4P30A

Structure of navms mutant in presence of pi1 compound
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
92
structure length
92
Chain Sequence
VGSVAALLTVVFYIAAVMATNLYGATFPEWFGDLSKSLYTLFQVMTLESWSMGIVRPVMNVHPNAWVFFIPFIMLTAFTVLNLAIGIIVDAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ion transport protein
publication title Prokaryotic NavMs channel as a structural and functional model for eukaryotic sodium channel antagonism.
pubmed doi rcsb
source organism Magnetococcus sp.
molecule tags Transport protein
total genus 36
structure length 92
sequence length 92
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-03-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4p30A00
4MTFA 3F7VC 3SPIA 2A79B 3STZC 4H37A 4PA6A 4HYOA 2EIJC 4MS2A 3LDEA 4WFFA 4CBCA 2WLJA 3E8GA 5CBGA 2A0LA 4PA7A 1QLEC 3JYCA 2AHZA 3K04A 2ITCC 3VOUA 4QE9A 4JTAB 4JTDB 1KKDA 3RBZA 4PA4A 2QKSA 4PA3A 3UM7A 5EBWC 2HVJC 4J9YB 3F7YC 5B3SC 3EFFK 4PA9A 2JK5C 5EBLC 2X6CA 3SPHA 4G27B 4G28B 5IY5C 3FB7C 3IFXA 4EKWA 2IH1C 4GX5A 2ZD9A 3UKMA 3RVZA 1P7BA 4GX0A 4WFHA 3SJQC 2HFEC 3E8FA 3E86A 3ZRSA 5KUMA 3OUSA 4R50A 5J9PC 1R3IC 3SPJA 3RVYA 2QTOA 3KG2A 3TCUA 3OR6C 3LNMB 4MTOA 4XDLA 4MVRA 3LDCA 4MW3A 3ABKC 4R7CA 3E89A 5EBMC 1ORQC 3SYQA 3WG7C 4MVSA 3SPCA 1OCZC 2DWDC 5CBFA 2OCCC 2A9HA 3K0GA 5B1BC 4XDKA 2IH3C 1OCOC 4MSWC 4RAIA 4ZBMA 3T2MA 3K06A 1R3JC 4DXWA 2WLNA 3K03A 2X6AA 4P2ZA 4MW8A 3K0DA 3OR7C 4QNHB 3PJSK 2P7TC 3IGAC 4UUJC 4P9PA 5CBHA 3ABLC 3X2QC 2Q68A 2Y69C 4MVZA 2BOCC 2DYRC 3FB5C 3ASOC 1K4DC 1V55C 4LP8A 2WLIB 2WLIA 3STLC 2EIMC 2WLMA 4MTGA 3GB7C 4P9OA 4X88A 4BW5A 2R9RB 4F4LA 2YEVA 4P30A 4R8CA 4LCUC 5BZBA 3K08A 1K4CC 4HZ3A 3FB8C 3AG4C 2WLLA 3AG1C 4RO2A 1M56C 2HG5C 2Q69A 3E83A 3OGCC 4MVOA 4PDLA 2Q6AA 4R6ZA 4WFGA 2W0FC 4XDJA 3SYPA 4JTCB 4TWKA 4MVMA 3E8BA 3SYAA 1OCCC 1BL8A 2BOBC 2EIKC 2X6BA 1V54C 2WLKA 4H33A 4I9WA 1XL6A 4MVQA 3SYCA 3TETA 2EILC 1OCRC 4MVUA 4PDVA 3BEHA 2EINC 1G4YB 3ASNC 5EC2C 3SYOA 1S5HC 3T4DA 4GX1A 3R65A 4WFEA 3T4ZA 5EC1C 2DWEC 4PDRA 1J95A 2WLHA 2K1EA 4LBEC 3T1CA 2Q67A 3OUFA 5KUKA 2H8PC 3SPGA 2NLJC 2HVKC 3HPLC 2ATKC 1M57C 2ZXWC 5B1AC 1ZWIC 2AHYA 4RUFA 2HJFC 2WLLB 3F5WC 4OXSA 4X8AA 5EK0A 4QE7A 1R3LC 4RUEA 4J9ZB 1R3KC 5E1AC 3LUTB 3ZJZA 4X89A 3LDDA 1JVMA 3FB6C 2DYSC 2KB1A 4GX2A 3ABMC 4KFMA 3E8HA 1LNQA 4PDMA 3RW0A 1XL4A 2ITDC 3AG2C 3AG3C
chains in the Genus database with same CATH superfamily
4DV1O 1KKCA 1M56B 1N36O 1YJWV 1XNQO 2PY5A 4K35A 4CC6A 5IE9A 3ETEA 4CBCA 5LGUA 1R1BA 2V4DA 2P6JA 4GLXA 2PTMA 4K3AA 1VQLV 4LF7B 3WU2Z 2YIBA 4A5UB 5KHGA 4KP4A 1GN3A 1XEQA 3H1KH 4EKWA 1I0HA 1RPRA 1FFXA 4IHJB 1SA0A 3FYEB 3RVYA 1K92A 1D5AA 2DMXA 1N4CA 4MT8A 2JIZG 1N33O 4ZHQB 5EZYA 1YTFB 2YC0A 2ZQMA 4KHPO 2BTOA 4UCUA 1QR9A 1MZEA 4GKJB 5KAIZ 1EM1A 1HP8A 1YJNV 4JZGA 5B1AB 5CBHA 1XHXA 3A8TA 5CA0B 3FB5C 3CMEV 4MTGA 4LF5B 3L9DA 1VF6C 4DK1A 2RDCA 1K34A 1WB8A 1KB9F 3AG4C 1BHBA 4JI6O 1QQCA 1NS1A 5CA1A 1WB7A 3JAMN 3CXHF 2Y4UA 2WAMA 2F93B 2F4VO 3RT3C 1VQ6V 2RJZA 1G6UA 2K1EA 3N2KB 5DECA 5B66Z 2QKCA 2NLJC 3ABUA 3JASA 3JD0A 3OMNB 1URFA 1N32O 2EX3A 1PNMA 5FL7G 3CC2V 2UUAB 4EFEA 2ZT9B 3I55V 2UXNA 1AR1B 2YIAA 2IU3A 3AG1B 3CB2A 3AK2A 3ZMTA 4H37A 2JGDA 5HFLA 5LA6B 2JVDA 4AQYO 4JTAB 1N34O 1S76D 4YXWG 4DR7O 3FAVB 2DYRB 4DV3O 3U11A 1GM8A 3IAYA 3IFXA 1KU9A 2CTQA 3CWBH 2B9ZA 5B1OA 3JCZA 3SJQC 1GM9A 3T1YO 5D5PA 1OV9A 3J7AU 3A0HZ 1Q82W 3L72H 4JAVA 4IL6Z 2UU9O 3HKCA 3BCCH 4JI4O 2IJKA 3E22A 4ZBMA 1WA8A 3ZHSA 1FKAO 2UXCB 1M5IA 1QU7A 3O9OA 1S5JA 1PL0A 5JH7A 3HKBB 2OIEA 4J42A 4P9PA 4YY3O 3BVOA 4LR3A 3H1HH 1KC8W 1N36B 2CE4A 1XNQB 3W7TA 3S3XA 1NI8A 4HZ3A 4WFBV 2WLLA 3B09A 1B04A 3E8BA 4JI5B 2E5LO 2NR5A 1BSMA 4IYIA 2AW9A 2YIBD 4PV1B 4J80A 5BMVB 1Z5VA 3QO8A 1VARA 1MA1A 5B3SB 4WF9V 2P67A 5IY5B 5JVDA 2QKAA 1FXKC 3DXRB 1Q3EA 4I55A 4DV6O 1N33B 4X1KB 4X9QA 4KUMA 3TK1A 4KHPB 3F7VC 1B6QA 2LFRA 2A7WA 1TA8A 4PA6A 4OPHA 2EIJC 4TV9B 2QWOB 1WN7A 3K5LA 3E8GA 1AP5A 4PHZA 4Z2WA 3K04A 2HP8A 1YEWA 1L8DA 1N0NA 2V7QG 4ICGA 5L3BA 2JRIA 2RQ6A 4JI6B 3ZHVA 3WB0A 1AB3A 3B2EE 3VQXA 3CYOA 5DEDA 3TXSA 2GUZA 1GO3F 2Q0OC 3K79A 2DE0X 4JYYA 2QTOA 3B77A 3H1JH 2EILB 1H8EG 2F4VB 3CE2A 1I5YA 3S3WA 3MDSA 1YVWA 1OZ0A 3CP1A 4O2AA 1N32B 1ZLZA 4PJ0Z 4I50B 1XBLA 3RYCA 5CB4B 2XTAA 4DR3O 2X7RB 3FYIB 1JJOA 3OMAB 4X88A 3W7UA 4D6TH 3EXAA 4RO2A 2DOSA 2AZ0A 1DF5A 2QJ1A 4TWKA 2VS0A 5IWAB 4AQYB 1P49A 4FVMA 1N34B 3K58A 2HR3A 1Z5WA 5CN0A 4XBFA 2XAJA 4DV3B 2GHYA 3HKDB 5H6QA 2ZE6A 5IYZA 3OUFA 3RGBA 4TUYB 2ZXWC 3SJBC 5LHIA 3T1YB 1VQ7V 3F5WC 1COWG 1GRJA 1KP2A 1GAXA 3W7WA 3C3SA 1I7FA 4RQEA 1B06A 2UU9B 2Y0PA 4DR1O 4JI4B 4JI3O 2K9PA 3MHSC 2N04A 4IHJA 2OCCB 4HYOA 3ZMZA 3BA8A 4YY3B 2IJHA 4CH4A 4B3RO 1EBOA 1XHZA 1SQPH 3DGEA 4G28B 2QA4V 4QPJA 4HNAA 2XNDG 2E5LB 4GCZA 1H2MA 1QLNA 4DRXB 1Y76A 3ZRXA 3K57A 3ZRSA 4KXRA 1XNRO 4FLVA 1QHTA 1PL4A 4MTOA 3LDCA 2LGQA 3ABKC 3G6EV 3JARB 4LF4O 1ORQC 2ZR2A 1IBLO 1K73W 3MHHC 3TGUH 1Y66A 2X6AA 1GK9A 3OR7C 4GT1A 4DV5O 3X2QC 2Q68A 4DV6B 5A9GA 4J7KA 3N2KA 1V55C 5D5QA 3BPZA 4R8CA 4UCOA 2ZE8A 2MK3A 3AG2B 3OGCC 1IXBA 1BE3H 4DUZO 2EIKC 5JQGB 5KMGB 3SYCA 1DTOA 5LOVB 3ASNC 3G80A 2GSMB 4JI7O 2CTWA 4LFCB 1P7GA 2BSKA 2LO1A 3ZEDA 3JCUZ 3F5TA 2FL4A 4LWSA 1HNWO 2Z3YA 4CH5A 3KZIZ 2BE3A 1OCOB 2VQFO 1AR4A 1NR7A 4PA7A 3CRRA 4G2KA 4DR3B 3JSLA 2WA4A 4TQDA 5IJ9A 3CCEV 2EJ7A 4N21A 2R72A 1L0NH 3F7YC 4W4KA 4LC1A 5EBLC 4TOIA 4L8JA 2ZKOA 4X64O 4GX5A 3ZMUA 2GV9A 3DTUB 5LHGA 1HNXO 4JI8O 4R50A 3J80N 2HHHO 2H3OA 2YUAA 4R7CA 3E89A 5EBMC 2B5UA 3B40A 2EIJB 3NXSA 1XREA 1VIBA 3LSQA 3U10A 3D36A 2LFSA 2ADQB 1TVKA 1M57B 4BIZA 2ZM6B 3J81N 4NKGB 3W7XA 5KA5A 2YICA 4NXNB 4JI3B 2WLIB 1L0LH 3CMAV 3ZIAG 4X20A 5L3FA 1SQQH 4BAYA 3SPJA 4X1IA 4TQFA 4TSFG 3SYAA 1OCCC 2BOBC 4H33A 4DUYO 2IU0A 4LF9O 1QLEB 3UQ8A 1Q81W 2EINC 4FFBB 1NH2B 3SYOA 4GUNA 4FLXA 3M8AA 1RSOB 3M7MX 3T4ZA 1G8MA 3D36C 1IBMO 3FX7A 1XNRB 4OXSA 1MABG 4QE7A 3L75H 3CCVV 2ZE7A 5H2FZ 5B1NA 1Y6XA 1CXZB 4LF4B 2WSSG 2JEXA 2P4KA 1IBLB 2DYSC 4KFMA 2ITDC 2VQEO 4NVPA 1UPGA 3Q4HB 2A79B 3STZC 1VQKV 1S77D 1H2GA 5ITZB 5DM6V 2A0LA 3QVNA 1ZSPA 4DV5B 2AXTZ 4Z1VA 4O2BB 2OCHA 4Q6GA 5EIBD 1XDCA 3K5MA 1KBHA 2CUGA 5IJ0A 3VQWA 3CS5A 3CCSV 4Z1MG 1WJZA 4BIOA 4J7JA 3L74H 4B3SO 2ETNA 3R66A 3A0RA 3E86A 1BS3A 1H2LA 3ZRWB 1MSWD 4UCRA 4BIUA 3CCMV 3KG2A 3UCSC 3ZHQA 4B3TO 2F1MA 3SYQA 1W2BU 3WG7C 2ZDIA 4MVSA 4JI7B 1MZFA 2OIGA 2GTAA 5B1BC 2KG7A 3CJHB 4JV5B 5HFMA 3JAWB 4PI0A 5LP6B 1U96A 3N2GB 1QNMA 1VQ8V 2A06H 2WLNA 4U7OA 3PJSK 3RN4A 3ABLC 4UCTA 2JEUA 1P4RA 4QNHB 5JWPA 1HNWB 2YEVB 2EZOA 4X1YB 3ZMSA 2XAHA 3JATB 2VQFB 5LMNO 2CTPA 2W0FC 5JCOA 2Q7EA 3JAKA 1GM7A 1ZL8B 3VBBA 1E1RG 1V54C 1XL6A 4PDVA 4DO2A 3G71V 4FZ1A 4FLYA 4X64B 4WFEA 5E79Z 5LYJA 1Q7YW 4CH6A 3JD2A 1R6NA 3IC7A 1HNXB 4JI8B 4J41A 1XQ8A 2QDOA 5LHHA 4QIWF 4YJ3A 5EK0A 4FM2A 3FKSG 2HHHB 3RYFB 5H9CA 1D2DA 4X89A 2CGOA 1GH6A 4DV0O 5F2VO 2D3OW 3QNEA 1R73A 5A2QN 5L3EA 4LFAB 1DK1A 2Q5ZA 1VQMV 1TUBB 4UB8Z 3MD0A 3L71H 1V9PA 1D5NA 3QO7A 3K9AA 1SZTA 1NU1H 4UCVA 2AHZA 4EB6A 3K9SA 5EYPA 4I9QA 2P06A 1VQ4V 2IBZH 1JMKC 2OTJV 4G27B 3G4SV 4PELA 1DF4A 4NTXA 5LXTB 2IW5A 3I5DA 4FK5C 3ZX6A 2VWJA 4DUYB 4GX0A 1U97A 5LMUB 4LF9B 3CC7V 4JF3A 4FZ0A 1F4NA 4JAUA 4I4TA 1PV0A 2FYUH 3CCRV 1IBMB 4DR6O 4UVAA 1W59A 1X59A 4X66O 4YJ2A 4U3JB 1QVGU 1HR0O 3LNNA 3GWKC 1F7YA 1NVPD 3ETGA 2Y69C 2BOCC 2UXXA 2QEXV 2VQEB 4HBNA 2WLMA 2ILMA 1IX9A 4O4HA 1J5EO 1JX9A 2Q69A 4R6ZA 4ZI7B 4B3MO 2QM7A 4I9WA 4J7ZA 1G4YB 1PM9A 4DV7O 5C93A 2GTSA 5KHJA 2LW1A 1KQSU 2Y4TA 4PDRA 4ZKIA 4O4LB 2Q7HA 4B3SB 4DV1B 2NN4A 2Q67A 5KUKA 3C90A 2RN9A 1H8HG 2HVKC 2CH7B 1Q43A 5KX5A 1YITV 4B3TB 2OYQA 1SC5B 2KSDA 1RM1B 1XL4A 3D3IA 4ASUG 3P30A 1YF2A 2XT9A 2VWKA 1OCCB 1YHQV 1F4MA 3LDEA 2XOKG 3JYCA 2ITCC 1KKDA 2QKSA 2AZ2A 5K1XA 4LNUA 4TV8B 1TAEA 2DJVA 5GONB 3U0ZA 2JJ2G 5J2TA 5LMNB 3ZRVA 1VQ5V 2JS3A 2UXDO 3WB1A 1NQTA 2MW2B 3DSQA 3HKEB 3WFVA 5J9PC 3OEHG 4ZIBA 2OWOA 1FXHA 4NTWA 1OCZC 2ADPA 3K0GA 4XDKA 4O4JB 3T2MA 4UVCA 4JZ2A 2P4VA 4LH7A 4IT5A 3K03A 3IGAC 1AI6A 1AJPA 4IYHA 4FLTA 2QWQB 3STLC 4F6RB 2KQXA 2ARHA 1TGOA 3E83A 3D3QA 3SYPA 4XDJA 1BCCH 1BL8A 1ZUQA 3QO5A 1OCRC 4MVUA 1VEWA 5EC2C 3WG7B 2PYLA 4QGPA 4GX1A 1VQ9V 3R65A 1L1FA 2WLHA 4LBEC 2DN9A 3JD3A 4CS4A 3SJCC 2YS8A 4IIJA 2WA3A 3ABLB 3BAAA 1M9NA 5BXZA 3RYIB 1AP6A 1SESA 3RW0A 2W0XA 3CC4V 4DR6B 2YXHA 4X66B 3SPIA 4DR7B 1HR0B 4I5SA 4NB5A 3JALB 2UUBO 3ETDA 2OT5A 1I08A 4UXNA 4FJCC 5JJNB 1J5EB 5LP6A 4PA9A 5IDJA 1E1QG 1XOUA 1SQVH 3CXCU 1SQXH 3AG4B 4B3MB 3A2FA 3LSSA 1SQGA 1SA0B 1VF5B 1DLBA 1WPBA 4X1YA 1T5EA 2YDEA 1H38A 4NTYA 1IDSA 2BTQB 1XUQA 4ZHQA 1PPJH 1KECA 1VP7A 2FKXA 1K33A 1R3JC 5KLVH 1RFYA 1W0KG 1WP8A 5BY1A 4E2LA 4MVZA 5CA0A 1K4DC 4NXMO 4J11A 1SZXA 3E35A 3OMIB 1N8RW 1X4TA 1AJQA 4JYBA 3ZBHA 3JSNA 4OX9O 1Q86W 3W7SA 5CA1B 3GVMA 4DR2O 3ZN1A 1LUVA 5FNVB 2DWEC 1J95A 2Q4PA 1GN6A 2UXDB 1SQBH 1CP9A 2JS5A 2ATKC 5B1AC 3JASB 3HR0A 4J9ZB 1R3KC 1K7DA 3CX5F 4ZOLB 2WWWA 4PDMA 3ABMC 3AK1A 1SQFA 3CRCA 3SGIA 3QTCA 1JOYA 4MTFA 2CAZC 2PI4A 2ZIMA 2JGDB 2QM4A 5LA6A 1NH2D 3AEIA 4JASA 1K8AW 1SERA 2OTLV 4J9YB 1US6A 5EIBC 1W0JG 3FAVA 2PGGA 2X6CA 2WPDG 1Q6IA 3MAQA 4DK0A 2KKWA 1F23A 4JPRA 1KD1W 3E8FA 4LF7O 3BY6A 1H2KA 2YI8A 4UFZA 4BW9A 1Y67A 1THZA 1IVSA 2VRZA 2X0LA 1BMFG 2DWDC 2Z0AA 3BABA 2A9HA 1PNLA 2IH3C 1QVFU 1AI4A 3CRMA 1AI5A 5JH7B 4MW8A 3HKBA 3RFRA 2RMKB 1FXKB 2DYRC 2HJDA 3BRCA 3ASOC 4X65O 4J10A 3SR2C 5KHIA 1AVMA 2CH7A 2DQ0A 4CC5A 2HG5C 2UUBB 1E79G 1UFIA 4JYAO 1KMIZ 4MVMA 4LFBO 4Q20A 3FD9A 3GWOA 2Q0AA 3TETA 3EVKA 2AGAA 5BMVA 3BA9A 2HKOA 5L3GA 1VQPV 5EC1C 4DR1B 3T1CA 1FJGO 1KP3A 5IT9N 3HPLC 2AHYA 5JVDB 3DXRA 4TV8A 4DV4O 2GBOA 1VMGA 5GONA 4JGSA 5E1AC 1CPYA 1S3JA 4GX2A 4B3RB 4X1KA 3OTFA 2YI9A 1VQOV 1YTFD 2CDYA 3HKEA 4TV9A 3OEEG 2RNBA 1EN5A 1BHAA 4YIOA 4UV8A 4NXMB 1YSCA 3UM7A 1QBZA 4O4JA 4JI2O 3CEIA 5B3SC 1FXVA 1NKDA 2JK5C 3CRAA 2Y48A 1MOFA 5IY5C 3FB7C 2XAFA 3UKMA 4OX9B 1KYOF 4RWUA 3P3PA 1FYJA 3CCUV 3OUSA 3OAAG 2ZNIA 4F6RA 4DR2B 4F6EA 4AHCA 3LNMB 2FTKA 1MSDA 3SPCA 5LL6Y 1O9GA 4JI0O 1G1XB 4UVBA 3K06A 2O57A 4O2AB 3CCJV 3CCQV 4I50A 2ZXWB 3RYCB 5CB4A 4FPPA 5H6RA 4DUZB 1GN2A 1OHHG 1SKVA 1Q8IA 4JYCA 3CD6V 3ZN0A 3OW2U 2EIMC 1S0VA 1SRYA 3ZMVA 2PYJA 1M93A 4E4EA 3M99B 4UCSA 5FPOA 2N74A 3ZHUA 3I56V 2EILC 5KHHA 1NTKH 2H94A 2YXYA 2PF4E 3HKDA 3B8MA 3JALA 2R9AA 5IYZB 4JI5O 5J2UB 4TUYA 1FS0G 1SF9A 1HNZO 1RP3B 4X8AA 4CS3A 2HJFC 4RUEA 2EZPA 1P84F 4O4IB 3WB2A 1VF6A 1M4UA 2Z5UA 2B1GA 2ZDIC 3ABKB 2QR4A 3TXQA 2QGNA 1GKFA 1ZX3A 2BCCH 4MS2A 4MTXA 1SS3A 2EJRA 1RPOA 3ZS8C 2BTQA 3G67A 4PA4A 4X65B 2NNUA 2GDSA 3X2QB 2Q9LA 1V55B 3OM3B 4PI2A 3PN1A 4HNAB 1Q5OA 4JYAB 3G6BA 5CA3A 4LFBB 1A32A 1YXBA 3CHXA 1Y76B 4DRXA 5JCOC 3OD4A 4LF6O 3UT5B 2ZIOA 2ODMA 2EIKB 2E74B 1CEZA 3ABMB 1K5QA 4FMTA 3C3TA 4DW1A 3JARA 3ASNB 2OCCC 1MG1A 1IBKO 3VQYA 5C8YB 1FJGB 1GMGA 3ABTA 4JI1O 1R6KA 4FFKA 2C2AA 2P22C 4DV4B 1QR8A 4DXWA 3H1IH 4K0KO 1MMMA 3AK3A 4P2ZA 5KA6A 5FNVA 1VQNV 4ABMA 4FM0A 2M6YA 3T1HO 1JCHA 1WPXA 4P30A 3K08A 3FB8C 2E3CA 3OT7A 3P3NA 4ZOLA 4LF8O 5FPRA 1LUWA 1WLEA 5JQGA 5KMGA 4JI2B 3L70H 4X62O 1Y4MA 5LOVA 3T4DA 3OGIB 4DYLA 5IYDO 2B1IA 5IYCO 2PI5A 3OFNG 2QWNB 1TUEB 5IWAO 1NZ6A 2CTRA 2LJ2A 4LH6A 3SPGA 4YHHO 2HLDG 1I94O 3JD1A 2BSKB 4CS2A 2HEPA 4GYCB 3ASOB 3ZJZA 1O9HA 4PDLA 4OPAA 3E8HA 5L3DA 4K8ZA 4CH3A 3AG2C 4JI0B 4LWSB 2L6LA 1YIJV 5GTIZ 5KAFZ 1IURA 1PD3A 3K5NA 4QE9A 1UJWB 5AG2A 2IJIA 5IJ9B 4PA3A 2YXLA 4UV9A 1BQZA 1XMOO 4N23A 1AR5A 2V1DA 1WAZA 1PKXA 3EFFK 1KUQA 2XHBA 1AI7A 2XAGA 2XASA 1FXKA 1YZBA 4XDLA 2EINB 3NR7A 3H9VA 1HDJA 2M7WA 1Y74B 1OCOC 4RAIA 2Y0IA 3DC5A 1H2SB 1HNZB 1TVKB 1F51A 3K0DA 2P7TC 4K8XA 4WBNB 2N05A 4LP8A 2WLIA 2R9RB 2DYSB 4X20B 4IGGA 1GTOA 3CSXA 4X1IB 2Q6AA 4B08A 1VF7A 4JTCB 5GTHZ 2LGWA 4I0XB 2EULA 3AG7A 4FIPC 3BEHA 4FFBA 1BZKA 1Q6UA 2JDIG 2LW7A 5LGNA 1RSOA 2PUSA 3L73H 4DV0B 4W4LA 1YI2V 4H44B 3QF7A 4LF6B 2XUMA 1M57C 3UO3A 4RUFA 1AJNA 1NVPB 5K1PA 1R3LC 2ZCEA 4YIPA 4TT3G 2EIMB 1K9MW 2XAQA 1LNQA 1IBKB 1WP7A 1I5XA 3AG3C 4JI1B 3Q4HA 4LFCO 4DR4O 3OTOO 3SJAC 2IJJA 5B1BB 5ITZA 4K0KB 5CBGA 4WFFA 4BR6A 2WLJA 4U7NA 4NYKA 1XMQO 2F43G 2UXBO 1AROP 1QLEC 2IM9A 3OE7G 3IJ4A 5BR8O 1JR9A 4JTDB 4WCEV 1Q6HA 4O2BA 3T1HB 1JFFB 2G38A 3RYHB 4GZRB 5IJ0B 2IH1C 2ZD9A 4FLUA 3RVZA 2P5OA 4UB6Z 4LF8B 1P7BA 2P90A 4WFHA 1EZJA 4DR5O 4X62B 3ZRWA 4B7KA 3CPWU 3D8CA 1V54B 2Q73A 4I7ZB 4QPKA 1GN4A 5CBFA 2ZINA 2KG7B 3CJHA 2W6IG 3JAWA 4YHHB 5TISZ 1I94B 3N2GA 4DV2O 1H2NA 3FFQA 4PD4F 1EZVH 1FFXB 1NBMG 3JD4A 1ZTEA 4DV7B 4P9OA 5J2UA 1EFRG 4U3FH 2YEVA 1K4CC 1IXMA 3K5OA 2JGUA 3JATA 2ZR3A 1M56C 4HAMA 2ZNJA 3JAKB 1ZL8A 2ZM6O 5EZYB 4O4IA 1LR1A 4MVQA 4NXNO 1XMOB 4FLWA 5KHKA 5LP6C 5LYJB 2H8PC 4YJ3B 2CK3G 1XILA 3CCLV 3RYFA 3DC6A 3LUTB 3ML0A 3RWRD 3SPHA 1JVMA 1EN4A 2KB1A 2QTSA 4D7TA 5L3CA 1IZ3A 2DQ3A 2YSUB 1QCEA 3N27A 1TUBA 1FFTB 3UT5A 3O65A 4AILC 1K97A 3H1LH 2UUCO 3CRQA 3VOUA 4EB6B 4WFAV 3RBZA 5EYPB 3SDLA 4GKKO 1NT2B 5EBWC 5C8YA 1ZAUA 5JJJB 1FD9A 2Y69B 2FMLA 2QSAA 2E76B 1YDXA 5H5NA 5LXTA 4D7SA 3ZCCA 3HB3B 1Z2GA 4C7UA 4QJFB 3KKYA 4H13B 5KUMA 1M1KW 1R3IC 2DW4A 3KCYA 1PNKA 4I4TB 4NR1A 4EFBA 4MSWC 4YJ2B 4U3JA 1B3QA 1XI1A 4RQFA 3P32A 3H01A 2QWRB 5IYBO 5B5EZ 1S72V 3ZHRA 3VQVA 1MNGA 1JJ2U 4BW5A 4JV5O 4DR4B 4O4HB 4LCUC 5BZBA 3OTOB 2LP7A 3AG1C 2W6JG 1JA8A 1XMQB 2UXBB 3HKCB 5BR8B 4ZI7A 3E22B 1WNSA 2WLKA 1WA8B 2RCVA 1DGSA 1FAFA 1S5HC 1BQ0A 1SETA 1Q90D 5LBQA 3ZHTA 2CGNA 4O4LA 3LSUA 4FLZA 4DR5B 4GKJO 1JQ0A 2WLLB 5KX5B 4OGQB 2R70A 4CZZA 3LDDA 5GW7A 4LF5O 2YIDA 3K59A 1OCZB 4DV2B 2F66C 3B4SA 1R6TA 1NJIW 1BGYH 3THOA 2HVJC 1Y74A 4LNUB 4LFAO 2F23A 2Q7GA 4I55B 5J2TB 1M90W 3K3WA 5LGTA 5CMUA 1EN6A 4WBNA 1AILA 3E2EA 2HFEC 1HWYA 1OJHA 1RM1C 3TCUA 2L35A 3OR6C 1JPXA 5JJEB 4MVRA 1FPOA 3AG3B 1OCRB 4MW3A 2UUAO 3B8NA 5DN6G 1NTMH 4H0LB 1N0JA 4EEQA 4I0XA 2EBOA 2QE7G 3QG5A 5LMUO 3ETQA 2LQTA 2PZSA 1S5LZ 1PP9H 1ENVA 4UUJC 1HW7A 3EHBB 2GUZB 4JAAA 1YJ9V 2QWPB 4BWAA 4F4LA 1YCIA 2E75B 3GB7C 3KCXA 3ICXA 1K3EA 3BFRA 1K5SA 2F95B 4MVOA 2UUCB 4WFGA 4B7EA 3BHPA 1NR1A 2X6BA 4GKKB 2D2CB 3TJTA 2JJ1G 4DW0A 2R9IA 1ROPA 2Q8VA 2A3QA 2ZE5A 1NTZH 2FB5A 3IC9A 4L87A 4FM1A 5FLXN 2QM8A 3APOA 3APQA 3A0BZ 4IIJB 1ZWIC 1JFFA 2UXCO 3RYHA 4KL1A 3RYIA 4AI8A 3FB6C 1BT8A 3UO2A
chains in the Genus database with same CATH topology
3SPIA 1M56B 1YJWV 2Z3YA 1OCOB 3ETEA 4I5SA 4CBCA 5LGUA 1PD3A 1NR7A 4PA7A 4G2KA 3ETDA 2P6JA 2OT5A 4QE9A 1VQLV 1UJWB 2IJIA 3CCEV 4PA3A 4N21A 4UXNA 4FJCC 4UV9A 4N23A 3F7YC 2V1DA 1PKXA 3EFFK 4KP4A 4LC1A 4PA9A 5EBLC 5IDJA 1E1QG 1AI7A 4EKWA 4GX5A 3ZMUA 1RPRA 3CXCU 2XAGA 3DTUB 3AG4B 5LHGA 2XASA 1FXKA 3LSSA 4R50A 1DLBA 3FYEB 3RVYA 1K92A 4XDLA 1H38A 4R7CA 2EINB 3E89A 5EBMC 2B5UA 4MT8A 2JIZG 2M7WA 1YTFB 1OCOC 2EIJB 3NXSA 4RAIA 1KECA 2ZQMA 3LSQA 3D36A 1QR9A 1K33A 2LFSA 1R3JC 1F51A 1YJNV 3K0DA 1W0KG 1M57B 5B1AB 4BIZA 2P7TC 3W7XA 5CBHA 5KA5A 4E2LA 4MVZA 3FB5C 3CMEV 1K4DC 4LP8A 2WLIB 2WLIA 4MTGA 2R9RB 3E35A 3OMIB 3CMAV 2DYSB 1K34A 3ZIAG 5L3FA 1N8RW 3AG4C 4BAYA 1AJQA 4JYBA 3SPJA 1GTOA 2Q6AA 1BHBA 4TSFG 4JTCB 3SYAA 1OCCC 2BOBC 1Q86W 3W7SA 4H33A 2IU0A 1QLEB 4FIPC 3BEHA 2EINC 1NH2B 1Q81W 3SYOA 3ZN1A 2JDIG 2WAMA 5LGNA 3T4ZA 1VQ6V 1G8MA 2DWEC 1J95A 2K1EA 1YI2V 2NLJC 1CP9A 2ATKC 1M57C 5B1AC 3ABUA 3JD0A 1AJNA 3OMNB 4OXSA 4RUFA 1MABG 1NVPB 4QE7A 3CCVV 1R3LC 5B1NA 4J9ZB 1PNMA 5FL7G 1R3KC 3CC2V 1K7DA 4TT3G 2EIMB 2WSSG 2JEXA 2WWWA 1K9MW 4PDMA 2DYSC 2XAQA 3ABMC 4KFMA 3I55V 1LNQA 2ITDC 2UXNA 3AG3C 1I5XA 1AR1B 1JOYA 2IU3A 3AG1B 4MTFA 2PI4A 2A79B 3ZMTA 3STZC 1VQKV 4H37A 2IJJA 5B1BB 1S77D 1H2GA 5DM6V 5CBGA 4WFFA 5HFLA 2WLJA 4U7NA 1NH2D 2A0LA 2F43G 1AROP 1QLEC 3AEIA 3OE7G 4JASA 4JTAB 4JTDB 4WCEV 1K8AW 1S76D 4YXWG 2OTLV 1SERA 4J9YB 1W0JG 2DYRB 2X6CA 1GM8A 2WPDG 3IFXA 2IH1C 2ZD9A 3CCSV 4Z1MG 3RVZA 1P7BA 2P90A 5B1OA 1F23A 4JPRA 3JCZA 4WFHA 3A0RA 3SJQC 1KD1W 3E8FA 1GM9A 1EZJA 3E86A 3BY6A 3ZRWA 3ZRWB 3CPWU 1MSWD 4BIUA 3CCMV 1V54B 3KG2A 3SYQA 1W2BU 3WG7C 1THZA 2ZDIA 4MVSA 4QPKA 1Q82W 2X0LA 1BMFG 2DWDC 4JAVA 5CBFA 2A9HA 1PNLA 5B1BC 2IH3C 2IJKA 5HFMA 1QVFU 2W6IG 4ZBMA 1AI4A 1VQ8V 1AI5A 2WLNA 4U7OA 1PL0A 4MW8A 3PJSK 4P9PA 3ABLC 1FXKB 2DYRC 1NBMG 3ASOC 2JEUA 1P4RA 4QNHB 1KC8W 3JD4A 4P9OA 1EFRG 2YEVB 2EZOA 2YEVA 3W7TA 1K4CC 2DQ0A 4HZ3A 1IXMA 3ZMSA 2XAHA 4WFBV 2WLLA 2ZR3A 1M56C 2HG5C 4HAMA 1E79G 2W0FC 1GM7A 4MVMA 3E8BA 4Q20A 3GWOA 1E1RG 1V54C 4MVQA 3VBBA 1XL6A 3TETA 4PDVA 4DO2A 3G71V 2HKOA 3QO8A 5L3GA 4WFEA 1VQPV 1Q7YW 5EC1C 5B3SB 3JD2A 4WF9V 1R6NA 3T1CA 2P67A 5IY5B 2H8PC 3IC7A 1KP3A 3HPLC 2AHYA 5LHHA 4QIWF 5EK0A 2CK3G 1FXKC 3FKSG 3CCLV 4JGSA 5E1AC 3LUTB 3ML0A 5H9CA 4X89A 1CPYA 1JVMA 1S3JA 2KB1A 4GX2A 3SPHA 5L3CA 2D3OW 3QNEA 1R73A 2DQ3A 4KUMA 3TK1A 5L3EA 2YSUB 3F7VC 1VQMV 1VQOV 1QCEA 1B6QA 1YTFD 2LFRA 1FFTB 3MD0A 4PA6A 2EIJC 3QO7A 1K97A 3K9AA 1SZTA 3E8GA 3OEEG 3K04A 2AHZA 1BHAA 3VOUA 4WFAV 4UV8A 3RBZA 1YSCA 3UM7A 5EBWC 1QBZA 1VQ4V 2OTJV 2Y69B 5B3SC 1FXVA 1NKDA 2JK5C 2V7QG 2Y48A 4G27B 3G4SV 1MOFA 5IY5C 4PELA 5L3BA 3FB7C 1DF4A 2IW5A 2XAFA 3UKMA 3ZCCA 4FK5C 3HB3B 3CYOA 4QJFB 4GX0A 1GO3F 3CCUV 3K79A 5KUMA 3CC7V 3OUSA 1M1KW 4JF3A 3OAAG 1R3IC 2DW4A 2QTOA 3B77A 1F4NA 3LNMB 4JAUA 2EILB 1H8EG 2FTKA 1PNKA 1I5YA 3CCRV 3SPCA 4UVAA 4MSWC 4UVBA 3K06A 1QVGU 1OZ0A 3CP1A 3CCJV 4RQFA 3CCQV 3P32A 3H01A 1NVPD 2ZXWB 5IYBO 4FPPA 1S72V 5H6RA 3ETGA 2X7RB 3FYIB 2Y69C 1OHHG 2BOCC 4JYCA 2UXXA 2QEXV 3CD6V 3OMAB 3ZN0A 3OW2U 2EIMC 2WLMA 1SRYA 4X88A 3ZMVA 4BW5A 3W7UA 1JJ2U 1S0VA 4LCUC 5BZBA 2LP7A 1JX9A 3AG1C 3M99B 4RO2A 2Q69A 2W6JG 4R6ZA 1DF5A 4TWKA 2QM7A 2WLKA 4I9WA 3I56V 2EILC 2HR3A 1G4YB 5CN0A 1S5HC 4XBFA 5C93A 2XAJA 2GHYA 2H94A 1SETA 5H6QA 3B8MA 5LBQA 1KQSU 4PDRA 4ZKIA 5KUKA 2Q67A 3OUFA 1H8HG 2HVKC 2ZXWC 1FS0G 5LHIA 1VQ7V 4X8AA 1JQ0A 2HJFC 2WLLB 3F5WC 1COWG 1KP2A 4RUEA 2EZPA 3W7WA 1YITV 4CZZA 4RQEA 3LDDA 1RM1B 1XL4A 3D3IA 2Z5UA 4ASUG 2B1GA 3P30A 5GW7A 2ZDIC 3ABKB 3MHSC 1OCZB 2OCCB 1GKFA 4HYOA 1OCCB 1YHQV 4MS2A 4MTXA 1F4MA 3LDEA 3ZMZA 2XOKG 2EJRA 1RPOA 1NJIW 3JYCA 2ITCC 2IJHA 1KKDA 4PA4A 2QKSA 2NNUA 2HVJC 3X2QB 1EBOA 3DGEA 1V55B 2JJ2G 4G28B 2QA4V 3OM3B 3ZRVA 1VQ5V 4QPJA 1M90W 2XNDG 3K3WA 5LGTA 5CA3A 4GCZA 5CMUA 1QLNA 3ZRXA 3E2EA 1NQTA 2HFEC 3ZRSA 1HWYA 3WFVA 5J9PC 2EIKB 1CEZA 3OEHG 3ABMB 3TCUA 1K5QA 1RM1C 4FMTA 3OR6C 1JPXA 4MTOA 4MVRA 3AG3B 1OCRB 1FXHA 3LDCA 4MW3A 3ABKC 3G6EV 1ORQC 2ZR2A 3ASNB 3B8NA 1OCZC 5DN6G 2OCCC 1MG1A 3K0GA 4XDKA 1K73W 1GMGA 3ABTA 2EBOA 2QE7G 3T2MA 4UVCA 3MHHC 1R6KA 1Y66A 2C2AA 1QR8A 4DXWA 3K03A 2X6AA 4P2ZA 1GK9A 3OR7C 4GT1A 1ENVA 3IGAC 4UUJC 1AI6A 1AJPA 3X2QC 2Q68A 5KA6A 3EHBB 1YJ9V 1V55C 1VQNV 3STLC 4F4LA 3GB7C 1JCHA 1WPXA 4P30A 4R8CA 3K08A 2MK3A 1K3EA 3FB8C 3AG2B 1K5SA 3OGCC 3E83A 4MVOA 3SYPA 4WFGA 4XDJA 1NR1A 1BL8A 2EIKC 2X6BA 3QO5A 1WLEA 3SYCA 1OCRC 4MVUA 2JJ1G 1DTOA 2R9IA 1Y4MA 1ROPA 3ASNC 5EC2C 3WG7B 3T4DA 4GX1A 1VQ9V 5IYDO 3R65A 2B1IA 1L1FA 2GSMB 5IYCO 2PI5A 3OFNG 4L87A 2WLHA 4LBEC 2QM8A 1TUEB 3SPGA 3JD3A 2HLDG 1ZWIC 3JD1A 3ABLB 1M9NA 3ASOB 3ZJZA 1SESA 3FB6C 4PDLA 3RW0A 3CC4V 3E8HA 5L3DA 3AG2C 1YIJV
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MTF A;  3F7V C;  3SPI A;  2A79 B;  3STZ C;  4H37 A;  4PA6 A;  4HYO A;  2EIJ C;  4MS2 A;  3LDE A;  4WFF A;  4CBC A;  2WLJ A;  3E8G A;  5CBG A;  2A0L A;  4PA7 A;  1QLE C;  3JYC A;  2AHZ A;  3K04 A;  2ITC C;  3VOU A;  4QE9 A;  4JTA B;  4JTD B;  1KKD A;  3RBZ A;  4PA4 A;  2QKS A;  4PA3 A;  3UM7 A;  5EBW C;  2HVJ C;  4J9Y B;  3F7Y C;  5B3S C;  3EFF K;  4PA9 A;  2JK5 C;  5EBL C;  2X6C A;  3SPH A;  4G27 B;  4G28 B;  5IY5 C;  3FB7 C;  3IFX A;  4EKW A;  2IH1 C;  4GX5 A;  2ZD9 A;  3UKM A;  3RVZ A;  1P7B A;  4GX0 A;  4WFH A;  3SJQ C;  2HFE C;  3E8F A;  3E86 A;  3ZRS A;  5KUM A;  3OUS A;  4R50 A;  5J9P C;  1R3I C;  3SPJ A;  3RVY A;  2QTO A;  3KG2 A;  3TCU A;  3OR6 C;  3LNM B;  4MTO A;  4XDL A;  4MVR A;  3LDC A;  4MW3 A;  3ABK C;  4R7C A;  3E89 A;  5EBM C;  1ORQ C;  3SYQ A;  3WG7 C;  4MVS A;  3SPC A;  1OCZ C;  2DWD C;  5CBF A;  2OCC C;  2A9H A;  3K0G A;  5B1B C;  4XDK A;  2IH3 C;  1OCO C;  4MSW C;  4RAI A;  4ZBM A;  3T2M A;  3K06 A;  1R3J C;  4DXW A;  2WLN A;  3K03 A;  2X6A A;  4P2Z A;  4MW8 A;  3K0D A;  3OR7 C;  4QNH B;  3PJS K;  2P7T C;  3IGA C;  4UUJ C;  4P9P A;  5CBH A;  3ABL C;  3X2Q C;  2Q68 A;  2Y69 C;  4MVZ A;  2BOC C;  2DYR C;  3FB5 C;  3ASO C;  1K4D C;  1V55 C;  4LP8 A;  2WLI B;  2WLI A;  3STL C;  2EIM C;  2WLM A;  4MTG A;  3GB7 C;  4P9O A;  4X88 A;  4BW5 A;  2R9R B;  4F4L A;  2YEV A;  4P30 A;  4R8C A;  4LCU C;  5BZB A;  3K08 A;  1K4C C;  4HZ3 A;  3FB8 C;  3AG4 C;  2WLL A;  3AG1 C;  4RO2 A;  1M56 C;  2HG5 C;  2Q69 A;  3E83 A;  3OGC C;  4MVO A;  4PDL A;  2Q6A A;  4R6Z A;  4WFG A;  2W0F C;  4XDJ A;  3SYP A;  4JTC B;  4TWK A;  4MVM A;  3E8B A;  3SYA A;  1OCC C;  1BL8 A;  2BOB C;  2EIK C;  2X6B A;  1V54 C;  2WLK A;  4H33 A;  4I9W A;  1XL6 A;  4MVQ A;  3SYC A;  3TET A;  2EIL C;  1OCR C;  4MVU A;  4PDV A;  3BEH A;  2EIN C;  1G4Y B;  3ASN C;  5EC2 C;  3SYO A;  1S5H C;  3T4D A;  4GX1 A;  3R65 A;  4WFE A;  3T4Z A;  5EC1 C;  2DWE C;  4PDR A;  1J95 A;  2WLH A;  2K1E A;  4LBE C;  3T1C A;  2Q67 A;  3OUF A;  5KUK A;  2H8P C;  3SPG A;  2NLJ C;  2HVK C;  3HPL C;  2ATK C;  1M57 C;  2ZXW C;  5B1A C;  1ZWI C;  2AHY A;  4RUF A;  2HJF C;  2WLL B;  3F5W C;  4OXS A;  4X8A A;  5EK0 A;  4QE7 A;  1R3L C;  4RUE A;  4J9Z B;  1R3K C;  5E1A C;  3LUT B;  3ZJZ A;  4X89 A;  3LDD A;  1JVM A;  3FB6 C;  2DYS C;  2KB1 A;  4GX2 A;  3ABM C;  4KFM A;  3E8H A;  1LNQ A;  4PDM A;  3RW0 A;  1XL4 A;  2ITD C;  3AG2 C;  3AG3 C; 
#chains in the Genus database with same CATH topology
 4DV1 O;  1KKC A;  1M56 B;  1N36 O;  1YJW V;  1XNQ O;  2PY5 A;  4K35 A;  4CC6 A;  5IE9 A;  3ETE A;  4CBC A;  5LGU A;  1R1B A;  2V4D A;  2P6J A;  4GLX A;  2PTM A;  4K3A A;  1VQL V;  4LF7 B;  3WU2 Z;  2YIB A;  4A5U B;  5KHG A;  4KP4 A;  1GN3 A;  1XEQ A;  3H1K H;  4EKW A;  1I0H A;  1RPR A;  1FFX A;  4IHJ B;  1SA0 A;  3FYE B;  3RVY A;  1K92 A;  1D5A A;  2DMX A;  1N4C A;  4MT8 A;  2JIZ G;  1N33 O;  4ZHQ B;  5EZY A;  1YTF B;  2YC0 A;  2ZQM A;  4KHP O;  2BTO A;  4UCU A;  1QR9 A;  1MZE A;  4GKJ B;  5KAI Z;  1EM1 A;  1HP8 A;  1YJN V;  4JZG A;  5B1A B;  5CBH A;  1XHX A;  3A8T A;  5CA0 B;  3FB5 C;  3CME V;  4MTG A;  4LF5 B;  3L9D A;  1VF6 C;  4DK1 A;  2RDC A;  1K34 A;  1WB8 A;  1KB9 F;  3AG4 C;  1BHB A;  4JI6 O;  1QQC A;  1NS1 A;  5CA1 A;  1WB7 A;  3JAM N;  3CXH F;  2Y4U A;  2WAM A;  2F93 B;  2F4V O;  3RT3 C;  1VQ6 V;  2RJZ A;  1G6U A;  2K1E A;  3N2K B;  5DEC A;  5B66 Z;  2QKC A;  2NLJ C;  3ABU A;  3JAS A;  3JD0 A;  3OMN B;  1URF A;  1N32 O;  2EX3 A;  1PNM A;  5FL7 G;  3CC2 V;  2UUA B;  4EFE A;  2ZT9 B;  3I55 V;  2UXN A;  1AR1 B;  2YIA A;  2IU3 A;  3AG1 B;  3CB2 A;  3AK2 A;  3ZMT A;  4H37 A;  2JGD A;  5HFL A;  5LA6 B;  2JVD A;  4AQY O;  4JTA B;  1N34 O;  1S76 D;  4YXW G;  4DR7 O;  3FAV B;  2DYR B;  4DV3 O;  3U11 A;  1GM8 A;  3IAY A;  3IFX A;  1KU9 A;  2CTQ A;  3CWB H;  2B9Z A;  5B1O A;  3JCZ A;  3SJQ C;  1GM9 A;  3T1Y O;  5D5P A;  1OV9 A;  3J7A U;  3A0H Z;  1Q82 W;  3L72 H;  4JAV A;  4IL6 Z;  2UU9 O;  3HKC A;  3BCC H;  4JI4 O;  2IJK A;  3E22 A;  4ZBM A;  1WA8 A;  3ZHS A;  1FKA O;  2UXC B;  1M5I A;  1QU7 A;  3O9O A;  1S5J A;  1PL0 A;  5JH7 A;  3HKB B;  2OIE A;  4J42 A;  4P9P A;  4YY3 O;  3BVO A;  4LR3 A;  3H1H H;  1KC8 W;  1N36 B;  2CE4 A;  1XNQ B;  3W7T A;  3S3X A;  1NI8 A;  4HZ3 A;  4WFB V;  2WLL A;  3B09 A;  1B04 A;  3E8B A;  4JI5 B;  2E5L O;  2NR5 A;  1BSM A;  4IYI A;  2AW9 A;  2YIB D;  4PV1 B;  4J80 A;  5BMV B;  1Z5V A;  3QO8 A;  1VAR A;  1MA1 A;  5B3S B;  4WF9 V;  2P67 A;  5IY5 B;  5JVD A;  2QKA A;  1FXK C;  3DXR B;  1Q3E A;  4I55 A;  4DV6 O;  1N33 B;  4X1K B;  4X9Q A;  4KUM A;  3TK1 A;  4KHP B;  3F7V C;  1B6Q A;  2LFR A;  2A7W A;  1TA8 A;  4PA6 A;  4OPH A;  2EIJ C;  4TV9 B;  2QWO B;  1WN7 A;  3K5L A;  3E8G A;  1AP5 A;  4PHZ A;  4Z2W A;  3K04 A;  2HP8 A;  1YEW A;  1L8D A;  1N0N A;  2V7Q G;  4ICG A;  5L3B A;  2JRI A;  2RQ6 A;  4JI6 B;  3ZHV A;  3WB0 A;  1AB3 A;  3B2E E;  3VQX A;  3CYO A;  5DED A;  3TXS A;  2GUZ A;  1GO3 F;  2Q0O C;  3K79 A;  2DE0 X;  4JYY A;  2QTO A;  3B77 A;  3H1J H;  2EIL B;  1H8E G;  2F4V B;  3CE2 A;  1I5Y A;  3S3W A;  3MDS A;  1YVW A;  1OZ0 A;  3CP1 A;  4O2A A;  1N32 B;  1ZLZ A;  4PJ0 Z;  4I50 B;  1XBL A;  3RYC A;  5CB4 B;  2XTA A;  4DR3 O;  2X7R B;  3FYI B;  1JJO A;  3OMA B;  4X88 A;  3W7U A;  4D6T H;  3EXA A;  4RO2 A;  2DOS A;  2AZ0 A;  1DF5 A;  2QJ1 A;  4TWK A;  2VS0 A;  5IWA B;  4AQY B;  1P49 A;  4FVM A;  1N34 B;  3K58 A;  2HR3 A;  1Z5W A;  5CN0 A;  4XBF A;  2XAJ A;  4DV3 B;  2GHY A;  3HKD B;  5H6Q A;  2ZE6 A;  5IYZ A;  3OUF A;  3RGB A;  4TUY B;  2ZXW C;  3SJB C;  5LHI A;  3T1Y B;  1VQ7 V;  3F5W C;  1COW G;  1GRJ A;  1KP2 A;  1GAX A;  3W7W A;  3C3S A;  1I7F A;  4RQE A;  1B06 A;  2UU9 B;  2Y0P A;  4DR1 O;  4JI4 B;  4JI3 O;  2K9P A;  3MHS C;  2N04 A;  4IHJ A;  2OCC B;  4HYO A;  3ZMZ A;  3BA8 A;  4YY3 B;  2IJH A;  4CH4 A;  4B3R O;  1EBO A;  1XHZ A;  1SQP H;  3DGE A;  4G28 B;  2QA4 V;  4QPJ A;  4HNA A;  2XND G;  2E5L B;  4GCZ A;  1H2M A;  1QLN A;  4DRX B;  1Y76 A;  3ZRX A;  3K57 A;  3ZRS A;  4KXR A;  1XNR O;  4FLV A;  1QHT A;  1PL4 A;  4MTO A;  3LDC A;  2LGQ A;  3ABK C;  3G6E V;  3JAR B;  4LF4 O;  1ORQ C;  2ZR2 A;  1IBL O;  1K73 W;  3MHH C;  3TGU H;  1Y66 A;  2X6A A;  1GK9 A;  3OR7 C;  4GT1 A;  4DV5 O;  3X2Q C;  2Q68 A;  4DV6 B;  5A9G A;  4J7K A;  3N2K A;  1V55 C;  5D5Q A;  3BPZ A;  4R8C A;  4UCO A;  2ZE8 A;  2MK3 A;  3AG2 B;  3OGC C;  1IXB A;  1BE3 H;  4DUZ O;  2EIK C;  5JQG B;  5KMG B;  3SYC A;  1DTO A;  5LOV B;  3ASN C;  3G80 A;  2GSM B;  4JI7 O;  2CTW A;  4LFC B;  1P7G A;  2BSK A;  2LO1 A;  3ZED A;  3JCU Z;  3F5T A;  2FL4 A;  4LWS A;  1HNW O;  2Z3Y A;  4CH5 A;  3KZI Z;  2BE3 A;  1OCO B;  2VQF O;  1AR4 A;  1NR7 A;  4PA7 A;  3CRR A;  4G2K A;  4DR3 B;  3JSL A;  2WA4 A;  4TQD A;  5IJ9 A;  3CCE V;  2EJ7 A;  4N21 A;  2R72 A;  1L0N H;  3F7Y C;  4W4K A;  4LC1 A;  5EBL C;  4TOI A;  4L8J A;  2ZKO A;  4X64 O;  4GX5 A;  3ZMU A;  2GV9 A;  3DTU B;  5LHG A;  1HNX O;  4JI8 O;  4R50 A;  3J80 N;  2HHH O;  2H3O A;  2YUA A;  4R7C A;  3E89 A;  5EBM C;  2B5U A;  3B40 A;  2EIJ B;  3NXS A;  1XRE A;  1VIB A;  3LSQ A;  3U10 A;  3D36 A;  2LFS A;  2ADQ B;  1TVK A;  1M57 B;  4BIZ A;  2ZM6 B;  3J81 N;  4NKG B;  3W7X A;  5KA5 A;  2YIC A;  4NXN B;  4JI3 B;  2WLI B;  1L0L H;  3CMA V;  3ZIA G;  4X20 A;  5L3F A;  1SQQ H;  4BAY A;  3SPJ A;  4X1I A;  4TQF A;  4TSF G;  3SYA A;  1OCC C;  2BOB C;  4H33 A;  4DUY O;  2IU0 A;  4LF9 O;  1QLE B;  3UQ8 A;  1Q81 W;  2EIN C;  4FFB B;  1NH2 B;  3SYO A;  4GUN A;  4FLX A;  3M8A A;  1RSO B;  3M7M X;  3T4Z A;  1G8M A;  3D36 C;  1IBM O;  3FX7 A;  1XNR B;  4OXS A;  1MAB G;  4QE7 A;  3L75 H;  3CCV V;  2ZE7 A;  5H2F Z;  5B1N A;  1Y6X A;  1CXZ B;  4LF4 B;  2WSS G;  2JEX A;  2P4K A;  1IBL B;  2DYS C;  4KFM A;  2ITD C;  2VQE O;  4NVP A;  1UPG A;  3Q4H B;  2A79 B;  3STZ C;  1VQK V;  1S77 D;  1H2G A;  5ITZ B;  5DM6 V;  2A0L A;  3QVN A;  1ZSP A;  4DV5 B;  2AXT Z;  4Z1V A;  4O2B B;  2OCH A;  4Q6G A;  5EIB D;  1XDC A;  3K5M A;  1KBH A;  2CUG A;  5IJ0 A;  3VQW A;  3CS5 A;  3CCS V;  4Z1M G;  1WJZ A;  4BIO A;  4J7J A;  3L74 H;  4B3S O;  2ETN A;  3R66 A;  3A0R A;  3E86 A;  1BS3 A;  1H2L A;  3ZRW B;  1MSW D;  4UCR A;  4BIU A;  3CCM V;  3KG2 A;  3UCS C;  3ZHQ A;  4B3T O;  2F1M A;  3SYQ A;  1W2B U;  3WG7 C;  2ZDI A;  4MVS A;  4JI7 B;  1MZF A;  2OIG A;  2GTA A;  5B1B C;  2KG7 A;  3CJH B;  4JV5 B;  5HFM A;  3JAW B;  4PI0 A;  5LP6 B;  1U96 A;  3N2G B;  1QNM A;  1VQ8 V;  2A06 H;  2WLN A;  4U7O A;  3PJS K;  3RN4 A;  3ABL C;  4UCT A;  2JEU A;  1P4R A;  4QNH B;  5JWP A;  1HNW B;  2YEV B;  2EZO A;  4X1Y B;  3ZMS A;  2XAH A;  3JAT B;  2VQF B;  5LMN O;  2CTP A;  2W0F C;  5JCO A;  2Q7E A;  3JAK A;  1GM7 A;  1ZL8 B;  3VBB A;  1E1R G;  1V54 C;  1XL6 A;  4PDV A;  4DO2 A;  3G71 V;  4FZ1 A;  4FLY A;  4X64 B;  4WFE A;  5E79 Z;  5LYJ A;  1Q7Y W;  4CH6 A;  3JD2 A;  1R6N A;  3IC7 A;  1HNX B;  4JI8 B;  4J41 A;  1XQ8 A;  2QDO A;  5LHH A;  4QIW F;  4YJ3 A;  5EK0 A;  4FM2 A;  3FKS G;  2HHH B;  3RYF B;  5H9C A;  1D2D A;  4X89 A;  2CGO A;  1GH6 A;  4DV0 O;  5F2V O;  2D3O W;  3QNE A;  1R73 A;  5A2Q N;  5L3E A;  4LFA B;  1DK1 A;  2Q5Z A;  1VQM V;  1TUB B;  4UB8 Z;  3MD0 A;  3L71 H;  1V9P A;  1D5N A;  3QO7 A;  3K9A A;  1SZT A;  1NU1 H;  4UCV A;  2AHZ A;  4EB6 A;  3K9S A;  5EYP A;  4I9Q A;  2P06 A;  1VQ4 V;  2IBZ H;  1JMK C;  2OTJ V;  4G27 B;  3G4S V;  4PEL A;  1DF4 A;  4NTX A;  5LXT B;  2IW5 A;  3I5D A;  4FK5 C;  3ZX6 A;  2VWJ A;  4DUY B;  4GX0 A;  1U97 A;  5LMU B;  4LF9 B;  3CC7 V;  4JF3 A;  4FZ0 A;  1F4N A;  4JAU A;  4I4T A;  1PV0 A;  2FYU H;  3CCR V;  1IBM B;  4DR6 O;  4UVA A;  1W59 A;  1X59 A;  4X66 O;  4YJ2 A;  4U3J B;  1QVG U;  1HR0 O;  3LNN A;  3GWK C;  1F7Y A;  1NVP D;  3ETG A;  2Y69 C;  2BOC C;  2UXX A;  2QEX V;  2VQE B;  4HBN A;  2WLM A;  2ILM A;  1IX9 A;  4O4H A;  1J5E O;  1JX9 A;  2Q69 A;  4R6Z A;  4ZI7 B;  4B3M O;  2QM7 A;  4I9W A;  4J7Z A;  1G4Y B;  1PM9 A;  4DV7 O;  5C93 A;  2GTS A;  5KHJ A;  2LW1 A;  1KQS U;  2Y4T A;  4PDR A;  4ZKI A;  4O4L B;  2Q7H A;  4B3S B;  4DV1 B;  2NN4 A;  2Q67 A;  5KUK A;  3C90 A;  2RN9 A;  1H8H G;  2HVK C;  2CH7 B;  1Q43 A;  5KX5 A;  1YIT V;  4B3T B;  2OYQ A;  1SC5 B;  2KSD A;  1RM1 B;  1XL4 A;  3D3I A;  4ASU G;  3P30 A;  1YF2 A;  2XT9 A;  2VWK A;  1OCC B;  1YHQ V;  1F4M A;  3LDE A;  2XOK G;  3JYC A;  2ITC C;  1KKD A;  2QKS A;  2AZ2 A;  5K1X A;  4LNU A;  4TV8 B;  1TAE A;  2DJV A;  5GON B;  3U0Z A;  2JJ2 G;  5J2T A;  5LMN B;  3ZRV A;  1VQ5 V;  2JS3 A;  2UXD O;  3WB1 A;  1NQT A;  2MW2 B;  3DSQ A;  3HKE B;  3WFV A;  5J9P C;  3OEH G;  4ZIB A;  2OWO A;  1FXH A;  4NTW A;  1OCZ C;  2ADP A;  3K0G A;  4XDK A;  4O4J B;  3T2M A;  4UVC A;  4JZ2 A;  2P4V A;  4LH7 A;  4IT5 A;  3K03 A;  3IGA C;  1AI6 A;  1AJP A;  4IYH A;  4FLT A;  2QWQ B;  3STL C;  4F6R B;  2KQX A;  2ARH A;  1TGO A;  3E83 A;  3D3Q A;  3SYP A;  4XDJ A;  1BCC H;  1BL8 A;  1ZUQ A;  3QO5 A;  1OCR C;  4MVU A;  1VEW A;  5EC2 C;  3WG7 B;  2PYL A;  4QGP A;  4GX1 A;  1VQ9 V;  3R65 A;  1L1F A;  2WLH A;  4LBE C;  2DN9 A;  3JD3 A;  4CS4 A;  3SJC C;  2YS8 A;  4IIJ A;  2WA3 A;  3ABL B;  3BAA A;  1M9N A;  5BXZ A;  3RYI B;  1AP6 A;  1SES A;  3RW0 A;  2W0X A;  3CC4 V;  4DR6 B;  2YXH A;  4X66 B;  3SPI A;  4DR7 B;  1HR0 B;  4I5S A;  4NB5 A;  3JAL B;  2UUB O;  3ETD A;  2OT5 A;  1I08 A;  4UXN A;  4FJC C;  5JJN B;  1J5E B;  5LP6 A;  4PA9 A;  5IDJ A;  1E1Q G;  1XOU A;  1SQV H;  3CXC U;  1SQX H;  3AG4 B;  4B3M B;  3A2F A;  3LSS A;  1SQG A;  1SA0 B;  1VF5 B;  1DLB A;  1WPB A;  4X1Y A;  1T5E A;  2YDE A;  1H38 A;  4NTY A;  1IDS A;  2BTQ B;  1XUQ A;  4ZHQ A;  1PPJ H;  1KEC A;  1VP7 A;  2FKX A;  1K33 A;  1R3J C;  5KLV H;  1RFY A;  1W0K G;  1WP8 A;  5BY1 A;  4E2L A;  4MVZ A;  5CA0 A;  1K4D C;  4NXM O;  4J11 A;  1SZX A;  3E35 A;  3OMI B;  1N8R W;  1X4T A;  1AJQ A;  4JYB A;  3ZBH A;  3JSN A;  4OX9 O;  1Q86 W;  3W7S A;  5CA1 B;  3GVM A;  4DR2 O;  3ZN1 A;  1LUV A;  5FNV B;  2DWE C;  1J95 A;  2Q4P A;  1GN6 A;  2UXD B;  1SQB H;  1CP9 A;  2JS5 A;  2ATK C;  5B1A C;  3JAS B;  3HR0 A;  4J9Z B;  1R3K C;  1K7D A;  3CX5 F;  4ZOL B;  2WWW A;  4PDM A;  3ABM C;  3AK1 A;  1SQF A;  3CRC A;  3SGI A;  3QTC A;  1JOY A;  4MTF A;  2CAZ C;  2PI4 A;  2ZIM A;  2JGD B;  2QM4 A;  5LA6 A;  1NH2 D;  3AEI A;  4JAS A;  1K8A W;  1SER A;  2OTL V;  4J9Y B;  1US6 A;  5EIB C;  1W0J G;  3FAV A;  2PGG A;  2X6C A;  2WPD G;  1Q6I A;  3MAQ A;  4DK0 A;  2KKW A;  1F23 A;  4JPR A;  1KD1 W;  3E8F A;  4LF7 O;  3BY6 A;  1H2K A;  2YI8 A;  4UFZ A;  4BW9 A;  1Y67 A;  1THZ A;  1IVS A;  2VRZ A;  2X0L A;  1BMF G;  2DWD C;  2Z0A A;  3BAB A;  2A9H A;  1PNL A;  2IH3 C;  1QVF U;  1AI4 A;  3CRM A;  1AI5 A;  5JH7 B;  4MW8 A;  3HKB A;  3RFR A;  2RMK B;  1FXK B;  2DYR C;  2HJD A;  3BRC A;  3ASO C;  4X65 O;  4J10 A;  3SR2 C;  5KHI A;  1AVM A;  2CH7 A;  2DQ0 A;  4CC5 A;  2HG5 C;  2UUB B;  1E79 G;  1UFI A;  4JYA O;  1KMI Z;  4MVM A;  4LFB O;  4Q20 A;  3FD9 A;  3GWO A;  2Q0A A;  3TET A;  3EVK A;  2AGA A;  5BMV A;  3BA9 A;  2HKO A;  5L3G A;  1VQP V;  5EC1 C;  4DR1 B;  3T1C A;  1FJG O;  1KP3 A;  5IT9 N;  3HPL C;  2AHY A;  5JVD B;  3DXR A;  4TV8 A;  4DV4 O;  2GBO A;  1VMG A;  5GON A;  4JGS A;  5E1A C;  1CPY A;  1S3J A;  4GX2 A;  4B3R B;  4X1K A;  3OTF A;  2YI9 A;  1VQO V;  1YTF D;  2CDY A;  3HKE A;  4TV9 A;  3OEE G;  2RNB A;  1EN5 A;  1BHA A;  4YIO A;  4UV8 A;  4NXM B;  1YSC A;  3UM7 A;  1QBZ A;  4O4J A;  4JI2 O;  3CEI A;  5B3S C;  1FXV A;  1NKD A;  2JK5 C;  3CRA A;  2Y48 A;  1MOF A;  5IY5 C;  3FB7 C;  2XAF A;  3UKM A;  4OX9 B;  1KYO F;  4RWU A;  3P3P A;  1FYJ A;  3CCU V;  3OUS A;  3OAA G;  2ZNI A;  4F6R A;  4DR2 B;  4F6E A;  4AHC A;  3LNM B;  2FTK A;  1MSD A;  3SPC A;  5LL6 Y;  1O9G A;  4JI0 O;  1G1X B;  4UVB A;  3K06 A;  2O57 A;  4O2A B;  3CCJ V;  3CCQ V;  4I50 A;  2ZXW B;  3RYC B;  5CB4 A;  4FPP A;  5H6R A;  4DUZ B;  1GN2 A;  1OHH G;  1SKV A;  1Q8I A;  4JYC A;  3CD6 V;  3ZN0 A;  3OW2 U;  2EIM C;  1S0V A;  1SRY A;  3ZMV A;  2PYJ A;  1M93 A;  4E4E A;  3M99 B;  4UCS A;  5FPO A;  2N74 A;  3ZHU A;  3I56 V;  2EIL C;  5KHH A;  1NTK H;  2H94 A;  2YXY A;  2PF4 E;  3HKD A;  3B8M A;  3JAL A;  2R9A A;  5IYZ B;  4JI5 O;  5J2U B;  4TUY A;  1FS0 G;  1SF9 A;  1HNZ O;  1RP3 B;  4X8A A;  4CS3 A;  2HJF C;  4RUE A;  2EZP A;  1P84 F;  4O4I B;  3WB2 A;  1VF6 A;  1M4U A;  2Z5U A;  2B1G A;  2ZDI C;  3ABK B;  2QR4 A;  3TXQ A;  2QGN A;  1GKF A;  1ZX3 A;  2BCC H;  4MS2 A;  4MTX A;  1SS3 A;  2EJR A;  1RPO A;  3ZS8 C;  2BTQ A;  3G67 A;  4PA4 A;  4X65 B;  2NNU A;  2GDS A;  3X2Q B;  2Q9L A;  1V55 B;  3OM3 B;  4PI2 A;  3PN1 A;  4HNA B;  1Q5O A;  4JYA B;  3G6B A;  5CA3 A;  4LFB B;  1A32 A;  1YXB A;  3CHX A;  1Y76 B;  4DRX A;  5JCO C;  3OD4 A;  4LF6 O;  3UT5 B;  2ZIO A;  2ODM A;  2EIK B;  2E74 B;  1CEZ A;  3ABM B;  1K5Q A;  4FMT A;  3C3T A;  4DW1 A;  3JAR A;  3ASN B;  2OCC C;  1MG1 A;  1IBK O;  3VQY A;  5C8Y B;  1FJG B;  1GMG A;  3ABT A;  4JI1 O;  1R6K A;  4FFK A;  2C2A A;  2P22 C;  4DV4 B;  1QR8 A;  4DXW A;  3H1I H;  4K0K O;  1MMM A;  3AK3 A;  4P2Z A;  5KA6 A;  5FNV A;  1VQN V;  4ABM A;  4FM0 A;  2M6Y A;  3T1H O;  1JCH A;  1WPX A;  4P30 A;  3K08 A;  3FB8 C;  2E3C A;  3OT7 A;  3P3N A;  4ZOL A;  4LF8 O;  5FPR A;  1LUW A;  1WLE A;  5JQG A;  5KMG A;  4JI2 B;  3L70 H;  4X62 O;  1Y4M A;  5LOV A;  3T4D A;  3OGI B;  4DYL A;  5IYD O;  2B1I A;  5IYC O;  2PI5 A;  3OFN G;  2QWN B;  1TUE B;  5IWA O;  1NZ6 A;  2CTR A;  2LJ2 A;  4LH6 A;  3SPG A;  4YHH O;  2HLD G;  1I94 O;  3JD1 A;  2BSK B;  4CS2 A;  2HEP A;  4GYC B;  3ASO B;  3ZJZ A;  1O9H A;  4PDL A;  4OPA A;  3E8H A;  5L3D A;  4K8Z A;  4CH3 A;  3AG2 C;  4JI0 B;  4LWS B;  2L6L A;  1YIJ V;  5GTI Z;  5KAF Z;  1IUR A;  1PD3 A;  3K5N A;  4QE9 A;  1UJW B;  5AG2 A;  2IJI A;  5IJ9 B;  4PA3 A;  2YXL A;  4UV9 A;  1BQZ A;  1XMO O;  4N23 A;  1AR5 A;  2V1D A;  1WAZ A;  1PKX A;  3EFF K;  1KUQ A;  2XHB A;  1AI7 A;  2XAG A;  2XAS A;  1FXK A;  1YZB A;  4XDL A;  2EIN B;  3NR7 A;  3H9V A;  1HDJ A;  2M7W A;  1Y74 B;  1OCO C;  4RAI A;  2Y0I A;  3DC5 A;  1H2S B;  1HNZ B;  1TVK B;  1F51 A;  3K0D A;  2P7T C;  4K8X A;  4WBN B;  2N05 A;  4LP8 A;  2WLI A;  2R9R B;  2DYS B;  4X20 B;  4IGG A;  1GTO A;  3CSX A;  4X1I B;  2Q6A A;  4B08 A;  1VF7 A;  4JTC B;  5GTH Z;  2LGW A;  4I0X B;  2EUL A;  3AG7 A;  4FIP C;  3BEH A;  4FFB A;  1BZK A;  1Q6U A;  2JDI G;  2LW7 A;  5LGN A;  1RSO A;  2PUS A;  3L73 H;  4DV0 B;  4W4L A;  1YI2 V;  4H44 B;  3QF7 A;  4LF6 B;  2XUM A;  1M57 C;  3UO3 A;  4RUF A;  1AJN A;  1NVP B;  5K1P A;  1R3L C;  2ZCE A;  4YIP A;  4TT3 G;  2EIM B;  1K9M W;  2XAQ A;  1LNQ A;  1IBK B;  1WP7 A;  1I5X A;  3AG3 C;  4JI1 B;  3Q4H A;  4LFC O;  4DR4 O;  3OTO O;  3SJA C;  2IJJ A;  5B1B B;  5ITZ A;  4K0K B;  5CBG A;  4WFF A;  4BR6 A;  2WLJ A;  4U7N A;  4NYK A;  1XMQ O;  2F43 G;  2UXB O;  1ARO P;  1QLE C;  2IM9 A;  3OE7 G;  3IJ4 A;  5BR8 O;  1JR9 A;  4JTD B;  4WCE V;  1Q6H A;  4O2B A;  3T1H B;  1JFF B;  2G38 A;  3RYH B;  4GZR B;  5IJ0 B;  2IH1 C;  2ZD9 A;  4FLU A;  3RVZ A;  2P5O A;  4UB6 Z;  4LF8 B;  1P7B A;  2P90 A;  4WFH A;  1EZJ A;  4DR5 O;  4X62 B;  3ZRW A;  4B7K A;  3CPW U;  3D8C A;  1V54 B;  2Q73 A;  4I7Z B;  4QPK A;  1GN4 A;  5CBF A;  2ZIN A;  2KG7 B;  3CJH A;  2W6I G;  3JAW A;  4YHH B;  5TIS Z;  1I94 B;  3N2G A;  4DV2 O;  1H2N A;  3FFQ A;  4PD4 F;  1EZV H;  1FFX B;  1NBM G;  3JD4 A;  1ZTE A;  4DV7 B;  4P9O A;  5J2U A;  1EFR G;  4U3F H;  2YEV A;  1K4C C;  1IXM A;  3K5O A;  2JGU A;  3JAT A;  2ZR3 A;  1M56 C;  4HAM A;  2ZNJ A;  3JAK B;  1ZL8 A;  2ZM6 O;  5EZY B;  4O4I A;  1LR1 A;  4MVQ A;  4NXN O;  1XMO B;  4FLW A;  5KHK A;  5LP6 C;  5LYJ B;  2H8P C;  4YJ3 B;  2CK3 G;  1XIL A;  3CCL V;  3RYF A;  3DC6 A;  3LUT B;  3ML0 A;  3RWR D;  3SPH A;  1JVM A;  1EN4 A;  2KB1 A;  2QTS A;  4D7T A;  5L3C A;  1IZ3 A;  2DQ3 A;  2YSU B;  1QCE A;  3N27 A;  1TUB A;  1FFT B;  3UT5 A;  3O65 A;  4AIL C;  1K97 A;  3H1L H;  2UUC O;  3CRQ A;  3VOU A;  4EB6 B;  4WFA V;  3RBZ A;  5EYP B;  3SDL A;  4GKK O;  1NT2 B;  5EBW C;  5C8Y A;  1ZAU A;  5JJJ B;  1FD9 A;  2Y69 B;  2FML A;  2QSA A;  2E76 B;  1YDX A;  5H5N A;  5LXT A;  4D7S A;  3ZCC A;  3HB3 B;  1Z2G A;  4C7U A;  4QJF B;  3KKY A;  4H13 B;  5KUM A;  1M1K W;  1R3I C;  2DW4 A;  3KCY A;  1PNK A;  4I4T B;  4NR1 A;  4EFB A;  4MSW C;  4YJ2 B;  4U3J A;  1B3Q A;  1XI1 A;  4RQF A;  3P32 A;  3H01 A;  2QWR B;  5IYB O;  5B5E Z;  1S72 V;  3ZHR A;  3VQV A;  1MNG A;  1JJ2 U;  4BW5 A;  4JV5 O;  4DR4 B;  4O4H B;  4LCU C;  5BZB A;  3OTO B;  2LP7 A;  3AG1 C;  2W6J G;  1JA8 A;  1XMQ B;  2UXB B;  3HKC B;  5BR8 B;  4ZI7 A;  3E22 B;  1WNS A;  2WLK A;  1WA8 B;  2RCV A;  1DGS A;  1FAF A;  1S5H C;  1BQ0 A;  1SET A;  1Q90 D;  5LBQ A;  3ZHT A;  2CGN A;  4O4L A;  3LSU A;  4FLZ A;  4DR5 B;  4GKJ O;  1JQ0 A;  2WLL B;  5KX5 B;  4OGQ B;  2R70 A;  4CZZ A;  3LDD A;  5GW7 A;  4LF5 O;  2YID A;  3K59 A;  1OCZ B;  4DV2 B;  2F66 C;  3B4S A;  1R6T A;  1NJI W;  1BGY H;  3THO A;  2HVJ C;  1Y74 A;  4LNU B;  4LFA O;  2F23 A;  2Q7G A;  4I55 B;  5J2T B;  1M90 W;  3K3W A;  5LGT A;  5CMU A;  1EN6 A;  4WBN A;  1AIL A;  3E2E A;  2HFE C;  1HWY A;  1OJH A;  1RM1 C;  3TCU A;  2L35 A;  3OR6 C;  1JPX A;  5JJE B;  4MVR A;  1FPO A;  3AG3 B;  1OCR B;  4MW3 A;  2UUA O;  3B8N A;  5DN6 G;  1NTM H;  4H0L B;  1N0J A;  4EEQ A;  4I0X A;  2EBO A;  2QE7 G;  3QG5 A;  5LMU O;  3ETQ A;  2LQT A;  2PZS A;  1S5L Z;  1PP9 H;  1ENV A;  4UUJ C;  1HW7 A;  3EHB B;  2GUZ B;  4JAA A;  1YJ9 V;  2QWP B;  4BWA A;  4F4L A;  1YCI A;  2E75 B;  3GB7 C;  3KCX A;  3ICX A;  1K3E A;  3BFR A;  1K5S A;  2F95 B;  4MVO A;  2UUC B;  4WFG A;  4B7E A;  3BHP A;  1NR1 A;  2X6B A;  4GKK B;  2D2C B;  3TJT A;  2JJ1 G;  4DW0 A;  2R9I A;  1ROP A;  2Q8V A;  2A3Q A;  2ZE5 A;  1NTZ H;  2FB5 A;  3IC9 A;  4L87 A;  4FM1 A;  5FLX N;  2QM8 A;  3APO A;  3APQ A;  3A0B Z;  4IIJ B;  1ZWI C;  1JFF A;  2UXC O;  3RYH A;  4KL1 A;  3RYI A;  4AI8 A;  3FB6 C;  1BT8 A;  3UO2 A; 
#chains in the Genus database with same CATH homology
 3SPI A;  1M56 B;  1YJW V;  2Z3Y A;  1OCO B;  3ETE A;  4I5S A;  4CBC A;  5LGU A;  1PD3 A;  1NR7 A;  4PA7 A;  4G2K A;  3ETD A;  2P6J A;  2OT5 A;  4QE9 A;  1VQL V;  1UJW B;  2IJI A;  3CCE V;  4PA3 A;  4N21 A;  4UXN A;  4FJC C;  4UV9 A;  4N23 A;  3F7Y C;  2V1D A;  1PKX A;  3EFF K;  4KP4 A;  4LC1 A;  4PA9 A;  5EBL C;  5IDJ A;  1E1Q G;  1AI7 A;  4EKW A;  4GX5 A;  3ZMU A;  1RPR A;  3CXC U;  2XAG A;  3DTU B;  3AG4 B;  5LHG A;  2XAS A;  1FXK A;  3LSS A;  4R50 A;  1DLB A;  3FYE B;  3RVY A;  1K92 A;  4XDL A;  1H38 A;  4R7C A;  2EIN B;  3E89 A;  5EBM C;  2B5U A;  4MT8 A;  2JIZ G;  2M7W A;  1YTF B;  1OCO C;  2EIJ B;  3NXS A;  4RAI A;  1KEC A;  2ZQM A;  3LSQ A;  3D36 A;  1QR9 A;  1K33 A;  2LFS A;  1R3J C;  1F51 A;  1YJN V;  3K0D A;  1W0K G;  1M57 B;  5B1A B;  4BIZ A;  2P7T C;  3W7X A;  5CBH A;  5KA5 A;  4E2L A;  4MVZ A;  3FB5 C;  3CME V;  1K4D C;  4LP8 A;  2WLI B;  2WLI A;  4MTG A;  2R9R B;  3E35 A;  3OMI B;  3CMA V;  2DYS B;  1K34 A;  3ZIA G;  5L3F A;  1N8R W;  3AG4 C;  4BAY A;  1AJQ A;  4JYB A;  3SPJ A;  1GTO A;  2Q6A A;  1BHB A;  4TSF G;  4JTC B;  3SYA A;  1OCC C;  2BOB C;  1Q86 W;  3W7S A;  4H33 A;  2IU0 A;  1QLE B;  4FIP C;  3BEH A;  2EIN C;  1NH2 B;  1Q81 W;  3SYO A;  3ZN1 A;  2JDI G;  2WAM A;  5LGN A;  3T4Z A;  1VQ6 V;  1G8M A;  2DWE C;  1J95 A;  2K1E A;  1YI2 V;  2NLJ C;  1CP9 A;  2ATK C;  1M57 C;  5B1A C;  3ABU A;  3JD0 A;  1AJN A;  3OMN B;  4OXS A;  4RUF A;  1MAB G;  1NVP B;  4QE7 A;  3CCV V;  1R3L C;  5B1N A;  4J9Z B;  1PNM A;  5FL7 G;  1R3K C;  3CC2 V;  1K7D A;  4TT3 G;  2EIM B;  2WSS G;  2JEX A;  2WWW A;  1K9M W;  4PDM A;  2DYS C;  2XAQ A;  3ABM C;  4KFM A;  3I55 V;  1LNQ A;  2ITD C;  2UXN A;  3AG3 C;  1I5X A;  1AR1 B;  1JOY A;  2IU3 A;  3AG1 B;  4MTF A;  2PI4 A;  2A79 B;  3ZMT A;  3STZ C;  1VQK V;  4H37 A;  2IJJ A;  5B1B B;  1S77 D;  1H2G A;  5DM6 V;  5CBG A;  4WFF A;  5HFL A;  2WLJ A;  4U7N A;  1NH2 D;  2A0L A;  2F43 G;  1ARO P;  1QLE C;  3AEI A;  3OE7 G;  4JAS A;  4JTA B;  4JTD B;  4WCE V;  1K8A W;  1S76 D;  4YXW G;  2OTL V;  1SER A;  4J9Y B;  1W0J G;  2DYR B;  2X6C A;  1GM8 A;  2WPD G;  3IFX A;  2IH1 C;  2ZD9 A;  3CCS V;  4Z1M G;  3RVZ A;  1P7B A;  2P90 A;  5B1O A;  1F23 A;  4JPR A;  3JCZ A;  4WFH A;  3A0R A;  3SJQ C;  1KD1 W;  3E8F A;  1GM9 A;  1EZJ A;  3E86 A;  3BY6 A;  3ZRW A;  3ZRW B;  3CPW U;  1MSW D;  4BIU A;  3CCM V;  1V54 B;  3KG2 A;  3SYQ A;  1W2B U;  3WG7 C;  1THZ A;  2ZDI A;  4MVS A;  4QPK A;  1Q82 W;  2X0L A;  1BMF G;  2DWD C;  4JAV A;  5CBF A;  2A9H A;  1PNL A;  5B1B C;  2IH3 C;  2IJK A;  5HFM A;  1QVF U;  2W6I G;  4ZBM A;  1AI4 A;  1VQ8 V;  1AI5 A;  2WLN A;  4U7O A;  1PL0 A;  4MW8 A;  3PJS K;  4P9P A;  3ABL C;  1FXK B;  2DYR C;  1NBM G;  3ASO C;  2JEU A;  1P4R A;  4QNH B;  1KC8 W;  3JD4 A;  4P9O A;  1EFR G;  2YEV B;  2EZO A;  2YEV A;  3W7T A;  1K4C C;  2DQ0 A;  4HZ3 A;  1IXM A;  3ZMS A;  2XAH A;  4WFB V;  2WLL A;  2ZR3 A;  1M56 C;  2HG5 C;  4HAM A;  1E79 G;  2W0F C;  1GM7 A;  4MVM A;  3E8B A;  4Q20 A;  3GWO A;  1E1R G;  1V54 C;  4MVQ A;  3VBB A;  1XL6 A;  3TET A;  4PDV A;  4DO2 A;  3G71 V;  2HKO A;  3QO8 A;  5L3G A;  4WFE A;  1VQP V;  1Q7Y W;  5EC1 C;  5B3S B;  3JD2 A;  4WF9 V;  1R6N A;  3T1C A;  2P67 A;  5IY5 B;  2H8P C;  3IC7 A;  1KP3 A;  3HPL C;  2AHY A;  5LHH A;  4QIW F;  5EK0 A;  2CK3 G;  1FXK C;  3FKS G;  3CCL V;  4JGS A;  5E1A C;  3LUT B;  3ML0 A;  5H9C A;  4X89 A;  1CPY A;  1JVM A;  1S3J A;  2KB1 A;  4GX2 A;  3SPH A;  5L3C A;  2D3O W;  3QNE A;  1R73 A;  2DQ3 A;  4KUM A;  3TK1 A;  5L3E A;  2YSU B;  3F7V C;  1VQM V;  1VQO V;  1QCE A;  1B6Q A;  1YTF D;  2LFR A;  1FFT B;  3MD0 A;  4PA6 A;  2EIJ C;  3QO7 A;  1K97 A;  3K9A A;  1SZT A;  3E8G A;  3OEE G;  3K04 A;  2AHZ A;  1BHA A;  3VOU A;  4WFA V;  4UV8 A;  3RBZ A;  1YSC A;  3UM7 A;  5EBW C;  1QBZ A;  1VQ4 V;  2OTJ V;  2Y69 B;  5B3S C;  1FXV A;  1NKD A;  2JK5 C;  2V7Q G;  2Y48 A;  4G27 B;  3G4S V;  1MOF A;  5IY5 C;  4PEL A;  5L3B A;  3FB7 C;  1DF4 A;  2IW5 A;  2XAF A;  3UKM A;  3ZCC A;  4FK5 C;  3HB3 B;  3CYO A;  4QJF B;  4GX0 A;  1GO3 F;  3CCU V;  3K79 A;  5KUM A;  3CC7 V;  3OUS A;  1M1K W;  4JF3 A;  3OAA G;  1R3I C;  2DW4 A;  2QTO A;  3B77 A;  1F4N A;  3LNM B;  4JAU A;  2EIL B;  1H8E G;  2FTK A;  1PNK A;  1I5Y A;  3CCR V;  3SPC A;  4UVA A;  4MSW C;  4UVB A;  3K06 A;  1QVG U;  1OZ0 A;  3CP1 A;  3CCJ V;  4RQF A;  3CCQ V;  3P32 A;  3H01 A;  1NVP D;  2ZXW B;  5IYB O;  4FPP A;  1S72 V;  5H6R A;  3ETG A;  2X7R B;  3FYI B;  2Y69 C;  1OHH G;  2BOC C;  4JYC A;  2UXX A;  2QEX V;  3CD6 V;  3OMA B;  3ZN0 A;  3OW2 U;  2EIM C;  2WLM A;  1SRY A;  4X88 A;  3ZMV A;  4BW5 A;  3W7U A;  1JJ2 U;  1S0V A;  4LCU C;  5BZB A;  2LP7 A;  1JX9 A;  3AG1 C;  3M99 B;  4RO2 A;  2Q69 A;  2W6J G;  4R6Z A;  1DF5 A;  4TWK A;  2QM7 A;  2WLK A;  4I9W A;  3I56 V;  2EIL C;  2HR3 A;  1G4Y B;  5CN0 A;  1S5H C;  4XBF A;  5C93 A;  2XAJ A;  2GHY A;  2H94 A;  1SET A;  5H6Q A;  3B8M A;  5LBQ A;  1KQS U;  4PDR A;  4ZKI A;  5KUK A;  2Q67 A;  3OUF A;  1H8H G;  2HVK C;  2ZXW C;  1FS0 G;  5LHI A;  1VQ7 V;  4X8A A;  1JQ0 A;  2HJF C;  2WLL B;  3F5W C;  1COW G;  1KP2 A;  4RUE A;  2EZP A;  3W7W A;  1YIT V;  4CZZ A;  4RQE A;  3LDD A;  1RM1 B;  1XL4 A;  3D3I A;  2Z5U A;  4ASU G;  2B1G A;  3P30 A;  5GW7 A;  2ZDI C;  3ABK B;  3MHS C;  1OCZ B;  2OCC B;  1GKF A;  4HYO A;  1OCC B;  1YHQ V;  4MS2 A;  4MTX A;  1F4M A;  3LDE A;  3ZMZ A;  2XOK G;  2EJR A;  1RPO A;  1NJI W;  3JYC A;  2ITC C;  2IJH A;  1KKD A;  4PA4 A;  2QKS A;  2NNU A;  2HVJ C;  3X2Q B;  1EBO A;  3DGE A;  1V55 B;  2JJ2 G;  4G28 B;  2QA4 V;  3OM3 B;  3ZRV A;  1VQ5 V;  4QPJ A;  1M90 W;  2XND G;  3K3W A;  5LGT A;  5CA3 A;  4GCZ A;  5CMU A;  1QLN A;  3ZRX A;  3E2E A;  1NQT A;  2HFE C;  3ZRS A;  1HWY A;  3WFV A;  5J9P C;  2EIK B;  1CEZ A;  3OEH G;  3ABM B;  3TCU A;  1K5Q A;  1RM1 C;  4FMT A;  3OR6 C;  1JPX A;  4MTO A;  4MVR A;  3AG3 B;  1OCR B;  1FXH A;  3LDC A;  4MW3 A;  3ABK C;  3G6E V;  1ORQ C;  2ZR2 A;  3ASN B;  3B8N A;  1OCZ C;  5DN6 G;  2OCC C;  1MG1 A;  3K0G A;  4XDK A;  1K73 W;  1GMG A;  3ABT A;  2EBO A;  2QE7 G;  3T2M A;  4UVC A;  3MHH C;  1R6K A;  1Y66 A;  2C2A A;  1QR8 A;  4DXW A;  3K03 A;  2X6A A;  4P2Z A;  1GK9 A;  3OR7 C;  4GT1 A;  1ENV A;  3IGA C;  4UUJ C;  1AI6 A;  1AJP A;  3X2Q C;  2Q68 A;  5KA6 A;  3EHB B;  1YJ9 V;  1V55 C;  1VQN V;  3STL C;  4F4L A;  3GB7 C;  1JCH A;  1WPX A;  4P30 A;  4R8C A;  3K08 A;  2MK3 A;  1K3E A;  3FB8 C;  3AG2 B;  1K5S A;  3OGC C;  3E83 A;  4MVO A;  3SYP A;  4WFG A;  4XDJ A;  1NR1 A;  1BL8 A;  2EIK C;  2X6B A;  3QO5 A;  1WLE A;  3SYC A;  1OCR C;  4MVU A;  2JJ1 G;  1DTO A;  2R9I A;  1Y4M A;  1ROP A;  3ASN C;  5EC2 C;  3WG7 B;  3T4D A;  4GX1 A;  1VQ9 V;  5IYD O;  3R65 A;  2B1I A;  1L1F A;  2GSM B;  5IYC O;  2PI5 A;  3OFN G;  4L87 A;  2WLH A;  4LBE C;  2QM8 A;  1TUE B;  3SPG A;  3JD3 A;  2HLD G;  1ZWI C;  3JD1 A;  3ABL B;  1M9N A;  3ASO B;  3ZJZ A;  1SES A;  3FB6 C;  4PDL A;  3RW0 A;  3CC4 V;  3E8H A;  5L3D A;  3AG2 C;  1YIJ V; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...