L3FA 4IT5A 4LF8B 3CCEV 2Q6AA 4EB6A 1W59A 2PI4A 2F93B 1PV0A 1SZTA 3P3PA 3ZIAG 1NS1A 4ABMA 1HW7A 2ZM6O 3HKEA 1S72V 4J80A 3EFFK 2QDOA 4JI6B 4K0KO 3ZBHA 2Q7GA 3CC2V 4DV4B 3SJQC 2Y0IA 2YXYA 1S3JA 5BXZA 3OTOO 5BY1A 1W0KG 4RAIA 4O4HA 2V7QG 1M90W 4MTFA 2DWDC 5LOVB 1HNZB 1P7BA 1VQNV 3WU2Z 1VIBA 4JI8O 1MZEA 3MD0A 3D3QA 2OCHA 4LFCB 5JVDA 3CB2A 2IJKA 3RYIB 2O57A 4J9YB 2RNBA 2JEXA 4ZKIA 2Z3YA 1PP9H 3HKEB 3N2KA 1GM7A 2W0FC 4NXNO 1IURA 1I08A 1L8DA 2V1DA 2XTAA 2IJHA 2H94A 1VP7A 1WNSA 3CRQA 1EM1A 4QE7A 1WP7A 3H9VA 3OUFA 5LP6B 1QNMA 3JD2A 5CBGA 2F43G 3OAAG 3ETDA 4LP8A 1FKAO 5LA6B 1G8MA 2NR5A 3ZMZA 1Q86W 2N05A 3A0BZ 4TSFG 5B3SC 2YIAA 1AB3A 3X2QC 3P30A 3VQVA 1ZLZA 4BWAA 3B8MA 1OCZB 1QLNA 4JTCB 3R66A 3RYHB 5IY5C 3H1HH 1YJWV 1RM1B 1MSWD 1EN5A 3ZHUA 4X89A 1VQ5V 3AK2A 1COWG 2P7TC 2UXBB 3KG2A 3SYPA 1YTFB 1R73A 2CE4A 2GSMB 5JCOC 4DV1B 2YI9A 4AI8A 1Q43A 4JI7B 2WSSG 3Q4HB 2E3CA 1WJZA 1KUQA 1BQZA 4DR6B 4J9ZB 4BR6A 4J42A 1EBOA 5D5QA 2VQEO 4NB5A 1R6KA 4DV4O 1M56B 3AG7A 3QTCA 5LMNO 1KKDA 2WA4A 3ZN0A 1H8HG 4QNHB 3OEHG 1NVPD 3ABTA 1XILA 3A0HZ 1PNKA 1OV9A 5CBFA 1N34B 4DV7B 2M6YA 4X1IB 1AP6A 1N4CA 3D3IA 1I5YA 3BABA 4J7KA 4P9OA 1S5JA 2FMLA 1XMQO 3L9DA 4LC1A 4U7OA 2ZINA 2PTMA 3OW2U 3LSQA 2CTWA 4LFBB 1KD1W 4JI0O 1VQMV 3TXSA 4UUJC 4B3RB 4GKJB 1OCRC 2XASA 2EIJB 3LSUA 3JASB 2Q0AA 1NVPB 3JCUZ 5JWPA 1BQ0A 4RQEA 2L6LA 2PY5A 1X4TA 1YITV 1V54B 3OR6C 4DR4B 2E74B 3WG7B 3H1LH 4UB8Z 1FXKA 4EFBA 1IBLB 3BY6A 5D5PA 2QM4A 4TQDA 2QTSA 4I7ZB 2P6JA 4NTXA 3CCVV 4DV2O 1R6TA 2CDYA 5EYPA 3ZHTA 2E5LO 1K33A 1VF6C 4DV2B 3APOA 4FM0A 4J41A 3PJSK 1DLBA 4AQYO 4CH3A 2UXXA 1PL4A 1DF5A 4B3RO 4G28B 1CEZA 4LWSA 3JATA 2UUBB 3K03A 3ZN1A 1N33B 1D2DA 3TJTA 4BIZA 2NLJC 1XL6A 4IHJA 2CGNA 3AG3B 3G80A 3UM7A 4D7TA 3E86A 1G4YB 3CXCU 3FYEB 1LNQA 1K5SA 1FXKB 4OPAA 2GV9A 1K97A 2UUAO 2ZM6B 5DN6G 1GN3A 3M8AA 1K8AW 1D5NA 2Q69A 1L1FA 3W7XA 1V54C 5KHKA 1QLEC 5IJ9B 2ZQMA 3DC6A 4I5SA 1QVFU 3OMNB 3OTOB 4PDVA 1U96A 3TETA 4WFGA 4DR3O 4WFEA 2K1EA 3CCSV 4UCRA 2HVJC 4U7NA 3JAWB 1GKFA 3C3SA 2PZSA 1OCOC 1Y4MA 3K5NA 1AVMA 1K9MW 2FTKA 1SESA 5L3BA 4Z1MG 4B7EA 3A8TA 4AHCA 5IJ9A 4PDLA 2DYSB 5B5EZ 2CH7A 4HBNA 4UCTA 4C7UA 4CH6A 1AJNA 4D7SA 1XDCA 4P9PA 4DUZO 1X59A 2ZD9A 4GLXA 1YF2A 1H2LA 5FNVB 4DW1A 2ZIMA 2WLIB 4FK5C 3CCUV 5GONB 3BHPA 1TAEA 3RFRA 1SQPH 4LF5O 3MAQA 5BR8B 2BOCC 4N21A 3M99B 4PDMA 4J11A 4UV9A 5H5NA 4F6RA 3SJBC 2L35A 1H38A 4JAUA 5CA0B 4QIWF 5LP6A 3WB0A 1H2SB 5KAIZ 2UXCB 4U3JA 4UVAA 1YHQV 4ZHQA 1XUQA 1FJGB 3B09A 4GKKO 2ZDIC 2CGOA 4GCZA 4PA6A 1XBLA 3UKMA 3VBBA 4FLTA 1L0LH 1BS3A 2DW4A 1PPJH 3CC4V 2D2CB 1K4DC 5IJ0B 2XAHA 1BL8A 2N04A 2WLKA 4JGSA 4DR7O 4YJ3B 2QR4A 2P90A 4DR6O 1CP9A 4TUYB 3JARA 1Y67A 5FL7G 2M7WA 1R3KC 5BMVB 5JH7B 4X64O 1W0JG 1Z5WA 4I55A 1VQOV 5LMUO 4OX9B 2OYQA 1Q8IA 2HVKC 3H1IH 1YVWA 3ZMTA 4NR1A 2Q4PA 3T1HB 4UXNA 4KP4A 3D36A 1H8EG 1JJ2U 3EXAA 1YIJV 2XAJA 1XEQA 5IYZA 1IBMO 4TUYA 3BPZA 2JGDA 1NTMH 2AW9A 4FLVA 3CJHB 3CRRA 4LNUA 2R72A 5LOVA 1JFFB 2Y48A 2ZR3A 1HR0O 2XUMA 1R3IC 4DUZB 4G2KA 3ZRWA 4FLWA 3CP1A 2PUSA 4JI4O 3ETEA 5H9CA 3N27A 4B08A 1M56C 1Z5VA 1KC8W 1IBKO 3O65A 2ITDC 2ZR2A 1ZAUA 1G6UA 3BAAA 2DQ3A 4G27B 3I55V 2JDIG 1I7FA 1QU7A 1Y74A 2VS0A 2XNDG 2MK3A 1TVKB 1K7DA 3N2GB 2YEVA 4NVPA 4LNUB 2BOBC 4IL6Z 4DUYO 1M4UA 3F7VC 5HFMA 2W6JG 5K1PA 3RYCB 2EIJC 3MDSA 4MTOA 2LP7A 4YY3O 1XMQB 3G4SV 3QO8A 5CBHA 4MTXA 1NT2B 5ITZB 3FYIB 1VQPV 3W7WA 2H8PC 4DK0A 2PYLA 5H6QA 1EZJA 2CK3G 2ZE7A 4IYIA 2RJZA 1V55C 1WN7A 2OTLV 3N2GA 5KLVH 4DV6B 4DK1A 1O9HA 1RFYA 2OCCC 4MVUA 4I50A 1J95A 5L3DA 4JTAB 4JI1O 4GX1A 2UUAB 1XL4A 4MVQA 4DV3B 1B6QA 4LFBO 3HKBA 1ZWIC 3DTUB 4RQFA 4FLYA 4X8AA 3RYFA 3WB2A 4GX0A 1XMOB 1E1RG 2IBZH 1M1KW 1NBMG 3CJHA 5CB4B 4GKJO 1V9PA 2LW1A 3ZX6A 2Q67A 3WB1A 4N23A 1D5AA 3F7YC 1IXBA 4J7ZA 4R8CA 5E79Z 4RUFA 4KHPO 4J10A 4MTGA 1JMKC 3CCQV 4ZOLB 3AG3C 4I50B 3LUTB 1LUVA 4HNAB 4BW5A 4JI6O 1AI6A 2WLNA 4H13B 4JI7O 5HFLA 5A9GA 1BZKA 5FPOA 5K1XA 3CE2A 3APQA 2XOKG 2VQEB 1Z2GA 4UCUA 3RVYA 4B7KA 2D3OW 3O9OA 4JYAB 5EYPB 4ZI7A 4JV5O 2P5OA 3R65A 4JI8B 4JYAO 2ZXWC 1BMFG 1N34O 1RP3B 5EC2C 4DO2A 2RQ6A 2DE0X 3WG7C 2JJ2G 2WPDG 2G38A 4I0XA 4B3MB 3OR7C 3TXQA 1GN2A 4OGQB 2HEPA 2R9IA 3IJ4A 5LGTA 1UFIA 2HHHO 2QWOB 4TV9A 4BAYA 3P32A 1P4RA 2ATKC 2DN9A 2RN9A 1FAFA 1VF5B 1IX9A 4DXWA 4X1KB 1FD9A 3K0GA 2QWPB 1K5QA 2B5UA 3OD4A 3H1KH 5FNVA 3X2QB 3ZS8C 5IWAB 1N32O 5B3SB 4UCOA 1IBKB 2P06A 4FJCC 1N8RW 1SS3A 5KHHA 2EZPA 3JCZA 2A9HA 3QG5A 1E1QG 4KUMA 5CA1A 4DR5B 1KU9A 2DYSC 1HNZO 2YEVB 1YTFD 3U11A 4F6RB 3AG1C 4FLXA 1OHHG 3E22A 2EIMB 2B1IA 4YJ2A 4MVZA 1XHXA 1J5EB 4I9QA 2WLJA 1JCHA 1KMIZ 1SQFA 3E8HA 2F4VB 3UQ8A 4MW8A 2H3OA 3GB7C 1VQ6V 3CPWU 2QA4V 2UU9B 3OGCC 4K35A 2GUZB 4OXSA 3W7SA 4HYOA 1ZX3A 3FAVA 3K5MA 4YXWG 5IYZB 4WBNB 5J2UA 4X66O 2UUCB 3FAVB 3G71V 2PGGA 4KFMA 4Z1VA 2ZE6A 3B4SA 3NXSA 1RM1C 4JI5B 3ZRXA 1IZ3A 4CC5A 5LXTB 3ABKC 3K3WA 4I55B 1KBHA 4L8JA 1AI5A 1JQ0A 5LYJB 3L71H 1YI2V 1JFFA 3W7TA 4CS2A 1URFA 4JZ2A 5F2VO 4JF3A 1SA0A 3FB7C 5CMUA 3ZRSA 4DRXA 4X1IA 2Z0AA 4P2ZA 1VQ8V 1P84F 4NYKA 1SA0B 3WFVA 4DYLA 2VWJA 1BHAA 1JR9A 4PD4F 4GX5A 2CAZC 1HNWO 5ITZA 4DR1O 1MSDA 2Q68A 1R1BA 5LYJA 3B2EE 2RDCA 4JI4B 1SRYA 1XNRB 1BHBA 2F95B 1NH2B 1OCOB 1RPOA 5B1BC 1Q7YW 3QO7A 4OX9O 3AG4B 2HJFC 1FFXA 2YIBD 4FLUA 4WCEV 3E83A 2WA3A 4HZ3A 3KZIZ 4LF4O 2XAQA 2QM8A 2JGDB 2B9ZA 3MHSC 4E4EA 4F4LA 1XMOO 1MA1A 3HKBB 1K34A 3AG4C 4AQYB 4K3AA 2P4VA 2WLMA 4Q6GA 4TV8B 1PD3A 2HKOA 4QPKA 4X62O 4LF6O 5IYCO 3VQYA 3ZCCA 5DM6V 4X9QA 4O2BB 4DR1B 2EJ7A 1M57C 3KKYA 2QKCA 1U97A 2HP8A 2ZNJA 1FFTB 1NTKH 4BW9A 3SDLA 1I5XA 3GVMA 3ICXA 1SC5B 2BTOA 1TVKA 3A0RA 2WLLA 1XQ8A 5L3GA 2F1MA 2WLHA 4HNAA 2YI8A 4O4JB 3IC9A 1Q81W 1KKCA 3JAKA 2YXLA 1PKXA 3CCRV 2Y0PA 4IIJB 4TV8A 4ZOLA 2VRZA 1ZL8A 4MT8A 2YS8A 2LW7A 3TGUH 1KB9F 3T1YB 1Y74B 1JJOA 1MZFA 3CMEV 2IU0A 4YIOA 1G1XB 3FD9A 4CZZA 2WWWA 1Y76A 4JI3B 1NJIW 4JI2B 3AG2B 2EINC 3J7AU 1FXKC 3KCXA 4KHPB 4PJ0Z 4QPJA 4PI2A 4O4JA 2JEUA 3SYQA 3JAKB 4FVMA 1KQSU 4O4LA 2FYUH 2DQ0A 2KG7A 3DXRA 2Q8VA 5KX5B 4DV1O 1HP8A 3UCSC 5IYDO 2FB5A 3FKSG 2PI5A 2EIMC 2KQXA 1RSOB 1P7GA 5LHHA 1Q3EA 3ABMC 2ADQB 2AGAA 2EX3A 2QKAA 2QE7G 2VQFB 1E79G 1BSMA 3CX5F 3T1YO 3ML0A 5LGNA 3SPGA 3E2EA 4JYBA 1IVSA 4TOIA 4D6TH 2ZIOA 5C8YA 4NXMB 2BSKB 4JI3O 1AI7A 1MG1A 2IJJA 1GO3F 1KECA 3Q4HA 4QJFB 1QVGU 3JD0A 1H2MA 2LJ2A 2AZ0A 1EFRG 2ZE5A 4DV5B 4ZIBA 3JYCA 2P22C 2WAMA 4PV1B 1VEWA 5EBMC 3EHBB 1LUWA 4ASUG 1ZSPA 3C3TA 2ZCEA 4DV5O 3JD4A 5FPRA 4IGGA 4LF7B 3LNNA 1QR9A 4O2AA 3BEHA 1GAXA 3ASNC 1N33O 1F51A 4EKWA 1ZL8B 3K58A 2F23A 4PA9A 2YC0A 3J81N 2VQFO 4FIPC 5IWAO 2DWEC 4JI5O 1QLEB 4CH5A 4Z2WA 1JVMA 2Q7HA 2Y69C 2B1GA 2XAFA 2YXHA 2QEXV 4B3SB 4EB6B 3K9AA 3BVOA 5IDJA 1KP2A 3ZHQA 4DR2B 1FYJA 3CD6V 1YCIA 1FXVA 2LFSA 1FJGO 4GZRB 2YIBA 5KA5A 5EIBC 1QR8A 2XHBA 3LSSA 3NR7A 1Q6HA 2IH3C 5BMVA 1JOYA 1CXZB 1XNQB 5CA0A 2UXDO 2EBOA 4A5UB 1PNMA 3IAYA 3T1CA 1XNRO 4FFBA 3W7UA 2QKSA 4CS3A 3OGIB 1AR5A 3DSQA 1GN4A 1VQLV 4OPHA 1SQBH 3RBZA 3ZRVA 2OIGA 1FFXB 4KL1A 3CCLV 2ZDIA 2CTRA 3SGIA 3B77A 1OCZC 2Y4UA 3P3NA 5H2FZ 4IIJA 1YXBA 4ICGA 4PA4A 3BFRA 1F7YA 2GBOA 2EULA 3RGBA 1MMMA 4LCUC 5IE9A 4JI0B 4YJ2B 4LFAB 5C93A 4LF5B 1QQCA 2CH7B 2UXBO 1THZA 3SR2C 1HNXO 3AG1B 1B3QA 3HKDA 4L87A 1GM8A 1HDJA 5LA6A 1MOFA 2UU9O 3H01A 5EBWC 2A7WA 2Y69B 3STZC 1YZBA 1YJNV 3IC7A 3OE7G 3E8FA 1MNGA 4O2BA 3L70H 3ZHVA 3HB3B 3ETQA 4X1YA 3RW0A 2UXDB 1JPXA 3J80N 1DGSA 2HR3A 2KB1A 4JAAA 4DV6O 1H2NA 5A2QN 4LF9O 4X1KA 4PHZA 3L73H 2WLIA 2EILB 4R7CA 2BE3A 3JALB 1VQ7V 3CXHF 3LDDA 3JARB 4UB6Z 3ZMSA 4NXNB 1TUBA 1L0NH 5B1AB 1SQVH 3SYAA 2P67A 2ZT9B 3CRCA 2LGWA 3ASOB 4JYYA 1N36B 4FZ1A 2CTQA 4PI0A 2GUZA 5JCOA 4HAMA 4ZBMA 4DV3O 5B1NA 5IYBO 1YJ9V 5J2UB 4WBNA 5KUKA 2ADPA 1F4MA 1NZ6A 3LDCA 1OZ0A 2ZE8A 3SYOA 2RCVA 3CEIA 1EN4A 4DV0O 1I0HA 1DK1A 5IY5B 2ARHA 4ZHQB 2VWKA 3VOUA 4O4IB 1ZUQA 1A32A 1FS0G 2OCCB 3MHHC 1SZXA 2KSDA 1JX9A 1WPBA 3QNEA 1M93A 1FXHA 2R70A 1NKDA 2BTQB 1WP8A 5CN0A 5LL6Y 1T5EA 2YDEA 5KMGA 2CTPA 1R3LC 5KUMA 1UPGA 2JJ1G 1IXMA 4R50A 3ZEDA 4MW3A 5KX5A 4O4IA 1N32B 2JIZG 4LWSB 3K04A 3K79A 4CS4A 2GHYA 3QO5A 4B3TO 5IT9N 1KYOF 4DV0B 3RYCA 1MABG 3THOA 1P49A 3HKDB 3BA9A 1H2GA 4JV5B 4LR3A 3M7MX 5KMGB 3A2FA 2HLDG 5CB4A 4WFHA 1ENVA 1WB7A 5EIBD 1SQXH 2UUBO 2BTQA 4FMTA 4YHHB 1WLEA 4I4TA 5KHJA 2EIKC 2NN4A 3ASNB 4X20A 1GM9A 4UCVA 2C2AA 5EBLC 3GWOA 3QVNA 3F5WC 4GX2A 2XAGA 1VMGA 2IM9A 1TA8A 4CC6A 1NR1A 1VF6A 1NI8A 1XOUA 4P30A 2LFRA 1VQ9V 2WLLB 2IJIA 2A3QA 4GYCB 3K57A 3ABMB 1GTOA 1GN6A 3ZMVA 1DF4A 5GTIZ 5H6RA 1WPXA 1VQKV 3DGEA 2A79B 5LMUB 2N74A 1PM9A 3FB6C 3SPCA 3JASA 2IH1C 1Y6XA 4IHJB 2BSKA 3DXRB 4LH6A 3T1HO 2Q5ZA 3D8CA 4Q20A 1J5EO 1Q5OA 4DUYB 5KA6A 4TT3G 5GW7A 1BE3H 1VARA 4LBEC 3JATB 2E75B 4AILC 4UCSA 1K3EA 3ABUA 3QF7A 2F4VO 4K8XA 4WFAV 3B40A 1K4CC 1Q82W 2IU3A 1I94B 3OFNG 4GT1A 2JGUA 1IBMB 2BCCH 3SJCC 5L3CA 5J2TA 4O4LB 5KHIA 5B1OA 5EZYA 1AJQA 1XNQO 5C8YB 2JS5A 4I0XB 5E1AC 4DW0A 5LGUA 1S77D 3DC5A 3JAWA 4B3TB 5JVDB 2X6CA 1UJWB 4XDLA 4U3FH 3RT3C
chains in the Genus database with same CATH topology
2DQ3A 4G27B 4CZZA 2WWWA 3I55V 1TUEB 2IJKA 2JDIG 1PNLA 2XNDG 2MK3A 1NJIW 3AG2B 1K7DA 2EINC 2YEVA 5L3EA 1FXKC 3STLC 4J9YB 4QPJA 2JEXA 4ZKIA 4TWKA 2BOBC 2Z3YA 2JEUA 3SYQA 3F7VC 1KQSU 1GM7A 2W0FC 5HFMA 2W6JG 2DQ0A 2EIJC 4MTOA 2LP7A 2V1DA 2IJHA 3K0DA 2H94A 2ZXWB 5IYDO 4QE7A 3FKSG 3G4SV 3QO8A 2EILC 2EIMC 3OUFA 5CBHA 2PI5A 3OUSA 2A0LA 1NH2D 5LHHA 4MTXA 3I56V 3SPHA 3TCUA 3ABMC 3JD2A 5CBGA 2F43G 3OAAG 3ETDA 4LP8A 1F23A 1G8MA 3FYIB 2QE7G 1VQPV 1E79G 3JD3A 3W7WA 3ZMZA 1Q86W 2H8PC 3E35A 4JPRA 4PELA 4TSFG 5H6QA 1EZJA 4JTDB 2CK3G 5B3SC 3ML0A 5LGNA 2HG5C 3SPGA 3X2QC 1V55C 3P30A 3E2EA 4JYBA 2W6IG 3B8MA 2OTLV 1OCZB 1QLNA 4JTCB 1W2BU 1OCCC 5IY5C 1YJWV 1RM1B 1MSWD 4MVOA 1HWYA 1AI7A 1NR7A 1MG1A 4RUEA 2IJJA 3JD1A 1GO3F 2OCCC 4X89A 4MVUA 1VQ5V 1KECA 5LHGA 1COWG 1J95A 2P7TC 5L3DA 4JTAB 4MS2A 4QJFB 4GX1A 1QVGU 3JD0A 1XL4A 3T4ZA 1QBZA 1EFRG 1K73W 4MVQA 3KG2A 3SYPA 3SPIA 1B6QA 1AR1B 1YTFB 1R73A 3JYCA 2WAMA 1ZWIC 3DTUB 2GSMB 4RQFA 5EBMC 3EHBB 2WSSG 4X8AA 2DYRB 2Z5UA 4GX0A 4ASUG 1E1RG 3ABLC 1M1KW 1NBMG 2NNUA 3JD4A 4MVSA 4J9ZB 5CA3A 1EBOA 1QR9A 4MSWC 3K06A 1R6KA 3BEHA 3ASNC 1F51A 3FB5C 1M56B 4EKWA 2Q67A 4PA9A 4N23A 1KKDA 1AROP 3ASOC 4FIPC 2DYRC 5B1AC 2DWEC 3ZN0A 3F7YC 1H8HG 1OCRB 3OMIB 4QNHB 3OEHG 4R8CA 1QLEB 4RUFA 3CMAV 4MTGA 1NVPD 3ABTA 3CCQV 1PNKA 4JYCA 1JVMA 2QM7A 1KP3A 5CBFA 2Y69C 2B1GA 2XAFA 3D3IA 2QEXV 3AG3C 1I5YA 5EC1C 4BIUA 3K9AA 2EJRA 3LUTB 4P9OA 2R9RB 5IDJA 4PDRA 1KP2A 5J9PC 4U7OA 4LC1A 4XDKA 3OW2U 3CD6V 3LSQA 1SERA 4BW5A 1FXVA 2LFSA 1DTOA 3OMAB 1KD1W 5KA5A 1AI6A 2WLNA 4MVMA 1VQMV 5HFLA 1CPYA 1RPRA 2XOKG 1QR8A 3ZMUA 3LSSA 3RVYA 4CBCA 4UUJC 1OCRC 2D3OW 2XASA 2IH3C 2EIJB 1M57B 1JOYA 3SPJA 1NVPB 2AHZA 3CCMV 3R65A 4RQEA 4E2LA 2EBOA 1YITV 1V54B 1PNMA 3ETGA 2ZXWC 1BMFG 3OR6C 3T1CA 2YSUB 3W7UA 2EIKB 5EC2C 4DO2A 2QKSA 3WG7C 2JJ2G 4R6ZA 3WG7B 2WPDG 1VQLV 3OR7C 4JAVA 1FXKA 3RBZA 2JK5C 3ZRVA 3BY6A 3CCLV 2R9IA 3LDEA 2ZDIA 2P6JA 5LGTA 3CCVV 1ROPA 3B77A 1OCZC 1S0VA 5BZBA 4PA4A 4BAYA 3G6EV 3P32A 1P4RA 1K33A 2ATKC 1VQ4V 4LCUC 5C93A 2OT5A 4DXWA 1THZA 3B8NA 5B1BB 2IW5A 1SETA 3AG1B 3PJSK 1DLBA 2X7RB 4L87A 2UXXA 1GM8A 3K0GA 1K5QA 2B5UA 1PL0A 1DF5A 1MOFA 3X2QB 2HFEC 3H01A 5B3SB 5EBWC 3STZC 2Y69B 2X0LA 4FJCC 1N8RW 1YJNV 3IC7A 3OE7G 4G28B 1CEZA 3E8FA 2EZPA 2X6BA 1OCCB 3JCZA 3K03A 2A9HA 3ZN1A 1E1QG 4KUMA 3HB3B 2ITCC 3CCJV 3RW0A 4BIZA 1JPXA 2NLJC 2DYSC 3AEIA 1XL6A 2KB1A 1ORQC 2HR3A 2YEVB 3AG3B 2X6AA 1YTFD 3UM7A 3AG1C 3E86A 2UXNA 1G4YB 1OHHG 2WLIA 3CXCU 4X88A 2EILB 2B1IA 2EIMB 4R7CA 3FYEB 1VQ7V 1LNQA 3LDDA 3ZMSA 1K5SA 4MVZA 1FXKB 4JASA 5B1AB 2WLJA 3SYAA 2P67A 1K97A 1JCHA 3RVZA 3ASOB 5DN6G 1QCEA 1K8AW 3E8HA 2Q69A 3OM3B 1L1FA 3W7XA 3CYOA 4MW8A 1V54C 1QLEC 4HAMA 4ZBMA 2ZQMA 3GB7C 3K08A 5B1NA 5IYBO 1VQ6V 3ZRWB 3CPWU 1YJ9V 4UVBA 4I5SA 1QVFU 1GMGA 3OMNB 5KUKA 1F4MA 4PDVA 2EZOA 3OEEG 2QA4V 3LDCA 3OGCC 3TETA 1OZ0A 4WFGA 4WFEA 4RO2A 2K1EA 4OXSA 3SYOA 3CCSV 3W7SA 4HYOA 2HVJC 4U7NA 5IY5B 4YXWG 1GKFA 1M9NA 3VOUA 1AI4A 3ABLB 1R3JC 1OCOC 4UV8A 1Y4MA 3G71V 1FS0G 3FB8C 2OCCB 3MHHC 4KFMA 1Y66A 4XDJA 1JX9A 3QNEA 1K9MW 2FTKA 3NXSA 1SESA 5L3BA 1RM1C 4Z1MG 1NQTA 3ZRXA 1FXHA 1NKDA 3LNMB 4PDLA 3ABKC 3K3WA 5CN0A 2DYSB 3ZJZA 1AI5A 1R3LC 5KUMA 1JQ0A 2JJ1G 1K92A 1IXMA 1YI2V 4MVRA 2QTOA 3W7TA 4R50A 1AJNA 4P9PA 4MW3A 3E8GA 2ZD9A 4WFFA 4JF3A 3FB7C 2WLIB 4FK5C 5CMUA 3SYCA 3ZRSA 3CCUV 2JIZG 1S76D 3T4DA 5LHIA 4XBFA 4P2ZA 1GK9A 1VQ8V 3E8BA 3CC7V 3K04A 3WFVA 3K79A 1BHAA 2GHYA 3QO5A 4GX5A 4H37A 2BOCC 2Q68A 4N21A 3M99B 1MABG 4PDMA 4H33A 4UV9A 1H2GA 1S5HC 1SRYA 1AJPA 2HLDG 1H38A 1BHBA 4JAUA 3ABKB 4WFHA 1NH2B 1ENVA 1OCOB 4QIWF 3AG2C 2EINB 1RPOA 5B1BC 4FMTA 1Q7YW 1WLEA 3QO7A 4PA3A 3AG4B 2HJFC 4UVAA 2EIKC 1YHQV 4FPPA 3TK1A 3ASNB 4WCEV 3E83A 1GM9A 2AHYA 2C2AA 4UVCA 5EBLC 2ZDIC 3GWOA 4PA6A 4GCZA 3F5WC 3UKMA 3VBBA 4HZ3A 1R6NA 2XAQA 2QM8A 2DW4A 4GX2A 2XAGA 1V55B 3CC4V 3MHSC 4F4LA 1NR1A 4P30A 4QE9A 3T2MA 1K4DC 1K34A 2XAHA 1BL8A 3AG4C 2LFRA 1VQ9V 2WLKA 3IGAC 4JGSA 2WLMA 2WLLB 3IFXA 2IJIA 1PD3A 2HKOA 4QPKA 4WFBV 4WF9V 4I9WA 1YSCA 2P90A 5IYCO 3ABMB 1GTOA 1CP9A 3ZCCA 3ZMVA 1DF4A 3HPLC 5DM6V 5H6RA 1WPXA 5LBQA 1VQKV 4PA7A 5FL7G 2M7WA 3DGEA 2A79B 1R3KC 1M57C 3SPCA 3FB6C 1F4NA 2IH1C 3E89A 5EK0A 1W0JG 2OTJV 1VQOV 5L3FA 1FFTB 2HVKC 3CCEV 2Q6AA 4Q20A 1I5XA 3ZMTA 5KA6A 3A0RA 4TT3G 2PI4A 4UXNA 2WLLA 4KP4A 3D36A 5GW7A 1SZTA 1H8EG 4LBEC 3ZIAG 1JJ2U 5L3GA 2WLHA 1YIJV 2XAJA 1Q81W 1S72V 1PKXA 3CCRV 3EFFK 1K3EA 3ABUA 4WFAV 1K4CC 1Q82W 2IU3A 3CC2V 3OFNG 3SJQC 4GT1A 2Y48A 2ZR3A 5L3CA 1R3IC 4MT8A 4G2KA 3ZRWA 5B1OA 1S3JA 1AJQA 1W0KG 3CP1A 4RAIA 2V7QG 3ETEA 1M90W 4MTFA 2DWDC 5H9CA 5E1AC 5LGUA 1S77D 1P7BA 1VQNV 3CMEV 1M56C 2IU0A 2X6CA 1UJWB 1KC8W 4XDLA 3MD0A 2ITDC 2ZR2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X6A A;  4G27 B;  1JVM A;  5B1B C;  5CBF A;  3UM7 A;  3AG1 C;  3E86 A;  1G4Y B;  2Y69 C;  2WLI A;  4PA3 A;  4X88 A;  4R7C A;  2EIN C;  2HJF C;  2EIK C;  2YEV A;  3AG3 C;  5EC1 C;  1LNQ A;  3LDD A;  4MVZ A;  3STL C;  4J9Y B;  3LUT B;  4P9O A;  2R9R B;  3E83 A;  2AHY A;  2BOB C;  4PDR A;  4TWK A;  2WLJ A;  5EBL C;  3SYA A;  3SYQ A;  3RVZ A;  5J9P C;  3F7V C;  4PA6 A;  3F5W C;  3UKM A;  2W0F C;  4XDK A;  4HZ3 A;  3E8H A;  2Q69 A;  4BW5 A;  2EIJ C;  4MW8 A;  4GX2 A;  4MTO A;  1V54 C;  2WLN A;  3K0D A;  4MVM A;  1QLE C;  4F4L A;  4ZBM A;  4P30 A;  4QE9 A;  3GB7 C;  3K08 A;  1K4D C;  4QE7 A;  3T2M A;  2EIL C;  1BL8 A;  2EIM C;  3AG4 C;  3OUF A;  5CBH A;  2WLK A;  3IGA C;  3OUS A;  2A0L A;  2WLM A;  2WLL B;  5KUK A;  3SPH A;  3TCU A;  3IFX A;  3ABM C;  4PDV A;  3RVY A;  4CBC A;  5CBG A;  3LDC A;  3OGC C;  4UUJ C;  3TET A;  4WFG A;  4LP8 A;  4WFE A;  4RO2 A;  2K1E A;  4OXS A;  1OCR C;  3SYO A;  4I9W A;  4HYO A;  2HVJ C;  2IH3 C;  3SPJ A;  3HPL C;  2AHZ A;  3VOU A;  2H8P C;  3R65 A;  4PA7 A;  1R3J C;  1OCO C;  2A79 B;  1R3K C;  1M57 C;  4JTD B;  3FB6 C;  3SPC A;  5B3S C;  2HG5 C;  2IH1 C;  3E89 A;  3FB8 C;  3SPG A;  3X2Q C;  1V55 C;  5EK0 A;  4KFM A;  4XDJ A;  2ZXW C;  3OR6 C;  3T1C A;  5EC2 C;  2QKS A;  4JTC B;  3WG7 C;  1ORQ C;  4R6Z A;  1OCC C;  5IY5 C;  2HVK C;  3AG2 C;  3OR7 C;  2Q6A A;  4MVO A;  3LNM B;  4PDL A;  3ABK C;  3RBZ A;  2JK5 C;  4RUE A;  3ZJZ A;  3LDE A;  2OCC C;  4X89 A;  1R3L C;  2WLL A;  4MVU A;  5KUM A;  1J95 A;  2P7T C;  4LBE C;  4JTA B;  4MS2 A;  4GX1 A;  1OCZ C;  2QTO A;  2WLH A;  4MVR A;  1XL4 A;  3T4Z A;  4R50 A;  5BZB A;  4PA4 A;  4MVQ A;  3KG2 A;  3SYP A;  3SPI A;  3EFF K;  4P9P A;  4MW3 A;  3E8G A;  3JYC A;  2ZD9 A;  2ATK C;  1ZWI C;  4WFF A;  4LCU C;  1K4C C;  5EBM C;  3FB7 C;  2WLI B;  4X8A A;  3SYC A;  4DXW A;  3ZRS A;  3SJQ C;  4GX0 A;  3T4D A;  3PJS K;  1R3I C;  3ABL C;  4P2Z A;  3E8B A;  4MVS A;  3K04 A;  4J9Z B;  3K0G A;  4MSW C;  3K06 A;  3BEH A;  4GX5 A;  4RAI A;  2HFE C;  3ASN C;  4H37 A;  3FB5 C;  2BOC C;  5EBW C;  3STZ C;  4MTF A;  2DWD C;  4EKW A;  2Q68 A;  2Q67 A;  5E1A C;  4PDM A;  4G28 B;  4PA9 A;  4H33 A;  3E8F A;  1P7B A;  2X6B A;  1KKD A;  1S5H C;  3K03 A;  1M56 C;  2A9H A;  3ASO C;  2DYR C;  5B1A C;  2DWE C;  2ITC C;  2X6C A;  3F7Y C;  4QNH B;  4XDL A;  3RW0 A;  2NLJ C;  2DYS C;  4R8C A;  4WFH A;  1XL6 A;  2ITD C;  4RUF A;  2KB1 A;  4MTG A; 
#chains in the Genus database with same CATH topology
 4TV9 B;  1TUE B;  1PNL A;  4K8Z A;  5L3E A;  3SJA C;  5EZY B;  3KCY A;  1JA8 A;  3STL C;  1H2K A;  2A06 H;  2QWR B;  4TWK A;  1IBL O;  4YY3 B;  5AG2 A;  2JRI A;  5FLX N;  4BIO A;  4X65 O;  3UO2 A;  2QWN B;  3S3W A;  3K0D A;  2P4K A;  4LFA O;  4DR2 O;  4GKK B;  1TUB B;  2ZXW B;  3EVK A;  2E5L B;  2EIL C;  4LH7 A;  4X65 B;  3OUS A;  2A0L A;  3RYH A;  1NH2 D;  3I56 V;  3SPH A;  3TCU A;  3CRA A;  1HNW B;  1F23 A;  3HR0 A;  2KKW A;  3JAM N;  3OT7 A;  3CSX A;  1B06 A;  3JD3 A;  4EEQ A;  3E35 A;  4JPR A;  3BA8 A;  4PEL A;  1AR4 A;  4JTD B;  1Q6U A;  4DRX B;  1Q90 D;  2HG5 C;  4LF8 O;  2Q0O C;  3OTF A;  1XHZ A;  2W6I G;  5LP6 C;  1W2B U;  2Q73 A;  1OCC C;  4X64 B;  2GTA A;  1NTZ H;  4LF9 B;  2LQT A;  4MVO A;  1HWY A;  4JZG A;  5JJJ B;  1NR7 A;  4RUE A;  4YJ3 A;  3JD1 A;  5LHG A;  4MS2 A;  3T4Z A;  4KXR A;  1QBZ A;  1K73 W;  3SPI A;  1AR1 B;  5JQG B;  2GTS A;  3RYI A;  2DYR B;  2Z5U A;  3ABL C;  2YIC A;  2Y4T A;  2NNU A;  4MVS A;  4X62 B;  5CA3 A;  1AP5 A;  1ZTE A;  4MSW C;  2K9P A;  2QWQ B;  3K06 A;  4DR3 B;  3BRC A;  3FB5 C;  4J7J A;  1ARO P;  3ASO C;  2DYR C;  5B1A C;  1VF7 A;  4O4H B;  1OCR B;  3OMI B;  5JJE B;  3CMA V;  4JYC A;  1XRE A;  1GRJ A;  2QM7 A;  1KP3 A;  3N2K B;  1TGO A;  3F5T A;  5EC1 C;  4BIU A;  2EJR A;  3UT5 B;  2R9R B;  4PDR A;  1Q6I A;  3K59 A;  3D36 C;  2LGQ A;  5J9P C;  1LR1 A;  3E22 B;  4XDK A;  1SER A;  3K5O A;  3K5L A;  1DTO A;  3OMA B;  3FFQ A;  1EN6 A;  4MVM A;  1CPY A;  1RPR A;  1QHT A;  1EZV H;  2FKX A;  2OWO A;  1BT8 A;  3ZMU A;  4FFK A;  3L75 H;  4LF7 O;  4CBC A;  4H44 B;  1YEW A;  3HKC B;  1M57 B;  1N0N A;  3SPJ A;  2ETN A;  2FL4 A;  3AK3 A;  3K9S A;  2AHZ A;  3CCM V;  1FPO A;  4EFE A;  4H0L B;  2LO1 A;  4E2L A;  5JJN B;  3ETG A;  4UFZ A;  2YSU B;  3AK1 A;  1WAZ A;  2EIK B;  2GDS A;  4B3S O;  4R6Z A;  4JAV A;  4YHH O;  2DJV A;  2JK5 C;  3LDE A;  3CWB H;  2V4D A;  4B3M O;  1ROP A;  1SQG A;  1S0V A;  5BZB A;  2MW2 B;  3G6E V;  3CRM A;  1VQ4 V;  3JAL A;  2HHH B;  2E76 B;  4FM2 A;  2OT5 A;  3B8N A;  5B1B B;  2IW5 A;  3JSL A;  1SET A;  5B66 Z;  2X7R B;  1BGY H;  1PL0 A;  4X1Y B;  5LXT A;  2HFE C;  1WA8 A;  3HKC A;  2X0L A;  4DR5 O;  5JH7 A;  4FM1 A;  3PN1 A;  2DMX A;  2X6B A;  1OCC B;  2ITC C;  5DEC A;  3CCJ V;  3AEI A;  2ILM A;  1ORQ C;  2X6A A;  4NXM O;  2UXN A;  4X88 A;  4YIP A;  1NU1 H;  4JAS A;  2R9A A;  1WB8 A;  4W4K A;  4NKG B;  1IDS A;  3RVZ A;  4JI2 O;  2UXC O;  1QCE A;  3S3X A;  5GTH Z;  1US6 A;  3OM3 B;  3CYO A;  2F66 C;  2DOS A;  3UT5 A;  1I94 O;  4X20 B;  3K08 A;  3ZRW B;  4UVB A;  1GMG A;  1Y76 B;  2EZO A;  3OEE G;  3FX7 A;  1HR0 B;  4RO2 A;  4X66 B;  2HJD A;  4I4T B;  1OJH A;  5DED A;  3JSN A;  1BCC H;  1M9N A;  1AI4 A;  3ABL B;  1R3J C;  4UV8 A;  3RN4 A;  2ZNI A;  3RYF B;  5LMN B;  3FB8 C;  3G6B A;  1Y66 A;  3G67 A;  2RMK B;  4XDJ A;  1S5L Z;  2UUC O;  1NQT A;  3CS5 A;  3RWR D;  4FLZ A;  2YID A;  4NTW A;  3VQW A;  4QGP A;  3LNM B;  2YUA A;  1SF9 A;  3ZJZ A;  1N36 O;  2QJ1 A;  2ZKO A;  1K92 A;  4MVR A;  2QTO A;  2CUG A;  1HNX B;  4GUN A;  3E8G A;  4WFF A;  2JVD A;  2AXT Z;  3SYC A;  4IYH A;  1O9G A;  1M5I A;  1S76 D;  3T4D A;  5LHI A;  4XBF A;  1RSO A;  3UO3 A;  1GK9 A;  3E8B A;  3CC7 V;  3VQX A;  4RWU A;  5KHG A;  4DR7 B;  4TQF A;  4H37 A;  2PF4 E;  2KG7 B;  2AZ2 A;  4F6E A;  4H33 A;  1N0J A;  2JS3 A;  1S5H C;  4LFC O;  2Q7E A;  4DR4 O;  1AJP A;  4W4L A;  1WA8 B;  3ABK B;  3AG2 C;  2ODM A;  2EIN B;  3C90 A;  4FZ0 A;  4PA3 A;  4FFB B;  5TIS Z;  2OIE A;  1GH6 A;  4LF4 B;  4FPP A;  3TK1 A;  2PYJ A;  3U10 A;  3BCC H;  5J2T B;  4UVC A;  2AHY A;  4DV7 O;  2QGN A;  1XI1 A;  1R6N A;  4JI1 B;  2W0X A;  5IJ0 A;  4K0K B;  3U0Z A;  1V55 B;  3CHX A;  5JQG A;  4QE9 A;  3T2M A;  3ZHR A;  3IGA C;  2XT9 A;  5GON A;  3IFX A;  1B04 A;  1SKV A;  4WFB V;  3I5D A;  5BR8 O;  4CH4 A;  1SQQ H;  4WF9 V;  3L72 H;  3L74 H;  4I9W A;  1YSC A;  4O2A B;  3ZHS A;  4NTY A;  3HPL C;  4U3J B;  3H1J H;  1AIL A;  5LBQ A;  4PA7 A;  2QSA A;  1F4N A;  1YDX A;  4ZI7 B;  3E89 A;  4LF6 B;  5EK0 A;  3GWK C;  2Q9L A;  2OTJ V;  5KAF Z;  5CA1 B;  5L3F A;  4IT5 A;  4LF8 B;  3CCE V;  2Q6A A;  4EB6 A;  1W59 A;  2PI4 A;  2F93 B;  1PV0 A;  1SZT A;  3P3P A;  3ZIA G;  1NS1 A;  4ABM A;  1HW7 A;  2ZM6 O;  3HKE A;  1S72 V;  4J80 A;  3EFF K;  2QDO A;  4JI6 B;  4K0K O;  3ZBH A;  2Q7G A;  3CC2 V;  4DV4 B;  3SJQ C;  2Y0I A;  2YXY A;  1S3J A;  5BXZ A;  3OTO O;  5BY1 A;  1W0K G;  4RAI A;  4O4H A;  2V7Q G;  1M90 W;  4MTF A;  2DWD C;  5LOV B;  1HNZ B;  1P7B A;  1VQN V;  3WU2 Z;  1VIB A;  4JI8 O;  1MZE A;  3MD0 A;  3D3Q A;  2OCH A;  4LFC B;  5JVD A;  3CB2 A;  2IJK A;  3RYI B;  2O57 A;  4J9Y B;  2RNB A;  2JEX A;  4ZKI A;  2Z3Y A;  1PP9 H;  3HKE B;  3N2K A;  1GM7 A;  2W0F C;  4NXN O;  1IUR A;  1I08 A;  1L8D A;  2V1D A;  2XTA A;  2IJH A;  2H94 A;  1VP7 A;  1WNS A;  3CRQ A;  1EM1 A;  4QE7 A;  1WP7 A;  3H9V A;  3OUF A;  5LP6 B;  1QNM A;  3JD2 A;  5CBG A;  2F43 G;  3OAA G;  3ETD A;  4LP8 A;  1FKA O;  5LA6 B;  1G8M A;  2NR5 A;  3ZMZ A;  1Q86 W;  2N05 A;  3A0B Z;  4TSF G;  5B3S C;  2YIA A;  1AB3 A;  3X2Q C;  3P30 A;  3VQV A;  1ZLZ A;  4BWA A;  3B8M A;  1OCZ B;  1QLN A;  4JTC B;  3R66 A;  3RYH B;  5IY5 C;  3H1H H;  1YJW V;  1RM1 B;  1MSW D;  1EN5 A;  3ZHU A;  4X89 A;  1VQ5 V;  3AK2 A;  1COW G;  2P7T C;  2UXB B;  3KG2 A;  3SYP A;  1YTF B;  1R73 A;  2CE4 A;  2GSM B;  5JCO C;  4DV1 B;  2YI9 A;  4AI8 A;  1Q43 A;  4JI7 B;  2WSS G;  3Q4H B;  2E3C A;  1WJZ A;  1KUQ A;  1BQZ A;  4DR6 B;  4J9Z B;  4BR6 A;  4J42 A;  1EBO A;  5D5Q A;  2VQE O;  4NB5 A;  1R6K A;  4DV4 O;  1M56 B;  3AG7 A;  3QTC A;  5LMN O;  1KKD A;  2WA4 A;  3ZN0 A;  1H8H G;  4QNH B;  3OEH G;  1NVP D;  3ABT A;  1XIL A;  3A0H Z;  1PNK A;  1OV9 A;  5CBF A;  1N34 B;  4DV7 B;  2M6Y A;  4X1I B;  1AP6 A;  1N4C A;  3D3I A;  1I5Y A;  3BAB A;  4J7K A;  4P9O A;  1S5J A;  2FML A;  1XMQ O;  3L9D A;  4LC1 A;  4U7O A;  2ZIN A;  2PTM A;  3OW2 U;  3LSQ A;  2CTW A;  4LFB B;  1KD1 W;  4JI0 O;  1VQM V;  3TXS A;  4UUJ C;  4B3R B;  4GKJ B;  1OCR C;  2XAS A;  2EIJ B;  3LSU A;  3JAS B;  2Q0A A;  1NVP B;  3JCU Z;  5JWP A;  1BQ0 A;  4RQE A;  2L6L A;  2PY5 A;  1X4T A;  1YIT V;  1V54 B;  3OR6 C;  4DR4 B;  2E74 B;  3WG7 B;  3H1L H;  4UB8 Z;  1FXK A;  4EFB A;  1IBL B;  3BY6 A;  5D5P A;  2QM4 A;  4TQD A;  2QTS A;  4I7Z B;  2P6J A;  4NTX A;  3CCV V;  4DV2 O;  1R6T A;  2CDY A;  5EYP A;  3ZHT A;  2E5L O;  1K33 A;  1VF6 C;  4DV2 B;  3APO A;  4FM0 A;  4J41 A;  3PJS K;  1DLB A;  4AQY O;  4CH3 A;  2UXX A;  1PL4 A;  1DF5 A;  4B3R O;  4G28 B;  1CEZ A;  4LWS A;  3JAT A;  2UUB B;  3K03 A;  3ZN1 A;  1N33 B;  1D2D A;  3TJT A;  4BIZ A;  2NLJ C;  1XL6 A;  4IHJ A;  2CGN A;  3AG3 B;  3G80 A;  3UM7 A;  4D7T A;  3E86 A;  1G4Y B;  3CXC U;  3FYE B;  1LNQ A;  1K5S A;  1FXK B;  4OPA A;  2GV9 A;  1K97 A;  2UUA O;  2ZM6 B;  5DN6 G;  1GN3 A;  3M8A A;  1K8A W;  1D5N A;  2Q69 A;  1L1F A;  3W7X A;  1V54 C;  5KHK A;  1QLE C;  5IJ9 B;  2ZQM A;  3DC6 A;  4I5S A;  1QVF U;  3OMN B;  3OTO B;  4PDV A;  1U96 A;  3TET A;  4WFG A;  4DR3 O;  4WFE A;  2K1E A;  3CCS V;  4UCR A;  2HVJ C;  4U7N A;  3JAW B;  1GKF A;  3C3S A;  2PZS A;  1OCO C;  1Y4M A;  3K5N A;  1AVM A;  1K9M W;  2FTK A;  1SES A;  5L3B A;  4Z1M G;  4B7E A;  3A8T A;  4AHC A;  5IJ9 A;  4PDL A;  2DYS B;  5B5E Z;  2CH7 A;  4HBN A;  4UCT A;  4C7U A;  4CH6 A;  1AJN A;  4D7S A;  1XDC A;  4P9P A;  4DUZ O;  1X59 A;  2ZD9 A;  4GLX A;  1YF2 A;  1H2L A;  5FNV B;  4DW1 A;  2ZIM A;  2WLI B;  4FK5 C;  3CCU V;  5GON B;  3BHP A;  1TAE A;  3RFR A;  1SQP H;  4LF5 O;  3MAQ A;  5BR8 B;  2BOC C;  4N21 A;  3M99 B;  4PDM A;  4J11 A;  4UV9 A;  5H5N A;  4F6R A;  3SJB C;  2L35 A;  1H38 A;  4JAU A;  5CA0 B;  4QIW F;  5LP6 A;  3WB0 A;  1H2S B;  5KAI Z;  2UXC B;  4U3J A;  4UVA A;  1YHQ V;  4ZHQ A;  1XUQ A;  1FJG B;  3B09 A;  4GKK O;  2ZDI C;  2CGO A;  4GCZ A;  4PA6 A;  1XBL A;  3UKM A;  3VBB A;  4FLT A;  1L0L H;  1BS3 A;  2DW4 A;  1PPJ H;  3CC4 V;  2D2C B;  1K4D C;  5IJ0 B;  2XAH A;  1BL8 A;  2N04 A;  2WLK A;  4JGS A;  4DR7 O;  4YJ3 B;  2QR4 A;  2P90 A;  4DR6 O;  1CP9 A;  4TUY B;  3JAR A;  1Y67 A;  5FL7 G;  2M7W A;  1R3K C;  5BMV B;  5JH7 B;  4X64 O;  1W0J G;  1Z5W A;  4I55 A;  1VQO V;  5LMU O;  4OX9 B;  2OYQ A;  1Q8I A;  2HVK C;  3H1I H;  1YVW A;  3ZMT A;  4NR1 A;  2Q4P A;  3T1H B;  4UXN A;  4KP4 A;  3D36 A;  1H8E G;  1JJ2 U;  3EXA A;  1YIJ V;  2XAJ A;  1XEQ A;  5IYZ A;  1IBM O;  4TUY A;  3BPZ A;  2JGD A;  1NTM H;  2AW9 A;  4FLV A;  3CJH B;  3CRR A;  4LNU A;  2R72 A;  5LOV A;  1JFF B;  2Y48 A;  2ZR3 A;  1HR0 O;  2XUM A;  1R3I C;  4DUZ B;  4G2K A;  3ZRW A;  4FLW A;  3CP1 A;  2PUS A;  4JI4 O;  3ETE A;  5H9C A;  3N27 A;  4B08 A;  1M56 C;  1Z5V A;  1KC8 W;  1IBK O;  3O65 A;  2ITD C;  2ZR2 A;  1ZAU A;  1G6U A;  3BAA A;  2DQ3 A;  4G27 B;  3I55 V;  2JDI G;  1I7F A;  1QU7 A;  1Y74 A;  2VS0 A;  2XND G;  2MK3 A;  1TVK B;  1K7D A;  3N2G B;  2YEV A;  4NVP A;  4LNU B;  2BOB C;  4IL6 Z;  4DUY O;  1M4U A;  3F7V C;  5HFM A;  2W6J G;  5K1P A;  3RYC B;  2EIJ C;  3MDS A;  4MTO A;  2LP7 A;  4YY3 O;  1XMQ B;  3G4S V;  3QO8 A;  5CBH A;  4MTX A;  1NT2 B;  5ITZ B;  3FYI B;  1VQP V;  3W7W A;  2H8P C;  4DK0 A;  2PYL A;  5H6Q A;  1EZJ A;  2CK3 G;  2ZE7 A;  4IYI A;  2RJZ A;  1V55 C;  1WN7 A;  2OTL V;  3N2G A;  5KLV H;  4DV6 B;  4DK1 A;  1O9H A;  1RFY A;  2OCC C;  4MVU A;  4I50 A;  1J95 A;  5L3D A;  4JTA B;  4JI1 O;  4GX1 A;  2UUA B;  1XL4 A;  4MVQ A;  4DV3 B;  1B6Q A;  4LFB O;  3HKB A;  1ZWI C;  3DTU B;  4RQF A;  4FLY A;  4X8A A;  3RYF A;  3WB2 A;  4GX0 A;  1XMO B;  1E1R G;  2IBZ H;  1M1K W;  1NBM G;  3CJH A;  5CB4 B;  4GKJ O;  1V9P A;  2LW1 A;  3ZX6 A;  2Q67 A;  3WB1 A;  4N23 A;  1D5A A;  3F7Y C;  1IXB A;  4J7Z A;  4R8C A;  5E79 Z;  4RUF A;  4KHP O;  4J10 A;  4MTG A;  1JMK C;  3CCQ V;  4ZOL B;  3AG3 C;  4I50 B;  3LUT B;  1LUV A;  4HNA B;  4BW5 A;  4JI6 O;  1AI6 A;  2WLN A;  4H13 B;  4JI7 O;  5HFL A;  5A9G A;  1BZK A;  5FPO A;  5K1X A;  3CE2 A;  3APQ A;  2XOK G;  2VQE B;  1Z2G A;  4UCU A;  3RVY A;  4B7K A;  2D3O W;  3O9O A;  4JYA B;  5EYP B;  4ZI7 A;  4JV5 O;  2P5O A;  3R65 A;  4JI8 B;  4JYA O;  2ZXW C;  1BMF G;  1N34 O;  1RP3 B;  5EC2 C;  4DO2 A;  2RQ6 A;  2DE0 X;  3WG7 C;  2JJ2 G;  2WPD G;  2G38 A;  4I0X A;  4B3M B;  3OR7 C;  3TXQ A;  1GN2 A;  4OGQ B;  2HEP A;  2R9I A;  3IJ4 A;  5LGT A;  1UFI A;  2HHH O;  2QWO B;  4TV9 A;  4BAY A;  3P32 A;  1P4R A;  2ATK C;  2DN9 A;  2RN9 A;  1FAF A;  1VF5 B;  1IX9 A;  4DXW A;  4X1K B;  1FD9 A;  3K0G A;  2QWP B;  1K5Q A;  2B5U A;  3OD4 A;  3H1K H;  5FNV A;  3X2Q B;  3ZS8 C;  5IWA B;  1N32 O;  5B3S B;  4UCO A;  1IBK B;  2P06 A;  4FJC C;  1N8R W;  1SS3 A;  5KHH A;  2EZP A;  3JCZ A;  2A9H A;  3QG5 A;  1E1Q G;  4KUM A;  5CA1 A;  4DR5 B;  1KU9 A;  2DYS C;  1HNZ O;  2YEV B;  1YTF D;  3U11 A;  4F6R B;  3AG1 C;  4FLX A;  1OHH G;  3E22 A;  2EIM B;  2B1I A;  4YJ2 A;  4MVZ A;  1XHX A;  1J5E B;  4I9Q A;  2WLJ A;  1JCH A;  1KMI Z;  1SQF A;  3E8H A;  2F4V B;  3UQ8 A;  4MW8 A;  2H3O A;  3GB7 C;  1VQ6 V;  3CPW U;  2QA4 V;  2UU9 B;  3OGC C;  4K35 A;  2GUZ B;  4OXS A;  3W7S A;  4HYO A;  1ZX3 A;  3FAV A;  3K5M A;  4YXW G;  5IYZ B;  4WBN B;  5J2U A;  4X66 O;  2UUC B;  3FAV B;  3G71 V;  2PGG A;  4KFM A;  4Z1V A;  2ZE6 A;  3B4S A;  3NXS A;  1RM1 C;  4JI5 B;  3ZRX A;  1IZ3 A;  4CC5 A;  5LXT B;  3ABK C;  3K3W A;  4I55 B;  1KBH A;  4L8J A;  1AI5 A;  1JQ0 A;  5LYJ B;  3L71 H;  1YI2 V;  1JFF A;  3W7T A;  4CS2 A;  1URF A;  4JZ2 A;  5F2V O;  4JF3 A;  1SA0 A;  3FB7 C;  5CMU A;  3ZRS A;  4DRX A;  4X1I A;  2Z0A A;  4P2Z A;  1VQ8 V;  1P84 F;  4NYK A;  1SA0 B;  3WFV A;  4DYL A;  2VWJ A;  1BHA A;  1JR9 A;  4PD4 F;  4GX5 A;  2CAZ C;  1HNW O;  5ITZ A;  4DR1 O;  1MSD A;  2Q68 A;  1R1B A;  5LYJ A;  3B2E E;  2RDC A;  4JI4 B;  1SRY A;  1XNR B;  1BHB A;  2F95 B;  1NH2 B;  1OCO B;  1RPO A;  5B1B C;  1Q7Y W;  3QO7 A;  4OX9 O;  3AG4 B;  2HJF C;  1FFX A;  2YIB D;  4FLU A;  4WCE V;  3E83 A;  2WA3 A;  4HZ3 A;  3KZI Z;  4LF4 O;  2XAQ A;  2QM8 A;  2JGD B;  2B9Z A;  3MHS C;  4E4E A;  4F4L A;  1XMO O;  1MA1 A;  3HKB B;  1K34 A;  3AG4 C;  4AQY B;  4K3A A;  2P4V A;  2WLM A;  4Q6G A;  4TV8 B;  1PD3 A;  2HKO A;  4QPK A;  4X62 O;  4LF6 O;  5IYC O;  3VQY A;  3ZCC A;  5DM6 V;  4X9Q A;  4O2B B;  4DR1 B;  2EJ7 A;  1M57 C;  3KKY A;  2QKC A;  1U97 A;  2HP8 A;  2ZNJ A;  1FFT B;  1NTK H;  4BW9 A;  3SDL A;  1I5X A;  3GVM A;  3ICX A;  1SC5 B;  2BTO A;  1TVK A;  3A0R A;  2WLL A;  1XQ8 A;  5L3G A;  2F1M A;  2WLH A;  4HNA A;  2YI8 A;  4O4J B;  3IC9 A;  1Q81 W;  1KKC A;  3JAK A;  2YXL A;  1PKX A;  3CCR V;  2Y0P A;  4IIJ B;  4TV8 A;  4ZOL A;  2VRZ A;  1ZL8 A;  4MT8 A;  2YS8 A;  2LW7 A;  3TGU H;  1KB9 F;  3T1Y B;  1Y74 B;  1JJO A;  1MZF A;  3CME V;  2IU0 A;  4YIO A;  1G1X B;  3FD9 A;  4CZZ A;  2WWW A;  1Y76 A;  4JI3 B;  1NJI W;  4JI2 B;  3AG2 B;  2EIN C;  3J7A U;  1FXK C;  3KCX A;  4KHP B;  4PJ0 Z;  4QPJ A;  4PI2 A;  4O4J A;  2JEU A;  3SYQ A;  3JAK B;  4FVM A;  1KQS U;  4O4L A;  2FYU H;  2DQ0 A;  2KG7 A;  3DXR A;  2Q8V A;  5KX5 B;  4DV1 O;  1HP8 A;  3UCS C;  5IYD O;  2FB5 A;  3FKS G;  2PI5 A;  2EIM C;  2KQX A;  1RSO B;  1P7G A;  5LHH A;  1Q3E A;  3ABM C;  2ADQ B;  2AGA A;  2EX3 A;  2QKA A;  2QE7 G;  2VQF B;  1E79 G;  1BSM A;  3CX5 F;  3T1Y O;  3ML0 A;  5LGN A;  3SPG A;  3E2E A;  4JYB A;  1IVS A;  4TOI A;  4D6T H;  2ZIO A;  5C8Y A;  4NXM B;  2BSK B;  4JI3 O;  1AI7 A;  1MG1 A;  2IJJ A;  1GO3 F;  1KEC A;  3Q4H A;  4QJF B;  1QVG U;  3JD0 A;  1H2M A;  2LJ2 A;  2AZ0 A;  1EFR G;  2ZE5 A;  4DV5 B;  4ZIB A;  3JYC A;  2P22 C;  2WAM A;  4PV1 B;  1VEW A;  5EBM C;  3EHB B;  1LUW A;  4ASU G;  1ZSP A;  3C3T A;  2ZCE A;  4DV5 O;  3JD4 A;  5FPR A;  4IGG A;  4LF7 B;  3LNN A;  1QR9 A;  4O2A A;  3BEH A;  1GAX A;  3ASN C;  1N33 O;  1F51 A;  4EKW A;  1ZL8 B;  3K58 A;  2F23 A;  4PA9 A;  2YC0 A;  3J81 N;  2VQF O;  4FIP C;  5IWA O;  2DWE C;  4JI5 O;  1QLE B;  4CH5 A;  4Z2W A;  1JVM A;  2Q7H A;  2Y69 C;  2B1G A;  2XAF A;  2YXH A;  2QEX V;  4B3S B;  4EB6 B;  3K9A A;  3BVO A;  5IDJ A;  1KP2 A;  3ZHQ A;  4DR2 B;  1FYJ A;  3CD6 V;  1YCI A;  1FXV A;  2LFS A;  1FJG O;  4GZR B;  2YIB A;  5KA5 A;  5EIB C;  1QR8 A;  2XHB A;  3LSS A;  3NR7 A;  1Q6H A;  2IH3 C;  5BMV A;  1JOY A;  1CXZ B;  1XNQ B;  5CA0 A;  2UXD O;  2EBO A;  4A5U B;  1PNM A;  3IAY A;  3T1C A;  1XNR O;  4FFB A;  3W7U A;  2QKS A;  4CS3 A;  3OGI B;  1AR5 A;  3DSQ A;  1GN4 A;  1VQL V;  4OPH A;  1SQB H;  3RBZ A;  3ZRV A;  2OIG A;  1FFX B;  4KL1 A;  3CCL V;  2ZDI A;  2CTR A;  3SGI A;  3B77 A;  1OCZ C;  2Y4U A;  3P3N A;  5H2F Z;  4IIJ A;  1YXB A;  4ICG A;  4PA4 A;  3BFR A;  1F7Y A;  2GBO A;  2EUL A;  3RGB A;  1MMM A;  4LCU C;  5IE9 A;  4JI0 B;  4YJ2 B;  4LFA B;  5C93 A;  4LF5 B;  1QQC A;  2CH7 B;  2UXB O;  1THZ A;  3SR2 C;  1HNX O;  3AG1 B;  1B3Q A;  3HKD A;  4L87 A;  1GM8 A;  1HDJ A;  5LA6 A;  1MOF A;  2UU9 O;  3H01 A;  5EBW C;  2A7W A;  2Y69 B;  3STZ C;  1YZB A;  1YJN V;  3IC7 A;  3OE7 G;  3E8F A;  1MNG A;  4O2B A;  3L70 H;  3ZHV A;  3HB3 B;  3ETQ A;  4X1Y A;  3RW0 A;  2UXD B;  1JPX A;  3J80 N;  1DGS A;  2HR3 A;  2KB1 A;  4JAA A;  4DV6 O;  1H2N A;  5A2Q N;  4LF9 O;  4X1K A;  4PHZ A;  3L73 H;  2WLI A;  2EIL B;  4R7C A;  2BE3 A;  3JAL B;  1VQ7 V;  3CXH F;  3LDD A;  3JAR B;  4UB6 Z;  3ZMS A;  4NXN B;  1TUB A;  1L0N H;  5B1A B;  1SQV H;  3SYA A;  2P67 A;  2ZT9 B;  3CRC A;  2LGW A;  3ASO B;  4JYY A;  1N36 B;  4FZ1 A;  2CTQ A;  4PI0 A;  2GUZ A;  5JCO A;  4HAM A;  4ZBM A;  4DV3 O;  5B1N A;  5IYB O;  1YJ9 V;  5J2U B;  4WBN A;  5KUK A;  2ADP A;  1F4M A;  1NZ6 A;  3LDC A;  1OZ0 A;  2ZE8 A;  3SYO A;  2RCV A;  3CEI A;  1EN4 A;  4DV0 O;  1I0H A;  1DK1 A;  5IY5 B;  2ARH A;  4ZHQ B;  2VWK A;  3VOU A;  4O4I B;  1ZUQ A;  1A32 A;  1FS0 G;  2OCC B;  3MHH C;  1SZX A;  2KSD A;  1JX9 A;  1WPB A;  3QNE A;  1M93 A;  1FXH A;  2R70 A;  1NKD A;  2BTQ B;  1WP8 A;  5CN0 A;  5LL6 Y;  1T5E A;  2YDE A;  5KMG A;  2CTP A;  1R3L C;  5KUM A;  1UPG A;  2JJ1 G;  1IXM A;  4R50 A;  3ZED A;  4MW3 A;  5KX5 A;  4O4I A;  1N32 B;  2JIZ G;  4LWS B;  3K04 A;  3K79 A;  4CS4 A;  2GHY A;  3QO5 A;  4B3T O;  5IT9 N;  1KYO F;  4DV0 B;  3RYC A;  1MAB G;  3THO A;  1P49 A;  3HKD B;  3BA9 A;  1H2G A;  4JV5 B;  4LR3 A;  3M7M X;  5KMG B;  3A2F A;  2HLD G;  5CB4 A;  4WFH A;  1ENV A;  1WB7 A;  5EIB D;  1SQX H;  2UUB O;  2BTQ A;  4FMT A;  4YHH B;  1WLE A;  4I4T A;  5KHJ A;  2EIK C;  2NN4 A;  3ASN B;  4X20 A;  1GM9 A;  4UCV A;  2C2A A;  5EBL C;  3GWO A;  3QVN A;  3F5W C;  4GX2 A;  2XAG A;  1VMG A;  2IM9 A;  1TA8 A;  4CC6 A;  1NR1 A;  1VF6 A;  1NI8 A;  1XOU A;  4P30 A;  2LFR A;  1VQ9 V;  2WLL B;  2IJI A;  2A3Q A;  4GYC B;  3K57 A;  3ABM B;  1GTO A;  1GN6 A;  3ZMV A;  1DF4 A;  5GTI Z;  5H6R A;  1WPX A;  1VQK V;  3DGE A;  2A79 B;  5LMU B;  2N74 A;  1PM9 A;  3FB6 C;  3SPC A;  3JAS A;  2IH1 C;  1Y6X A;  4IHJ B;  2BSK A;  3DXR B;  4LH6 A;  3T1H O;  2Q5Z A;  3D8C A;  4Q20 A;  1J5E O;  1Q5O A;  4DUY B;  5KA6 A;  4TT3 G;  5GW7 A;  1BE3 H;  1VAR A;  4LBE C;  3JAT B;  2E75 B;  4AIL C;  4UCS A;  1K3E A;  3ABU A;  3QF7 A;  2F4V O;  4K8X A;  4WFA V;  3B40 A;  1K4C C;  1Q82 W;  2IU3 A;  1I94 B;  3OFN G;  4GT1 A;  2JGU A;  1IBM B;  2BCC H;  3SJC C;  5L3C A;  5J2T A;  4O4L B;  5KHI A;  5B1O A;  5EZY A;  1AJQ A;  1XNQ O;  5C8Y B;  2JS5 A;  4I0X B;  5E1A C;  4DW0 A;  5LGU A;  1S77 D;  3DC5 A;  3JAW A;  4B3T B;  5JVD B;  2X6C A;  1UJW B;  4XDL A;  4U3F H;  3RT3 C; 
#chains in the Genus database with same CATH homology
 2DQ3 A;  4G27 B;  4CZZ A;  2WWW A;  3I55 V;  1TUE B;  2IJK A;  2JDI G;  1PNL A;  2XND G;  2MK3 A;  1NJI W;  3AG2 B;  1K7D A;  2EIN C;  2YEV A;  5L3E A;  1FXK C;  3STL C;  4J9Y B;  4QPJ A;  2JEX A;  4ZKI A;  4TWK A;  2BOB C;  2Z3Y A;  2JEU A;  3SYQ A;  3F7V C;  1KQS U;  1GM7 A;  2W0F C;  5HFM A;  2W6J G;  2DQ0 A;  2EIJ C;  4MTO A;  2LP7 A;  2V1D A;  2IJH A;  3K0D A;  2H94 A;  2ZXW B;  5IYD O;  4QE7 A;  3FKS G;  3G4S V;  3QO8 A;  2EIL C;  2EIM C;  3OUF A;  5CBH A;  2PI5 A;  3OUS A;  2A0L A;  1NH2 D;  5LHH A;  4MTX A;  3I56 V;  3SPH A;  3TCU A;  3ABM C;  3JD2 A;  5CBG A;  2F43 G;  3OAA G;  3ETD A;  4LP8 A;  1F23 A;  1G8M A;  3FYI B;  2QE7 G;  1VQP V;  1E79 G;  3JD3 A;  3W7W A;  3ZMZ A;  1Q86 W;  2H8P C;  3E35 A;  4JPR A;  4PEL A;  4TSF G;  5H6Q A;  1EZJ A;  4JTD B;  2CK3 G;  5B3S C;  3ML0 A;  5LGN A;  2HG5 C;  3SPG A;  3X2Q C;  1V55 C;  3P30 A;  3E2E A;  4JYB A;  2W6I G;  3B8M A;  2OTL V;  1OCZ B;  1QLN A;  4JTC B;  1W2B U;  1OCC C;  5IY5 C;  1YJW V;  1RM1 B;  1MSW D;  4MVO A;  1HWY A;  1AI7 A;  1NR7 A;  1MG1 A;  4RUE A;  2IJJ A;  3JD1 A;  1GO3 F;  2OCC C;  4X89 A;  4MVU A;  1VQ5 V;  1KEC A;  5LHG A;  1COW G;  1J95 A;  2P7T C;  5L3D A;  4JTA B;  4MS2 A;  4QJF B;  4GX1 A;  1QVG U;  3JD0 A;  1XL4 A;  3T4Z A;  1QBZ A;  1EFR G;  1K73 W;  4MVQ A;  3KG2 A;  3SYP A;  3SPI A;  1B6Q A;  1AR1 B;  1YTF B;  1R73 A;  3JYC A;  2WAM A;  1ZWI C;  3DTU B;  2GSM B;  4RQF A;  5EBM C;  3EHB B;  2WSS G;  4X8A A;  2DYR B;  2Z5U A;  4GX0 A;  4ASU G;  1E1R G;  3ABL C;  1M1K W;  1NBM G;  2NNU A;  3JD4 A;  4MVS A;  4J9Z B;  5CA3 A;  1EBO A;  1QR9 A;  4MSW C;  3K06 A;  1R6K A;  3BEH A;  3ASN C;  1F51 A;  3FB5 C;  1M56 B;  4EKW A;  2Q67 A;  4PA9 A;  4N23 A;  1KKD A;  1ARO P;  3ASO C;  4FIP C;  2DYR C;  5B1A C;  2DWE C;  3ZN0 A;  3F7Y C;  1H8H G;  1OCR B;  3OMI B;  4QNH B;  3OEH G;  4R8C A;  1QLE B;  4RUF A;  3CMA V;  4MTG A;  1NVP D;  3ABT A;  3CCQ V;  1PNK A;  4JYC A;  1JVM A;  2QM7 A;  1KP3 A;  5CBF A;  2Y69 C;  2B1G A;  2XAF A;  3D3I A;  2QEX V;  3AG3 C;  1I5Y A;  5EC1 C;  4BIU A;  3K9A A;  2EJR A;  3LUT B;  4P9O A;  2R9R B;  5IDJ A;  4PDR A;  1KP2 A;  5J9P C;  4U7O A;  4LC1 A;  4XDK A;  3OW2 U;  3CD6 V;  3LSQ A;  1SER A;  4BW5 A;  1FXV A;  2LFS A;  1DTO A;  3OMA B;  1KD1 W;  5KA5 A;  1AI6 A;  2WLN A;  4MVM A;  1VQM V;  5HFL A;  1CPY A;  1RPR A;  2XOK G;  1QR8 A;  3ZMU A;  3LSS A;  3RVY A;  4CBC A;  4UUJ C;  1OCR C;  2D3O W;  2XAS A;  2IH3 C;  2EIJ B;  1M57 B;  1JOY A;  3SPJ A;  1NVP B;  2AHZ A;  3CCM V;  3R65 A;  4RQE A;  4E2L A;  2EBO A;  1YIT V;  1V54 B;  1PNM A;  3ETG A;  2ZXW C;  1BMF G;  3OR6 C;  3T1C A;  2YSU B;  3W7U A;  2EIK B;  5EC2 C;  4DO2 A;  2QKS A;  3WG7 C;  2JJ2 G;  4R6Z A;  3WG7 B;  2WPD G;  1VQL V;  3OR7 C;  4JAV A;  1FXK A;  3RBZ A;  2JK5 C;  3ZRV A;  3BY6 A;  3CCL V;  2R9I A;  3LDE A;  2ZDI A;  2P6J A;  5LGT A;  3CCV V;  1ROP A;  3B77 A;  1OCZ C;  1S0V A;  5BZB A;  4PA4 A;  4BAY A;  3G6E V;  3P32 A;  1P4R A;  1K33 A;  2ATK C;  1VQ4 V;  4LCU C;  5C93 A;  2OT5 A;  4DXW A;  1THZ A;  3B8N A;  5B1B B;  2IW5 A;  1SET A;  3AG1 B;  3PJS K;  1DLB A;  2X7R B;  4L87 A;  2UXX A;  1GM8 A;  3K0G A;  1K5Q A;  2B5U A;  1PL0 A;  1DF5 A;  1MOF A;  3X2Q B;  2HFE C;  3H01 A;  5B3S B;  5EBW C;  3STZ C;  2Y69 B;  2X0L A;  4FJC C;  1N8R W;  1YJN V;  3IC7 A;  3OE7 G;  4G28 B;  1CEZ A;  3E8F A;  2EZP A;  2X6B A;  1OCC B;  3JCZ A;  3K03 A;  2A9H A;  3ZN1 A;  1E1Q G;  4KUM A;  3HB3 B;  2ITC C;  3CCJ V;  3RW0 A;  4BIZ A;  1JPX A;  2NLJ C;  2DYS C;  3AEI A;  1XL6 A;  2KB1 A;  1ORQ C;  2HR3 A;  2YEV B;  3AG3 B;  2X6A A;  1YTF D;  3UM7 A;  3AG1 C;  3E86 A;  2UXN A;  1G4Y B;  1OHH G;  2WLI A;  3CXC U;  4X88 A;  2EIL B;  2B1I A;  2EIM B;  4R7C A;  3FYE B;  1VQ7 V;  1LNQ A;  3LDD A;  3ZMS A;  1K5S A;  4MVZ A;  1FXK B;  4JAS A;  5B1A B;  2WLJ A;  3SYA A;  2P67 A;  1K97 A;  1JCH A;  3RVZ A;  3ASO B;  5DN6 G;  1QCE A;  1K8A W;  3E8H A;  2Q69 A;  3OM3 B;  1L1F A;  3W7X A;  3CYO A;  4MW8 A;  1V54 C;  1QLE C;  4HAM A;  4ZBM A;  2ZQM A;  3GB7 C;  3K08 A;  5B1N A;  5IYB O;  1VQ6 V;  3ZRW B;  3CPW U;  1YJ9 V;  4UVB A;  4I5S A;  1QVF U;  1GMG A;  3OMN B;  5KUK A;  1F4M A;  4PDV A;  2EZO A;  3OEE G;  2QA4 V;  3LDC A;  3OGC C;  3TET A;  1OZ0 A;  4WFG A;  4WFE A;  4RO2 A;  2K1E A;  4OXS A;  3SYO A;  3CCS V;  3W7S A;  4HYO A;  2HVJ C;  4U7N A;  5IY5 B;  4YXW G;  1GKF A;  1M9N A;  3VOU A;  1AI4 A;  3ABL B;  1R3J C;  1OCO C;  4UV8 A;  1Y4M A;  3G71 V;  1FS0 G;  3FB8 C;  2OCC B;  3MHH C;  4KFM A;  1Y66 A;  4XDJ A;  1JX9 A;  3QNE A;  1K9M W;  2FTK A;  3NXS A;  1SES A;  5L3B A;  1RM1 C;  4Z1M G;  1NQT A;  3ZRX A;  1FXH A;  1NKD A;  3LNM B;  4PDL A;  3ABK C;  3K3W A;  5CN0 A;  2DYS B;  3ZJZ A;  1AI5 A;  1R3L C;  5KUM A;  1JQ0 A;  2JJ1 G;  1K92 A;  1IXM A;  1YI2 V;  4MVR A;  2QTO A;  3W7T A;  4R50 A;  1AJN A;  4P9P A;  4MW3 A;  3E8G A;  2ZD9 A;  4WFF A;  4JF3 A;  3FB7 C;  2WLI B;  4FK5 C;  5CMU A;  3SYC A;  3ZRS A;  3CCU V;  2JIZ G;  1S76 D;  3T4D A;  5LHI A;  4XBF A;  4P2Z A;  1GK9 A;  1VQ8 V;  3E8B A;  3CC7 V;  3K04 A;  3WFV A;  3K79 A;  1BHA A;  2GHY A;  3QO5 A;  4GX5 A;  4H37 A;  2BOC C;  2Q68 A;  4N21 A;  3M99 B;  1MAB G;  4PDM A;  4H33 A;  4UV9 A;  1H2G A;  1S5H C;  1SRY A;  1AJP A;  2HLD G;  1H38 A;  1BHB A;  4JAU A;  3ABK B;  4WFH A;  1NH2 B;  1ENV A;  1OCO B;  4QIW F;  3AG2 C;  2EIN B;  1RPO A;  5B1B C;  4FMT A;  1Q7Y W;  1WLE A;  3QO7 A;  4PA3 A;  3AG4 B;  2HJF C;  4UVA A;  2EIK C;  1YHQ V;  4FPP A;  3TK1 A;  3ASN B;  4WCE V;  3E83 A;  1GM9 A;  2AHY A;  2C2A A;  4UVC A;  5EBL C;  2ZDI C;  3GWO A;  4PA6 A;  4GCZ A;  3F5W C;  3UKM A;  3VBB A;  4HZ3 A;  1R6N A;  2XAQ A;  2QM8 A;  2DW4 A;  4GX2 A;  2XAG A;  1V55 B;  3CC4 V;  3MHS C;  4F4L A;  1NR1 A;  4P30 A;  4QE9 A;  3T2M A;  1K4D C;  1K34 A;  2XAH A;  1BL8 A;  3AG4 C;  2LFR A;  1VQ9 V;  2WLK A;  3IGA C;  4JGS A;  2WLM A;  2WLL B;  3IFX A;  2IJI A;  1PD3 A;  2HKO A;  4QPK A;  4WFB V;  4WF9 V;  4I9W A;  1YSC A;  2P90 A;  5IYC O;  3ABM B;  1GTO A;  1CP9 A;  3ZCC A;  3ZMV A;  1DF4 A;  3HPL C;  5DM6 V;  5H6R A;  1WPX A;  5LBQ A;  1VQK V;  4PA7 A;  5FL7 G;  2M7W A;  3DGE A;  2A79 B;  1R3K C;  1M57 C;  3SPC A;  3FB6 C;  1F4N A;  2IH1 C;  3E89 A;  5EK0 A;  1W0J G;  2OTJ V;  1VQO V;  5L3F A;  1FFT B;  2HVK C;  3CCE V;  2Q6A A;  4Q20 A;  1I5X A;  3ZMT A;  5KA6 A;  3A0R A;  4TT3 G;  2PI4 A;  4UXN A;  2WLL A;  4KP4 A;  3D36 A;  5GW7 A;  1SZT A;  1H8E G;  4LBE C;  3ZIA G;  1JJ2 U;  5L3G A;  2WLH A;  1YIJ V;  2XAJ A;  1Q81 W;  1S72 V;  1PKX A;  3CCR V;  3EFF K;  1K3E A;  3ABU A;  4WFA V;  1K4C C;  1Q82 W;  2IU3 A;  3CC2 V;  3OFN G;  3SJQ C;  4GT1 A;  2Y48 A;  2ZR3 A;  5L3C A;  1R3I C;  4MT8 A;  4G2K A;  3ZRW A;  5B1O A;  1S3J A;  1AJQ A;  1W0K G;  3CP1 A;  4RAI A;  2V7Q G;  3ETE A;  1M90 W;  4MTF A;  2DWD C;  5H9C A;  5E1A C;  5LGU A;  1S77 D;  1P7B A;  1VQN V;  3CME V;  1M56 C;  2IU0 A;  2X6C A;  1UJW B;  1KC8 W;  4XDL A;  3MD0 A;  2ITD C;  2ZR2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...