4P31A

Crystal structure of a selenomethionine derivative of e. coli lptb in complex with adp-magensium
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
234
structure length
234
Chain Sequence
ATLTAKNLAKAYKGRRVVEDVSLTVNSGEIVGLLGPNGAGKTTTFYMVVGIVPRDAGNIIIDDDDISLLPLHARARRGIGYLPQEASIFRRLSVYDNLMAVLQIRDDLSAEQREDRANELMEEFHIEHLRDSMGQSLSGGERRRVEIARALAANPKFILLDEPFAGVDPISVIDIKRIIEHLRDSGLGVLITDHNVRETLAVCERAYIVSQGHLIAHGTPTEILQDEHVKRVYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lipopolysaccharide export system ATP-binding protein LptB
publication title Decoupling catalytic activity from biological function of the ATPase that powers lipopolysaccharide transport.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 70
structure length 234
sequence length 234
chains with identical sequence B
ec nomenclature ec 3.6.3.-:
pdb deposition date 2014-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF12399 BCA_ABC_TP_C Branched-chain amino acid ATP-binding cassette transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4p31A00
4OHWA 1HH4A 3IUYA 1FP6A 2W6JD 1GKUB 2WSMA 2ZE8A 4MKHA 1YE8A 3B1VA 4DLXA 1SVOA 2AD1A 4L16A 1A5TA 4JMPA 1NVVQ 2J7PA 4B76A 2GBLC 4DLWA 3SJZA 2LCFA 2XXAA 3P26A 3R8CA 3Q5EA 1YZLA 4Z51A 3OFNA 1S9HA 1ZM9A 4FCVA 4Q9LA 4AKHA 4GNKA 2D74A 1TU4A 3RAPR 2ANCA 1TF5A 1ZYUA 3F5FA 2VP9A 1IY2A 2ZRFA 1WCV1 2WWIA 2C2HA 1PLKA 1XTKA 1COWA 3AF3A 4Q4HA 4C30A 4QJ3A 3KFXA 1OXVA 5D3MB 4Q1EA 4TTPA 2XNDA 4G5GA 2VPPA 2QMOA 5EXPA 5JRZA 2AWNA 2OT3B 3MMPA 4GI7A 4TMTA 3A1SA 3DM9B 2C5LA 2VH5R 2ATXA 5KOYA 1KSFX 5FR2A 3CF6R 2BM0A 2HYIC 4XVRA 1W49A 1HY3A 4IFBA 2D3WA 3GLIE 2C9YA 1D2NA 1H8HD 1PV4A 1G7CA 5GADl 2OUKA 2RGDA 2Z4RA 4JLJA 5JZVA 1TL7C 1U9IC 4OQXA 1E0KA 2OHFA 1P4SA 3WMFA 3CLVA 1ZNYA 2I4IA 1JNYA 3B1XA 4FWTA 1J2JA 1NG1A 1U2RA 4Q9HA 2FFBA 3EPKA 1JQLB 4F93B 5J4VA 1EG7A 3WRYC 4JLAA 4EJSC 4L4UA 1E0SA 4DIDA 1DE0A 1NMXA 5TARA 3U3KA 3ICEA 221PA 2ONKA 3QKUA 4JSTA 3PITA 5CDFA 4LZZA 4OHYA 1IOZA 4FN5A 4QBGB 1Z06A 5EP3A 4ON9A 2FPLA 2AWOA 3HYRA 3RS7A 4JT4A 4S35A 1LVGA 4A92A 4JLVA 3LWNA 2YNMA 1TQ2A 1ZNWA 2A7QA 4RD6A 3RSOA 2OFXA 2DPXA 3VKWA 1E2IA 4G01B 4UJ3A 1NN3A 1E6CA 5LB4A 1EFUA 1N25A 3DMDA 1MABA 5DHFA 2XEXA 4MRNA 1Q3HA 3GFOA 3WYGA 2QP4A 5J47A 4Z8YA 2B7BA 4PPQA 4TL7A 1QHGA 2BIFA 1OB2A 1NL3A 3EPHA 2ZRDA 4B2LA 3BAFA 3CPEA 3F0TA 4D4MA 1MOZA 2AFIE 2IYUA 2ZI6A 3GLGB 2ZRJA 1H65A 1J8YF 2B8WA 3KB1A 1XPUA 3GJ7A 3MWJA 1W2GA 2P6RA 1YVDA 3DKVA 3ZVNA 1ZM7A 2R62A 3FKSD 2OO7A 1GFIA 3EARA 1EK0A 1DO0A 2NO1A 4Y0VA 5DH9A 5L3RA 3P32A 5L8VA 2JLWA 3AM1A 3EA0A 3HDTA 4NYMR 3VFDA 2Z0MA 2F43B 2B6HA 1BOFA 1TU3A 4C0BA 2ZVQX 4G5OA 4D81A 1U8AA 2QGNA 1E96A 5DI3A 5CDFE 1QRAA 3I62A 4D0NA 2MMCA 4PC6A 1Z07A 3OE7A 1VHTA 4BLTA 1N6RA 2IS4A 3PG5A 1UPTA 1KJYA 4BECA 3M0EA 4ILEA 4Q7KA 4XSGA 2QAGA 2O8FA 3A1TA 1KI4A 2ZSFA 4D4JA 3DZ8A 2FDCA 1I2MA 1KDTA 2ZTSA 2EWWA 521PA 4M8NE 5TMPA 1HUQA 1LV7A 2J87A 4Q1DA 4D0LB 4RFSB 3UG6A 1B23P 2PMDA 2OCBA 2P2LA 2F9MA 2XX3A 5E7JA 1G7SA 3VHLB 1MH1A 1GTVA 4D4LA 2Q3HA 2GXUA 2NMVA 2QY9A 4MYTA 4NYJR 4OHVA 1H8EA 5J4YA 3L43A 2BBOA 5EE3A 3REFA 2J0UB 4DB4A 3GEEA 2AXPA 4CW7A 1Q1BA 1RRPA 3I72A 4Q66C 4ASUA 3ASYA 3K0CA 4DJTA 2V54A 2NG1A 2P3SA 2PZGA 2RB4A 1E79D 3G82C 5C4GB 1IBRA 3I32A 3AEZA 2G88A 1C4OA 1BMFD 3DZDA 1US8A 4IVPA 4OI1A 2ZM5A 1U94A 1A2BA 2W2XA 3A37A 4KXFB 4P31A 2PBRA 2GVDC 3WP1B 3UWOA 2O8CB 4BLQA 4PHTA 3RANA 1NVVR 2YOGA 1FX0A 4LRWA 4GOKA 4AI6A 4QHTA 3OIVA 4RCYA 4LC1A 4W9MC 2Q9CA 2OESA 3NEJA 4QGFA 3BK7A 3UIEA 2WICA 2KI5A 4HUQB 2EFEB 2W6ID 2FWRA 3SC3A 5IK2D 2DYKA 3MD0A 4LUCA 5CJ2A 1T8UA 2QBYB 3E1SA 4PQFA 2IHYA 3BS4A 3TW4A 4Z8XA 1QHXA 4QRHA 3MUFA 3LFUA 4W5WA 1SXJA 1KNXA 3PUYA 4BFUA 3Q7QA 4B3XA 3KKPA 2WJIA 1NBMD 4GL2A 2WOJA 4ESHA 3W6OA 4HLUC 1PLJA 1VG0B 5CITA 2F6RA 2W00A 1ZD1A 5EXXA 3RS5A 3HP1A 5G3YA 5KSZA 4KFTA 4TL6A 2VTKA 2BEKA 2JLVA 2W0MA 2ORVA 3AF0A 2O8DA 2IYVA 1E2KA 3WP0A 2AXNA 3GLHB 3SEAA 2HUPA 2HEIA 3VR1A 4Q9KA 1A1VA 2CEAA 1IQPA 2ZJZA 3W6PA 2ANBA 2Z5FA 4MGKR 4Q03A 4N1AA 3ZH9B 2ZJAA 4LJAA 1G3UA 2CCGA 3VU9A 2D7CA 3GEIA 2NO0A 2IF0A 3QOFA 1Q1EA 3I8SA 2REOA 2GWHA 2VP0A 4NCKA 4Q1BA 5GVRA 3ZD7A 2JLSA 4BLSA 1YQTA 1YZQA 4AWXA 1KKMA 1P75A 1L7VC 5LD2B 1E2LA 3D6TB 2VHCA 4TL8A 1D2EA 1VCOA 3CRW1 2EFHB 3GJ0A 5CIQA 1RJ9B 4QJ5A 3A6PC 4LGMA 2WV9A 4OQLA 4A9AA 1FUKA 4PAOA 4TQ9A 4TYPA 2IYTA 4YMWA 2N1BA 4CYMA 3FOZA 5DISB 4I4LA 2WSSD 1SXJE 3H2YA 6Q21A 1DAMA 1YZTA 1N6HA 2GILA 2V4ZA 3EIHA 2XOKD 2GEUA 1QDEA 4C9BA 2ODEA 2PT5A 3OAAD 1Z2AA 2CCKA 1LS1A 2GJ8A 2NTYC 2P65A 4JLBA 1PZNA 1P61B 2FFAA 3THWB 2V55B 4NHOA 4GBMA 4HAVA 4K81B 1Q1ZA 1JAIA 1Y63A 1KK2A 1M7BA 2WAXA 2YJTD 3NH9A 4D82A 2EW1A 2Q9AA 4I1VA 4JYBA 2ZJYA 3T34A 3OZXA 3FMFA 4HB0A 4UQOA 4A15A 1XD9A 5EUQB 3RABA 2BJVA 3EZFA 4HAXA 2BBTA 1DTSA 2B21A 3G0HA 5DSZA 3AVTA 3CX7A 4I81A 3P20A 1FL9A 4O25A 1GNRA 3U7HB 3PUXA 2H5EA 1Z6AA 1ZIOA 1EESA 1OHHA 4B34A 1WQ1R 1S3GA 2F1JA 2IYRA 5A5GA 1XWIA 1ZM3A 1CJVC 2IL1A 3FHCB 4PAQA 2WKQA 1AN0A 4NH0A 2A5YB 3KKOA 3NBZC 2F7SA 1R8SA 3CR8A 1KMQA 4DRZA 1Q22A 2E87A 2VSOA 2GTPA 1XEXA 1HYQA 2EVWX 5CM8B 4DDWA 3LY5A 4D25A 3LBNA 2QSYA 5JEEA 1RRCA 3CIOA 4KBGA 1N6NA 3LX5A 1TTTA 2ZAMA 1L2TA 4IXNA 3AUYA 4JBXA 2DFNA 2X77A 3ZJYA 1Z47A 1R0YA 4EJSA 1ZW6A 2BV3A 4IDHA 4DCVA 1AQYA 3BE4A 2R9VA 1UKVY 2DHRA 3PUZA 2XSZD 3QPUA 1W47A 2YZ2A 4GSYA 4RKFA 1DS6A 4W7SA 4BFTA 4HSEA 1S8FA 2VYFA 2J0SA 4U7DA 5GJCA 3LAWA 1NP6A 3BH6A 3R9XA 2J59A 1DOAA 4Q00A 1OFIA 2ZR9A 2QRNA 5FFMA 1US8B 3KX2A 3I73A 4LSGA 1NMZA 1VECA 3T15A 1DAGA 2P6NA 3C7KA 4GDFA 2ZRHA 4NONA 1CR2A 5A0FA 2GXQA 2X8AA 2JAQA 5HTKA 2H8KA 4B47A 2FSHA 1NVXQ 3TMKA 4DHEA 4RD3A 3IGFA 3QNUA 1FX0B 2JLRA 3B9QA 1I4DD 1F2UA 3U44B 5FBWB 1ESNA 3VX4A 2CK3A 3QPWA 4D2IA 3NDBB 4DVGA 2JDID 4UNRA 1NI3A 3KJEA 1KO4A 2EYQA 3VR4A 5FPKA 2F3TA 4NU0A 1N6IA 3KB2A 4RZUA 1EWRA 2QROA 4TTRA 4DBLC 2IS1A 3N70A 4W5HA 2BMDA 4BFVA 2V9PA 4Q1CA 1R6BX 2QG6A 3TSWA 1XBTA 3M1IA 1PVOA 2DWPA 3K70B 1JR3D 4EPRA 1KI7A 1KOFA 1DAEA 2XJ4A 3BH0A 4B6EA 1CS4C 2FN4A 4HYYA 1GP2A 3T12A 2Z83A 2WOOA 1DEKA 4TYQA 2UZ3A 1CJMA 2RGEA 2F9LA 2NGRA 2Y8EA 4NCNA 5KDLA 4V03A 2QU8A 4B43A 4HAZA 1SHZA 3EWSA 1KHTA 2WAYA 3U4QB 1EGAA 5FUVA 5KSYA 2NO7A 2FE4A 2GEDA 1Z63A 1G64A 3HPRA 3LH5A 2O8DB 2WPDD 1RYFA 1UBFA 2ZYWX 2IW3A 1OFHA 1S1MA 1B0UA 2OCAA 1T9HA 4PTLA 3T61A 3K9NA 1G21E 3RRYA 2JIZD 4WXRA 5J4KA 1CIPA 2KBFA 2ZRNA 3FFAA 4BZPA 3HPQA 4AG5A 1VDZA 2RKOA 4HB2A 1XB2A 5AJZA 3A4MA 1HEIA 2C95A 2ZI5A 121PA 5FUYA 5D3MA 4BZQA 3QUSA 2WWYA 1T3HA 2QTVB 3KUDA 2YWEA 5EE5B 1WRBA 3IKJA 4X8LA 5EXSA 4Z1MD 1QHHB 3OEED 2ZS7A 5LBIA 3DL0A 5EUMA 5BYKA 1JEDA 3EXAA 4GP6A 4D80A 3QKSB 1E4YA 1GRQA 1KI6A 1KK3A 2GF9A 4A6PA 5FPYA 1W44A 2GJ9A 4ACBA 3U7GA 3KJIA 4O2RA 1S9DA 2Q3MA 3X2SA 4XOIA 3PR1A 3LLMA 4B3BA 4AYXA 1J7KA 4B3GA 4EFLA 1KIMA 4AYWA 3DEFA 3B85A 2HV8A 2CVHA 1T3SA 4TT3A 3BERA 3CZPA 3CB4A 5ELXA 3BFXA 2JLXA 4URZR 4UJ5A 3TR5A 1E9BA 1G5PA 1XU4A 2FOLA 4B73A 1M7HA 3NC0C 3VTKA 4C2UA 1CR0A 2O52A 3OEHA 4JYCA 3RS0A 1W5SA 3Q85A 2QPAA 4A1FA 5HZHA 5K8IA 5IRCD 3I3SR 3ZIAD 5BXQC 3RC8A 2JLUA 2A5FA 4R9UC 1GUAA 1ZAKA 4XSHA 4HLCA 4EDHA 4BQSA 3Q7PA 3QENA 4MGYR 5GVSA 3L8YA 2MSDB 4IKEA 1XD8A 2C8VA 3LA6A 3PJRA 4LBWA 1P73A 4HB4A 4QKQA 1P2VA 4FMDB 4ZKDA 1VG8A 2ZANA 4OYHA 1M2OB 5DLQC 3QXCA 2W6IA 1GNQA 3B13B 4NBSA 5IK2A 1ZIPA 3JZMA 1N0UA 4C7OB 1W0KA 5JECA 2EFCB 3Q5DA 4E5UA 2GCOB 1E9SA 3OHMA 5CIWA 4CT5A 1Q21A 1GITA 1R2QA 3FKQA 4M9ZA 1R0ZA 4PAMA 1VG1A 2D06A 5TXGA 1FTSA 2JJ1A 4E09A 1F2TB 3EZ9A 3T06B 1TF7A 3AGPA 2GEVA 4C0HA 2FZLA 3UG7A 3GJXC 1GRNA 2ZE6A 5K8TA 1GVNB 1NKTA 4A0HA 3GLGA 3O8BA 3IO3A 1HE1C 2G83A 3EAQA 4PFSA 2QQEA 1G8GA 1ZCAA 4CVNA 4CZ2A 3K09C 1JPJA 2QUZA 3MLEA 4II7A 3WNBA 4JJZA 4YONB 5TVKA 2ERYA 2GETA 4O0MA 3LXRA 4NKRA 2OBLA 2F43A 2OXRA 4RZ2A 5FOWA 1KO5A 3SNHA 1N0WA 3GD7A 3T1VA 1OYYA 3U7FB 1FQJA 1WXQA 4C0SA 3FMPB 1G6OA 3NHAA 1NNEA 2GHIA 4IVRA 2IEZA 4TQAA 1E2DA 4DDUA 4Q4AB 2QMEA 1LB1B 4JT2A 4PC1A 2WWWA 2CMKA 3AF2A 3E2IA 4B35A 4RCZA 4TMXA 2GAOA 5BYJA 5KPJA 1QF9A 3U2QA 4BFWA 2OV2A 3RHFA 4MRPA 1M7GA 4E22A 4B3DA 721PA 821PA 3A36A 3VNUA 2PLRA 4RFSA 2YC2C 4PX9A 4ABYA 4US2R 2NPIA 3CM0A 2RGNC 4Q01A 3F3YA 1JJVA 2IYYA 1G3QA 1KSHA 3B6EA 4G3XA 3Q3JB 2XJ9A 4GOJA 3OAAA 2A2ZA 3T5GA 3H4MA 1II0A 2J5XA 4KYUA 1II8B 1XCPA 2YOFA 3ZS9A 2J0UA 4L5BA 5E95A 5C1BA 1RRFA 3ICQB 3THYB 1A7JA 1Z28A 4HZIA 3GLGE 4HDOB 3EC2A 4DLRA 2WZQA 4HAUA 3G5UA 5BWMA 2FGKA 1JALA 1CP2A 1SVSA 1XPOA 1Z2CA 1XJQA 621PA 1PLLA 4GZLA 4IOLA 4OK3A 2IBMA 3ZZTA 1VTKA 3CW2A 2O0HA 3LXXA 3QKTA 1CJKC 2O8CA 2MSCB 2EFDB 1X86B 4B3FX 5FBVB 2O8BB 2A3RA 3R9WA 1K5DA 3C4JA 5AUQA 1CJUC 1DG1G 2HT6A 3OESA 1IM2A 2QPTA 1DADA 4PSAA 4TYNA 2VBCA 3UANA 2E1RA 3I92A 4HUQA 1W7AA 1CRPA 1E4VA 3KKQA 1P2SA 3ZGXA 4O3MA 2H1LA 2BM1A 1MO3A 2C04A 2QBYA 2BMFA 4LOAA 1KZ7B 1IXZA 1GL6A 2QN6A 1E1QD 3NEYA 3QXJA 4P0TA 3MAAC 4U00A 1M74A 4C0JA 3EZ7A 2C9CA 3NIBA 3UKDA 1KI6B 4KBFA 4Q9IA 3PQCA 4PHFA 5KUTA 1YZUA 1MO4A 2ZETA 4P4SB 4ZDJA 4QJ4A 4HLQB 5FL3A 1U0HC 2KE5A 3IDQA 2ZU6A 1G8PA 5EQTA 1ZUHA 1GZSA 3FHTA 4QNRA 4CEJB 2V7QA 5FTMA 3ADBA 3MWLA 1X8JA 3GLHA 3BH7A 3AVVA 1DAHA 3IEUA 2OLKA 1E2PA 1WDTA 3T5DA 2V3CC 4LHZA 5G53C 4LK2A 5KNDA 1R7RA 3VHXA 1P2UA 1U8ZA 2VF7A 1IJEA 1ZC3A 1XJ0A 2ECKA 3K0EA 2ZYVX 4BPBA 4ZDKA 2BEJA 4LJ6A 2WJHA 2CLSA 4I99A 1F60A 4PSKA 3TW8B 1TAGA 1NVWQ 1KJZA 2TMKA 1P9NA 3TRFA 5IT5A 4V0MA 1G20E 2DCUA 3L0PA 4K8OA 4UNPA 2ZU0C 1DO2A 4Q7MB 3TVTA 4W5JA 1XX6A 4BEJA 2VHJA 4NPHA 1EWQA 3GJ6A 1RJ9A 3U3MA 3DHWC 3GLFB 2W58A 4M2LA 1SVIA 3B78A 1F3OA 3L0IB 2NIPA 4MKFA 1RVDA 4OL0A 5C46F 5HR5A 4CGZA 1OLOA 2JJ2A 4M1MA 5FPTA 1I2DA 1TF2A 5FTNA 1HT2E 2R6FA 1E9DA 1BS1A 1N6PA 2HF8A 4OI0A 1EXMA 4GT1A 1UJ2A 3QF7A 1E0JA 4NDZA 1G291 3O8DA 5FTKA 4KFSA 4ZDWA 2WIAA 2WWGA 2OLJA 4MKIA 4U02A 1WF3A 2IT1A 2VP5A 4M1YA 4M1WA 3RS3A 3X1WA 4Q4LA 1NG9A 1G16A 1ZD8A 2BVNA 4ZIRB 3LQQA 3THWA 1IN6A 2C03A 1FZQA 3NBFA 3K9GA 1D6JA 3H86A 3CRMA 3KL4A 3CH5A 1KO7A 1T4GA 2RGXA 2O0JA 4HDCA 3TIFA 3GLHE 1ZP6A 2IK8A 2V1XA 5EP1A 3QBVA 5DNYB 4ITRC 2WJJA 1J90A 4A2WA 5KNBA 2NO9A 2K5UA 2LKCA 4JZKA 1E3MA 3C15C 2LWIA 3P1JA 2ZRAA 4A2QA 3SE0A 1QVAA 3AVPA 4EPXA 3CR7A 2CE7A 2W2TA 2PCJA 3THXB 4F7WA 1KK1A 3KFVA 1W4CA 3GJ5A 1FOEB 1TQ4A 1G41A 3SHFA 5FPSA 4V0ME 1AJEA 1NKSA 2H17A 3RWOA 2CHGA 2HLDA 3MJHA 4YMUA 3UWKA 1QHNA 1AKYA 4OBEA 1MV5A 2ZUCA 2IS6A 3HYTA 2Q21A 1NLZA 1O87A 2G9NA 1KK0A 1SGWA 1P62B 3N2EA 4Y0AA 4LHYA 5JWRA 3AVYA 2JASA 1HV8A 3KTAB 1CEEA 2MSEB 4JL5A 3R7WB 4LHWA 3V9PA 1DVRA 4MQBA 4IHQA 5KDDA 1NMYA 1OIXA 5FBQB 2HYDA 2REBA 2IA5A 1SQ5A 1SHKA 3IHLA 4R2HA 5L3SB 1FNMA 3KQUA 3A8TA 2R8RA 2WKPA 4E07A 4EPWA 3QF4B 3X1XA 2RGCA 4OQFA 1VCIA 4DUGA 4IDOA 5CYPA 3TBKA 2ODWA 3SJBA 3D7MA 1BO6A 4KJZA 1Z6TA 4OI2A 3WRXC 4ARZB 4XWAA 3QXXA 4PO1A 5FOTA 2FU5C 1VYTA 2VF8A 2GK7A 2ZUDA 3U44A 1OH7A 3PIRA 3QE0A 4DSOA 1SKQA 3EW9A 3W3AA 3Q72A 4RD2A 3SYKA 5EE0A 4DLSA 4E03A 1GG2A 4A0GA 1U8YA 3H84A 1U98A 1X1SA 3WBJA 1G4UR 1FMJA 1XCGB 1KSJA 3U6KA 1D9XA 3ZVLA 1BH2A 1ELOA 1R5OA 4LV6A 5F98A 4A8JC 2D4HA 3AQ4A 1JQJC 5J4HA 4BGDA 2CNWD 1WBBA 4YXWD 5DN6D 3RS2A 4JLNA 2F1RA 4K46A 5CB6A 2HJVA 4OQNA 5EP4A 3WNDA 1AKEA 1XD2B 4ZCMA 1U99A 3ND8A 3MSXA 4URVR 3UMRA 4G5SA 5CM9C 4DDTA 4OHZA 3SFVA 3LBIA 3PEVA 1R0WA 1IXRC 5SZKB 2X19A 2G3YA 4DEXA 3U4QA 3P27A 2IF2A 1L8QA 1UBGA 1KGDA 1N5IA 2HF9A 4LHXA 1KMHB 2VP2A 4KV9A 2OEPA 5F2EA 4DT1B 2FSFA 2H18A 1E1RA 1XNJA 2ZEJA 3ECCA 2OG2A 4IFEA 2V8OA 3TR0A 3KXIA 5JSZB 1XDBA 1C1YA 1SVLA 2ZI7A 3FE2A 1Q44A 2C77A 3QVVA 4FI3C 1J99A 2PH1A 2QA5A 2REXB 1G18A 1ETUA 3PV0A 5B57C 1W0JD 3PEYA 3QKRB 4KSCA 5BW8A 2ZRBA 4A6XA 1KO1A 1C9KA 2ZSBA 3KQLA 4LV8B 4F92B 2IYQA 4B74A 5SZHB 3MG9A 3ZZUA 1P72A 2CHQA 4DEYA 1QHHA 5C4MA 1Y3AA 2VA8A 2VP6A 1GRRA 2FMXA 3MCAA 1UDXA 3DKPA 3QKSA 2WVJA 3N5CA 4DCSA 1E2MA 3ZZ0A 1Z22A 2ZYUX 1NIPA 3QXHA 3SFZA 4JVSB 5FL7D 3U6BA 2I1QA 3TK1A 4Q4JA 2IXFA 1IN4A 5EE1A 3WMGA 1OF1A 5K8LA 3WXMA 4R2IA 1IY1A 1OKKD 2R6GA 3UATA 3PEUA 5BQ5A 1Q1QA 4JVMA 2W6JA 2GBLA 2ZITA 2CLCX 2O0KA 2ASEA 4LYAA 5EP2A 1FNNA 4HLDA 2ZR0A 5JHHB 3OIUA 3BFVA 1G8FA 4Q18A 4R7ZA 4OQMA 3I4LA 1M1YE 3FMIA 1WB9A 2IX3A 4URXR 1GL7A 1KAOA 5GJBA 4YMTA 4FW9A 2W2VA 5AJXA 5DIFA 1R10A 4H1UA 3C16C 2BMEA 4TL9A 4N0EA 4DLUA 2DFLA 3B1YA 3QEOA 4X8MA 4TLDA 1HTWA 1KZGB 1Q12A 4F4IA 5FH9A 2GXAA 5LB2A 4TWZA 1LF5A 2CL7X 2GNOA 2GCPA 2OFOA 2VP4A 1CR1A 3SZRA 2OM2A 2H57A 2A30A 3K0AB 3BB3A 4OJQA 4CT4B 3NH6A 2XITA 3CPHA 1E2QA 4QXAA 3CKLA 4C7OA 3TSZA 2GCOA 1VYUA 4ZPXA 1SULA 4G1UC 4NYIQ 3ASZA 2NZ8A 3PFIA 1TADA 2GZAA 4LPSA 2R44A 3MWYW 2WTUA 2XZLA 1XCMA 1F2TA 3DOEA 1U9IA 1Q0UA 2PX0A 2G0TA 2J7PD 3NKVA 5M04A 1TUIA 1H8HA 2UZIR 2ZSEA 2B8TA 2IS2A 3KDSE 4BEBA 3K53A 4OHXA 3NTUA 1P7CA 3OFND 4C0KA 4QC2A 4JS0A 4OI4A 4DWJA 1DAKA 2B7CA 2VQSA 5HPYB 1NN0A 4RKEA 3UMSA 2FV8A 1ODFA 1RFLA 2I1VB 3GFTA 2CDNA 1COWD 2R6AA 2ZI4A 4HI0E 1X3SA 3NG1A 3CRVA 2PMKA 4IRUB 4XWOA 1E2EA 2XNDD 1KY2A 2FSGA 3HJNA 1GAJA 3CNNA 4C4PA 1K5GA 4RD4A 4B71A 2BCGY 1KI1A 2X2FA 4M1SA 3I1FA 4GPTA 2ZI9A 2G1JA 3T1QA 1P60A 2CJWB 1KDRA 5EZ5A 4NL4H 3EPJA 2RCNA 4AC9A 3TKLA 3AH8A 4PO9A 3GJ8A 4Q4AA 1CBUA 3QQ5A 1SKYB 1QHSA 2AR7A 1W48A 4H1VA 1LTQA 2ZUBA 5E4FA 3DMNA 1L4YA 2ZSAA 4HB3A 4AIIA 5EZ6B 5CK5A 4JKYA 1YRAA 5AJWA 2W0SA 4HDQB 1G3MA 3BRWD 4PZYA 2UVQA 1JXOA 3WHKA 2QTFA 3KXKA 3PEWA 4FMDF 2QM8A 1LFDB 4X8HA 4Q21A 3UMFA 2BBWA 1II8A 2ZROA 2WWHA 2IWHA 5AJVB 4YMSA 1VHLA 4IEIA 1ZRHA 5KPDA 3NWJA 2VIIA 3THYA 3K0FB 3CRRA 2BOVA 3EZ6A 1OYWA 1P2TA 3ONWA 4LJ5A 1Z6GA 1EX7A 3TUIC 3FKSA 1T5IA 1RIFA 1NY6A 2IHBA 4JBWA 3RRMA 3OIWA 1ZU5A 3NC1C 1G8YA 4A0RA 3LW8A 1D5CA 4NTZA 3M4YA 4S2EA 2J0VA 2QMUA 3IPYA 3O8RA 1OIWA 2IXEA 2AKYA 1XPRA 1AZTA 4B2PA 1D8TA 1Z0FA 3NVAA 4QG7A 3O47A 2Q0HA 2O8BA 2PEZA 4DZZA 1PUIA 3S1AB 5CJPA 4ZCIA 1FTNA 5DYGA 1U0LA 2QORA 2AFHE 2XB2A 4WZBE 5FR1A 3IIJA 2AD5A 4O2LA 1JECA 2EQBA 4FMCB 3X1ZA 3LVRE 4PHGA 1VPLA 3A1UA 4HATA 1V5WA 2FGJA 5L3QA 2Q9BA 3EC1A 3FTQA 4KHZA 5H8WA 3VR6A 3GCGA 1E2JA 3EWAA 4CRWB 4P4SA 4KO8A 4XH9B 1NF3A 2RGBA 2VLIA 2JEOA 4Q4JB 3U7EB 3IEVA 4RZXA 2FPKA 1X8LA 1RZ3A 3MGCA 1VYVA 3OE7D 2QAJA 4Q48A 3QIAA 4CEJA 1PJRA 2ZRGA 4PC3A 2WMNB 3TLXA 1KYIA 4XVUA 1DPFA 1IN8A 1E79A 3B7GA 4FINA 2HXSA 2RHDA 4KLNA 2RH5A 4QGGA 3ADDA 1BMFA 2VHUA 3NBXX 2VHQA 4IW3B 2O8EB 4TTQA 1P3JA 1EFTA 1Z83A 2QP9X 4EIWA 4EQ6B 1G3RA 1KY3A 4RFVA 4YDHB 3I5YA 2QAGC 1W36D 2OZEA 4BRWA 4BWYA 2R65A 1G1MA 2QL6A 4MDEA 3ZS8A 2XNSA 1E2FA 1KJWA 1AS0A 3LLUA 3CF2A 5H68A 1W36C 4UKDA 4US1R 2DWOA 1KTVA 4QBIA 3ZYCA 5KU1A 3AVUA 3DM5A 2ORIA 2P5SA 5IDVA 4LJYA 4US0R 4HUTA 4BASA 1DELA 1H8ED 2C99A 1XXHB 5B30A 4HAWA 1ZNZA 4M21A 2UKDA 3FYHA 1GKYA 4PO8A 3TE6A 3GLFA 1QBKC 1N5KA 1ZD9A 3TSOA 1KI8A 4ASUD 2C96A 1OXTA 3DO6A 5AK0A 2GCNA 1F48A 4HLUA 4AD8A 1KKLA 1WA5A 2ATVA 4GRAA 1R8QA 4CIDA 1ZNXA 4JLMA 3R8FA 4EAQA 3QPVA 1OH6A 1NBMA 2IC5A 3HU1A 3VR2A 2AHOA 2OAQ1 3AKEA 3K0CC 2QNRA 5JLJA 4JKIA 4D4KA 1XF9A 1RE0A 1KDPA 2QI9C 5JJLA 5AWFC 2PZFA 3I5XA 4ZIRA 3KJGA 4V0NA 1GNPA 3SU8A 3KKMA 1ZBDA 4YLGA 3HU3A 4L9WA 3V4FA 4TZ0A 5L3VA 1LW7A 5TV2A 4QGAA 4DB2A 1S96A 4DLVA 3BD9A 5AUPB 5JS8A 2CL0X 4N0DA 2BCJQ 4B33A 1R4AA 4V02A 1SVMA 5JI3E 1BIFA 3VMFA 4C0AC 3K70D 3NHBA 3LNCA 4C0LA 1SXJD 1WBDA 1U0JA 3W9YA 4D0GA 1Q20A 5HCIA 3THXA 1MKYA 5KYKA 3SR0A 1XP8A 1SXJC 1Q57A 2ZQ5A 2GAAA 1IY0A 4A4DA 4WBSA 4NYMQ 2ZJ2A 4IVQA 4Z54A 1FMLA 5FBLB 5JWOA 4NCIA 1Q3TA 1S1CA 1IXSB 1G7TA 2CVFA 3WHLA 1Z8FA 1OXSC 1JBKA 5JMTA 1FPMA 3GPLA 3ADKA 4TQUS 1OFTA 1GM5A 3GLFE 4LYHA 1GILA 5KO2A 1IHUA 5AR1A 1E9EA 2IUTA 3DVLA 3U61B 1NLFA 2PLFA 2WSSA 3IBGA 4UNSA 2FEOA 1VIAA 3WMEA 3SYNA 4ACAA 1GDDA 2XOKA 1NBME 1T5LA 1J8MF 1XTRA 3KTAA 4KVGA 2E9SA 1G17A 2YV5A 5IF9A 3R7WA 5DO9A 2ZREA 3PCRB 5GJVC 1X1RA 2PT7A 4PPNA 3ZVRA 4RD0A 5L3SA 3A4LA 1LNZA 4BZXA 1XJCA 5G41A 2ZS8A 3KJHA 1A82A 3QF4A 4Q47A 4P4UA 2P0EA 5CYOA 4LBZA 4KYIB 1RRGA 4FCTA 4B2IA 4B3CA 1JI0A 1AM4D 4NCHA 4XTRA 3V00A 1XRJA 4ARZA 2ZE7A 4MYUA 4BLOA 5HZKA 4P33A 4LBVA 1RYHA 1E2NA 4RY2A 1CLUA 2XGJA 3A1WA 1JR6A 3MWKA 3W5IA 1RW4A 2VL7A 4B32A 3QJYA 1RPZA 4QGHA 4DLZA 3TVDA 2AKAB 2OXCA 5JRJA 2PJRA 3L0SA 2OFWA 3KXLA 5E7IA 2VO1A 3C5CA 4LJ9A 3JVVA 3CUEF 1TX4B 2ZRPA 3O8CA 3WBKA 2G1KA 1ZCBA 3C8UA 2IEYA 4DLTA 3KUCA 1WP9A 1AIPA 1UEJA 4JVNA 4LI0A 5JWHA 1A4RA 1UKZA 1ZVQA 1UF9A 3A4NA 3B9PA 5BN4A 2JGNA 1XTSA 2VHTA 4YC7A 1GWNA 3N2IA 5L3QB 4ZCLA 2DR3A 3BIFA 4GMDA 4Q7JB 1XD2A 3X1DA 2GZDA 4TYYA 1G5TA 4C0QC 4DCTA 2D2EA 4ZDIA 4Q9JA 2BC9A 2VRWA 4D26A 1OH8A 4MITA 3D31A 2ZS9A 2XSZA 3AUXA 1ZMXA 4LYFA 2IYXA 5FOUA 3CF0A 4DT1A 1OHHD 1KMHA 3NDPA 1ZINA 4M53A 1G8HA 4HZUA 1P5ZB 5JSZA 3E5HA 1ZM4A 3AVOA 4JL6A 4YMVA 4LDJA 1CF4A 3FHOA 1YU9A 1NN5A 4WZAE 2GKSA 1LY1A 2YHSA 2F1IA 4LWZA 3QKRA 2N42A 2IUSA 1K6MA 4HEJA 3T1TA 1E9AA 1E69A 5JJIA 3SS8A 4MH0R 1E98A 3TH5A 2OBNA 4M1KA 4PANA 1YR6A 4DDVA 2JDIA 1YZKA 1YZGA 4OK6A 5DGXA 5E3HA 1HQCA 3CWQA 3B2EA 2KWIA 2VSFA 1N6OA 1QVRA 4HAYA 4A8JB 1HE8B 2A78A 2ZRLA 5KSOA 3QY0A 1G6HA 3FB4A 2FX3A 3VR3A 1ESMA 1MO6A 1QG2A 2Z43A 2QGZA 1OB5A 2FH5B 3LO5A 1JR3A 3RC3A 2IYZA 1AGPA 3W8RA 4NP6A 1R0XA 4M9SA 3VKHA 1LF0A 3J81k 4MGIR 4OK5A 1FUUA 2BKEA 2C98A 3GFPA 2GZHA 4PQYA 1TEXA 5LPNA 3GMTA 2BHRA 5DI9A 2P6UA 3TAUA 4M22A 1VCNA 4TLEA 2VSXA 4KFUA 2C78A 3AP2A 1ZUIA 4IDPA 4ERNA 3ETLA 3RS4A 2WPDA 3IPXA 5FUXA 2CK3D 2ZRKA 3LVQE 3AVXA 4IDNA 2CLDX 5P21A 2IXGA 3ND9A 2BKUA 1F6BA 1NVUQ 3AP3A 1N5LA 2JIZA 2Z4SA 1JPNA 3W8NA 3CH4B 1JXMA 4G5QA 2BJWA 2GF0A 3RLFA 5FOVA 3K0AA 3RRNA 421PA 1P6XA 4BLPA 1IONA 1YZNA 1IJFA 2FNAA 4DKXA 5FTJA 5CB8A 4Z1MA 1DARA 1Z08A 2F55A 3RDPA 4BFYA 4A36A 2GRJA 3OEEA 4WA7A 4QM6A 1E0AA 3SJAA 4DCUA 4TZ6A 1CULC 1NIJA 1SZPA 4QHYA 3WYFA 4QOSA 1Z29A 4RVCA 1O3YA 1S4QA 1XEFA 2QQ0A 4R98A 1E2HA 1GSIA 2FJUA 3ADCA 3JZAA 1W5TA 4X8OA 1I4TD 4LYJA 1UKEA 2R6CA 4DC9A 2KSQA 4PR0A 1S2MA 1CXZA 3TNFA 1MO5A 1QZXA 4MKGA 1JR3E 4ZI3A 4IOKA 3AKDA 2ZAOA 3AKYA 4AKGA 5IHPA 4LPKA 5H1YA 3M6AA 3SN6A 3IO5A 2PEYA 4J0QA 1UEIA 5B2ZA 1EFCA 3UXMA 3DOFA 1KDOA 1L4UA 2X2EA 3KZ1E 5DHAA 4KLZA 1XTJA 2XTMA 2EWVA 4IEEA 5TDHA 3RSLA 4WAUA 8OHMA 3THOA 2XTNA 2IYSA 1MR3F 1V43A 3ZIAA 4KAXA 4TSFD 2RHMA 1Z0KA 2AN9A 2CJWA 2QE7D 5HCNA 1KAGA 3B82A 3R9IA 3GLIB 4CEHA 2FSIA 3BGWA 1OE0A 4MRVA 1BYUA 4B48A 2A5GA 2VEDA 5GJWC 2CHVA 3DPUA 2J46A 1UBEA 3L0OA 4JL8A 3SOPA 3EPLA 2XAUA 1Z3IX 1XMIA 4OKSA 2F1HA 3GEHA 1XMSA 2ODBA 2CCJA 4TT3D 2YKGA 5FOXA 1E9CA 5B58C 5LDDC 2XB4A 4C3ZA 4PSVA 4FXPA 2DWQA 5D3QA 1LS6A 2V6IA 4AYTA 3LBHA 1TNDA 1GKIA 1T8TA 2QRZA 3GP8A 3VNVA 4L9SA 4JBYA 2RAPA 2XXAB 3ZVMA 4QL3A 1NN1A 3KQNA 2CE2X 2HDNB 2YWGA 1M6NA 2Q6TA 3OEHD 2J45A 2NOAA 5FI0B 2P5TB 2XTZA 3HR8A 3K09A 4MYHA 3EG5A 4Q1AA 1F5NA 4EUNA 5UKDA 3QEJA 3K0FA 4V0OA 2QT1A 2HCBA 3NBYC 2V1UA 1W4BA 1UDWA 2OSBA 4CEIA 2HCJB 2LKDA 4Q4HB 2JLQA 1ANKA 4BFXA 4MGZR 1NJGA 5SZJA 3QSYA 3PVSA 1W0KD 4EPTA 3K1JA 4U5XA 1Z0AA 2WHXA 3EX7C 1M8PA 1P9WA 1T91A 3IILA 1GOTA 5E7MA 4HZUB 2YWFA 1G9XA 4XD7D 1DG3A 4DSUA 3QVUA 1OH5A 2JJ1D 1CTQA 4JVLA 3AF4A 3S1AA 3ZLJA 2QENA 2AK3A 4KCGA 4C2TA 2H7VA 1ZC4A 5HE8A 4URUR 5G40A 4PPGA 3BJIC 4CF7A 3SI7A 3ZQ6A 4A0FA 1SKYE 3AKCA 5CK4A 1OJLA 5B64A 2RGNA 2ONJA 2GESA 1JB1A 4UNQA 2A9KA 4GP7A 1P9RA 3B1WA 2GJKA 4JLKA 1EFRD 3IIKA 3U3RA 3U3JA 2YWHA 5FOSA 1G4AE 2ZPTX 5DYIA 1N6KA 1J70A 2ZXUA 2AX4A 3KQKA 4M1OA 3LD9A 3AF1A 4MYCA 1OV4A 3RRZA 4EKDA 1T0HB 3LX8A 4GOXA 4KI0A 4PXAA 5KSPA 3EZ2A 2Q3FA 4TLAA 1JAHA 3TJZA 3R20A 5FPHA 5AJYA 5H70A 1UAAA 1XZPA 2D7DA 1YR9A 2WKRA 2I3BA 3GJ3A 3TUJC 4IXMA 4URWR 1TPZA 2N46A 2QMHA 1TMKA 4JLDA 5SZIA 2OILA 3RNLA 3KQHA 2O8EA 2J0QA 2ZJBA 4M1TA 4V0LA 4EQ6A 1MABB 2WM9B 1TQDA 3LQRA 4IJMA 4PC7A 4OJKA 1U90A 5BN3A 4XVQA 4DXAA 4NE2A 4NCJA 2WWXA 1KSGA 1OSNA 4TN1A 3SBEA 1OW3B 1W4AA 4PZZA 2QEQA 3X1YA 2HT1A 1GIAA 3L2OB 1XXHA 4ESVA 2X1VA 2BWJA 5EE9A 5HKKD 4UXJA 1CU1A 2GXSA 4F38A 4L8GA 3UK6A 1E99A 1G5RA 4P4TA 3Q8XB 1E1QA 2FF7A 2NZJA 2QT0A 3P4XA 4UXIA 3RVBA 2QM7A 1HT1E 4AK9A 1OXXK 5FUWA 2DFTA 3FWYA 4QFMA 4A82A 4BFZA 4KSBA 2HXYA 1G3IA 4TMKA 1Z6YA 1XFAA 1OXUA 1ZUNB 1I4LD 3BOSA 4FMCF 1YR7A 3REGA 3AVQA 3U3OA 4QBFA 5DI3B 3U5ZB 2WJVA 1ZU4A 2KB0A 3BBPA 1W1WA 3K9HA 1X6VA 3VR5A 4WZ6A 2KBEA 1T6NA 3BB1A 1VMAA 2DB3A 1W2HA 2ZI3A 4FMBB 1N6LA 4JJKA 2ZJ5A 3C14C 2G6BA 1VIYA 2RGAA 2XZPA 1AS3A 1ZJ6A 2EFGA 2QAGB 2QZ4A 1M34E 2O8FB 1YJ5A 2G0NA 2IWRA 3PXGA 1AK2A 3EIQA 3RYTC 4DIEA 1WMSA 1HQYE 2ZRCA 1X8KA 3PUWA 2FFQA 5EXTA 3CPJB 2QP3A 4KU4A 1W36B 3FDIA 1Z6XA 1A2KC 3CNLA 2ERXA 4LC0A 1GL9B 4P3YA 4CEHB 1S0UA 3UPUA 3AVWA 1FFHA 1YR8A 4RD1A 4I1SA 5KDOA 2JCSA 2EYUA 4NZYA 4WIAA 1YHNA 3W6NA 4F91B 2D2FA 3HWSA 1AQUA 2L0XA 1XXHE 3BXZA 1IN7A 1JEEA 2V7QD 4XTCS 3QG1A 4BRUA 2GK6A 3F8TA 1UADA 1XEWY 2P67A 4IOJA 4KODA 5CLQA 4G0NA 2J7KA 3V4RA 4QBHA 2V6JA 4NMMA 1T3LA 4GMXA 3MRSA 2FG5A 5BN5A 4PPFA 3K9LA 1E94E 3B8HA 3PUVA 4GFDA 4XIGS 3AV0B 2FFHA 1TQ6A 3TQFA 1KO8A 3BORA 5JBQA 1QHIA 1W46A 1XTIA 1NSTA 4KFRA 1G19A 3BB4A 4LY6A 2YC4C 1E2GA 1VKJA 3SQXA 3U60B 2ZE5A 4M9QA 3BFKA 3NXSA 4BLRA 2OBMA 1HA3A 4I1UA 4POAA 4LV5B 1UFQA 5FBRB 4CEIB 3L8ZA 4PHHA 1D9ZA 1KNQA 1CRQA 3W90A 5KHOC 1Z0DA 4Q1FA 3K8YA 3QG5A 3SHWA 2IUUA 4Q02A 3D3QA 1T0JB 1ZM2A 3L82B 1Z5ZA 5JI2E 1OFUX 2SHKA 5J5CA 5LD2C 4FIDA 4BE7B 2NO6A 3E70C 1SXJB 1QG4A 2JJ2D 4QNMA 3LDAA 1YRBA 4JLPA 3OIYA 2GJSA 3FMOB 1EX6A 3IHWA 3CZQA 3MFYA 3CX6A 4PZLA 3BC1A 3DDCA 4KVAA 5J40A 1HURA 2C9OA 2IYLD 4LBYA 3TAHA 4TYWA 3CNOA 1AA9A 2A5DA 2PZEA 5EJEA 5HE9A 3FPAA 2CL6X 3H0KA 5C18A 4G5RA 4YDSA 2DY1A 4LHVA 4B6FA 2ZJ8A 4PQRA 4ZO4A 3H1TA 1N5JA 2R6DA 4URYR 3SQWA 3BWDD 5JEDA 1R5BA 2YYZA 4CDGA 1BKDR 5JJKA 4TMWA 1AGRA 2JA1A 1DBSA 4M0LA 3SBDA 4FWIB 1NY5A 3T1OA 2EU8A 3VU9B 2OCPA 4RJLA 2GA8A 3QI2A 3IQWA 3FGNA 4M4SA 3W34A 4DSTA 4DSNA 4AKIA 1IN5A 3MJRA 1MRNA 4AURA 3CX8A 1NJFA 1AS2A 1CJTC 2WMOB 3GQBA 4FCWA 5DE3A 5F3WB 2AL7A 2OAP1 1MT0A 2DFKB 3HU2A 1CR4A 2NPFA 3JVUA 1IAQA 2BDTA 3LW7A 4TMVA 3CONA 2PL3A 4TSFA 3OF5A 4DLYA 3AP1A 1MRSA 3VQTA 2GVZC 2J9RA 2RGGA 2HJGA 2QE7A 3B1ZA 3K0SA 2B92A 4ZKEA 1G7RA 1XMVA 2Z6VA 2WBLC 4ZI2A 2HLDD 4JLOA 1UKYA 1EFHA 3FVQA 3FFBA 3RWMB 5AUNB 3B5JA 1DAIA 3AGQA 4EPYA 3T35A 4QHSA 3VAAA 3CRQA 3AB3A 3EIEA 1II9A 2ZRIA 5KNCA 1N3BA 1NLYA 1NSFA 2DBYA 1XZQA 1NRJB 1XEWX 1YKSA 2FPMA 2J3EA 4A8JA 2CXXA 1OT3A 4L15A 3SYLA 2FA9A 1Z0JA 4TLBA 1KI9A 4PC2A 2CNWA 2QTHA 4LCBA 1N2CE 1W4RA 4N3NA 5DN6A 4YXWA 4MUAA 2D62A 3GJ4A 2YINC 4IOMA 1FP7A 2GJAA 4WXPA 4JSYA 2ZIAA 4DUGD 3ZD6A 2RMKA 4MA4A 5FI1B 2WJYA 4NYIR 4QM7A 2XZOA 2OCYC 2ORWA 4WW0A 1E9FA 1ONBA 4LJ8A 2YOHA 3W5JA 4LJ7A 4M9XA 3QXSA 3CBQA 4KITB 3ZDQA 2AK2A 3WNCA 2W83A 2CBZA 2GDJA 4EPVA 1VG9B 1WE2A 2O5VA 4Q7LA 2IYWA 4UNNA 5JFGA 4JIMA 2JJ8A 3HR7A 1TUEA 4DCNA 4R71A 1D2MA 5CLLA 3TGPA 4XD7A 4XWKA 2ZRMA 4LX0A 4AKEA 3ZQJA 2KJQA 2G77B 3SDZA 2ZR7A 4MRSA 3LRPA 1W0JA 1XEXB 2ZYTX 2QSZA 3A1VA 2WWFA 1XTQA 2J1LA 3C41J 4IDQA 5ANRB 1RC8A 1Z0IA 2BMJA 2FZ4A 4FD2A 3VKGA 2PCLA 2JLZA 2H92A 4XJXA 3SJCA 2YVUA 1FQKA 2J41A 4EJSB 4WOPA 4LJ4A 3CWZA 5G3ZA 5K8UA 1DAFA 3K70C 1EFRA 4TLCA 4A2PA 2JATA 1SVWA 2PJZA 4UXHA 5F9HA 5KTYA 1BYIA 3QBTA 4GZMA 2ZSDA 4AY2A 5JS7A 5C2JB 1U81A 4P32A 1UBCA 3Q9LA 2R2AA 3IQXA 5A4JA 1K8RA 2BBSA 4Q19A 5FL7A 5JCZA 4H9GA 1E32A 1KI2A 1AZSC 1SVKA 3A58B 1RKBA 3IBYA 4BFSA 1E1RD 2PX3A 2ZJOA 4RSGA 1OKKA 3TUZC 4BUJA 1KI3A 5JCPA 1OPXA 3P4YA 4MUBA 2OE2A 5TY0A 1JJ7A 1FW6A 2MMGA 2A5JA 3I61A 4EFNA 2ODNA 3LV8A 4MDFA 1UM8A 2NQ2C 4ZV4A 1OIVA 1N0VC 1CKEA 2WIBA 3I8XA 4EFMA 5FTLA 1F2UB 4I1OA 4RZ3A 1S3SA 2QPOA 4TMZA 3B60A 3EA5A 1PUJA 1TEVA 3VX3A 3W3ZB 4YQFA 5J4LA 2WJGA 3CO5A 1VCMA 2F3RA 3PENA 4F4CA 5F9FA 4NYJQ 4B44A 4B75A 3KKNA 3TQCA 4Q5IA 4AG6A 5AUOB 4WVFA 3GLIA 3IIMA 3WY9A 1QHYA 4MRRA 3WYAA 4D6PA 3EASA 1R5NA 1XMJA 5TB5A 5JHGB 2FEMA 4F4JA 1E9RA 2JLYA 3D8BA 5HKKA 2H16A 3C5HA 4V0KA 2ZVPX
chains in the Genus database with same CATH superfamily
1RM0A 4ZOBA 3EGXB 3FJOA 2R8ZA 2J33A 3M8KA 4QATA 3P94A 3QE3A 4X92A 1R8YA 3NGLA 3G2IA 3L05A 1A5TA 3E7XA 4XGQA 3V4VB 1I1QB 4E7OA 1NBAA 5AW2A 2JFXA 4H4CA 3PEEA 2J7PA 3EUWA 3BRSA 2GBLC 1MEEA 2Z3VA 2AOVA 2GOYA 3R0IA 4GVPA 3R8CA 3CRZA 3R7SA 3HXKA 2ZDGA 1LUAA 1DXQA 9LDTA 5L4LA 3E15A 5KWIA 4D9CA 1SPBS 4FCVA 5CD1A 4GNKA 1PJLA 3RAPR 1C0EA 1D6SA 1TF5A 1XU7A 4KBYA 4MUYA 3S2SA 3WOHA 4OLBA 1IY2A 2I2AA 1DMRA 1KDYA 3BDAA 1JHVA 3ZU6A 1FX1A 5J3JA 2WWIA 2ZWVA 3RAJA 1ZGGA 1COWA 3BK2A 3EZGA 4Q4HA 2IH4A 1OXVA 4PZCA 3BXHA 1F4PA 4HRXA 1WO8A 5C8DA 3WK4A 4FLEA 5EXPA 1EDBA 4FYYA 1Y1SA 3CZMA 3MMPA 3O8OB 1GGKA 4OO3A 3R40A 3KCQA 3U19A 3JR7A 4YXWA 3GK3A 2ATXA 3GDFA 3U7JA 1P0QA 4R81A 2DSTA 3HEBA 2BZGA 4D7AA 3P2IA 4IIHA 1THTA 3OLXA 5D8DA 1S2NA 1W49A 4YAFA 4AN0A 4EP1A 1HNNA 2GO1A 3HRIA 4J07A 1PV4A 2AQIA 3NNNA 1G7CA 3KSMA 2ZSHA 1KQOA 3UAOA 3W8DA 2GSDA 2Z2JA 4RV5A 1ORTA 1Z6QA 4JLJA 5I7VA 2WZDA 3BQMB 3UK2A 3OFJA 4KEAA 2OHFA 3WJ1A 3WMFA 4A73A 1RXVA 1ZNYA 3ZZNA 2ZBPA 3G17A 2IJGX 4KIWA 5LXTF 4V39A 3EPKA 3ZGOA 3BRWA 4IH1A 1IPEA 4E11A 3AKZA 3JD3A 2JVJA 2FW7A 3R2JA 1XC7A 1QTNA 1E0SA 1QYXA 3IS3A 3OU7A 3HYNA 5AVYA 1MV8A 1UDRA 1VE7A 3U3KA 3ICEA 3PCXA 221PA 2ONKA 1RM3A 1YD7A 3OZCA 3QMPA 4JSTA 3TR6A 3ZDEA 1L5VA 4BCBA 1M5RA 2OZPA 5EP3A 2V7BA 4ON9A 4CM4A 4W1PA 2UUOA 5IAEA 2BUAA 1LVGA 4HEA6 1W19A 4A92A 5HM8A 1Z4IA 4JFAA 3TQOA 4HQKA 3AI1A 1PZMA 1E2IA 1JL3A 1NC3A 1Q7TA 1X1TA 1XP5A 2CHFA 4JELA 4REQB 4UJ3A 2D00A 4EB6B 2FPGB 3CLTC 3KEQA 3MUOA 2O1SA 4OA8A 1W0CA 2E48A 3ML1A 2C2GA 3DEHA 4GF5A 1GZDA 5DHFA 4F12A 4MRNA 5DLPA 1L8LA 5IW8A 2G36A 3D6HA 2QP4A 2IDMA 3EA4A 1MAUA 4LOIA 5J47A 4BKQA 1CG6A 4L75A 4R84A 1O2DA 1LDBA 5HBGA 1OZAA 1XFDA 2ID4A 4TL7A 3TZQA 4ZAFA 1PU2A 2R2GA 1H0SA 3IRVA 1NJ1A 4XUGB 1NL3A 3D8NA 2V58A 3ORFA 5E1BA 1P3DA 3F0TA 4J9VA 3HWWA 4PICA 2K6GA 1S3FA 1MOZA 3MFQA 3IMFA 3K9QO 3ZE7A 3EB9A 3GLGB 4JI2B 1H65A 3I9LA 2B8WA 1XF1A 3KB1A 4G1VA 3O4IA 5A7FA 3FDZB 4HSGA 3I6IA 2P6RA 3DKVA 3MPOA 2XUFA 3ZVNA 2VH2A 4R69A 1RYBA 1SFRA 3EARA 1MOSA 3WJAA 4X94A 3BKXA 4M60A 4RA6B 2NO1A 1LPBB 1T4DA 4P22A 1SOUA 4RPJA 3P32A 5L8VA 4J4TA 5DM0A 4AICA 5L7WA 3HP7A 3JTEA 2F43B 2B6HA 2X4GA 1I3NA 1WUJS 4G5OA 4LVUA 5AW4A 2QGNA 5DI3A 2C2XA 1M2JA 5K2MA 2HJRA 5AKGA 2JCVA 4QEKA 1QMGA 3PKZA 3E3NA 1YBAA 4EVRA 4TXHA 1CLEA 1TW2A 1QR6A 1KJYA 2OQIA 3WV5A 4M54A 3M0EA 4XSGA 5B7NA 4KQXA 3U37A 3ZCTA 4MP8A 1HR0B 1U28C 3NVKI 4L28A 4Y6LA 1P1IA 2QAGA 1ISJA 1PNRA 4CKWA 4GZ5A 1UXHA 1I1HA 1NVKA 2ZSFA 1Y6QA 4PX5A 2AYXA 4BNXA 3TSAA 1CIJA 3I4FA 2DZDA 4AN1A 3V1UA 4O2BF 1QS0A 1HUQA 2OVBA 3WZLA 4D0LB 3EULA 4C5CA 2ID8A 2PRYA 5C1DA 3H17A 5DN9A 4FE3A 3R74A 2PMDA 2P77A 3SWWA 3R5TA 5LQMA 2BI7A 1L5WA 5IBPA 3T0GA 3Q1KA 2GLXA 4OQEA 5DHPA 5KYWB 5AM2A 4E5MA 2A6PA 2QY9A 4L2IB 4I6JA 4NYJR 2VPXA 2SBTA 3AOEA 3PTLA 3QM1A 4QOFA 5J4YA 5EE3A 4QD3A 1I13A 1UH5A 3FZNA 4JI8B 3GEEA 3GH1A 3SNKA 3RR2A 3FPSA 6LDHA 4TLMB 2DE0X 4LTNA 4FCCA 1AOXA 3K0CA 3EYWA 4S04A 3HY3A 4X7BA 3K5PA 2RB4A 3G82C 4MHSA 4KK3A 1KU0A 2HQBA 3PIDA 4GQAA 3UKOA 3I32A 4G0UA 1GU0A 5JDCC 3C7AA 1BMFD 3O4VA 1US8A 3AB7A 1T0PA 4TXMA 4DPMA 5JNTA 1ZXXA 1IVNA 1BGWA 1S2IA 2ZRQA 4OMDA 4P31A 2GB4A 2PZKA 4YRPA 2FPIB 3UWOA 9MHTA 4BLQA 2P90A 3GFFA 2WSBA 4JU8A 4PZPA 1YAHA 4EG8A 4QHTA 4AI6A 1MW9X 1W30A 1ZCZA 3S81A 1G20B 2ZQZA 4F9FA 4QU0A 2B1JA 2RCYA 4Z1OA 3OZVA 3R4CA 4RX1A 3GO4A 4XA8A 3WIBA 4MUNA 4KQ2A 2DMRA 2F48A 2EARA 5HWSA 1NAIA 2EFEB 3K15A 1V4VA 2FWRA 1PEKE 4Z9AA 1DLIA 4LUCA 2UZ4A 1XPJA 2V7EA 2YW9A 3M1YA 3E1SA 4PQFA 3D8UA 3TW4A 2QBYB 2WF9A 4HNVA 1QHXA 4BRSA 4JP8A 3HJTA 3A1DA 3U4IA 4Z7OB 3ZGNA 1NMEA 1U9CA 2KPOA 3A6LA 4TX1A 1NNUA 4RVUA 1URPA 3KKPA 3Q0IA 2VQ3A 2XCRB 3JQ7B 4WSOA 4GL2A 4ESHA 3QWIA 4HLUC 1JIKA 4IJWA 3VR2D 1A9SA 3CO0S 2F6RA 2NXJA 1ZD1A 2WJZB 2W00A 5EXXA 3RS5A 1QVZA 3FPCA 4ZMRA 3H16A 2OSVA 1M8KA 4P0PB 3H2IA 3E84A 1O96B 2VTKA 4TL6A 2PKXA 2GLUA 2KM1A 2XPCA 1BKSB 1E64A 2X14A 3QGMA 1PVDA 1FU4A 1T1IA 2ORVA 2AG8A 2X76A 3PGKA 5LMUB 3NAMA 5DDIP 2JK1A 3PQFA 2AXNA 4LMAA 2PL9A 2VDWB 3OY2A 1HT3A 4CM1A 1RLMA 1YZHA 3K2QA 4MR9B 2HUPA 2HEIA 3VR1A 3ITKA 1SHTX 3V1MA 1FJXA 1IQPA 1Z12A 2VXYA 4Q03A 3MILA 4XEUA 2ZJAA 2I7VA 1BJKA 3V97A 3RYFA 3CURA 1DLJA 1DCTA 3FZYA 3LY8A 4PG4A 5LUAA 2DFPA 2XMCA 3GEIA 3AOGA 1IYZA 3PHJA 3QOFA 4QBTA 3TWOA 1Q1EA 3I8SA 3CZRA 2Z56A 3SQMA 2GWHA 4Z7NB 5DB4A 4CETA 2QD3A 2HA0A 4FNGA 4E21A 1JG3A 4GM1A 2VDLB 5EMKA 5GVRA 3T0IA 4DQUA 2MYTA 1YQTA 4IDFA 3ZWPA 4GX5A 3SQDA 1RVV1 4X97A 2WTAA 3M6FA 4G67A 4E1BA 5LD2B 1TMYA 3L6CA 2VHCA 3D1LA 1D2EA 1VCOA 3CRW1 3MT7A 4MP3A 3WNZA 1K8YB 4Z0HO 3GHHA 5I9TA 4XSVA 3PHHA 4JT9A 1E9VA 4A9AA 4GMKA 2OCDA 3S2YA 2IYTA 4MVJA 4HDNA 3WYEA 4YGXB 3P9PA 4YO8A 2VZ9A 4YMWA 2GCIA 1UBKS 1GPLA 4OQQA 3WK7A 1Y1PA 2V3VA 2WSSD 3H2YA 5TSDA 4O59O 4TWIA 2Y1LA 2EG5A 3OUZA 1DAMA 4WTOA 1PDVA 2Z6QA 2GEUA 2WNHA 4LRQA 2PT5A 2WNIA 3FETA 3BIOA 2AS0A 5MGNA 3IOCA 2CCKA 4RHUA 2P65A 3G7SA 3AESA 4JLBA 1JF8A 3C8MA 5CVDA 1LGYA 1WVGA 4NHOA 2NP6A 1XDGA 5DNWA 3CTMA 1Q1ZA 2G4CA 1JAIA 1U0SY 4RHCA 2WAXA 8ATCA 1B7GO 2P69A 2HGZA 3NH9A 4KMOA 4KSYA 2OD7A 2PRJA 2VCEA 3RIHA 1T6ZA 3GC6A 3ZLVA 4E5YA 2IU3A 4M38A 1A88A 3T34A 4M1EA 3PYLA 3ZWXA 1FIUA 5EZQA 2DPHA 2PSFA 4CM8A 4I50F 4AZTA 4F46A 1A04A 1FXUA 1O94D 4UQOA 5ER9A 4BL5A 5EUQB 2JFQA 3HABA 1U5BA 3ZWVA 3D5EA 1UBNA 2FI1A 5DSZA 4MVJP 3AVTA 3CX7A 1FL9A 1KL7A 3MMSA 3SF8B 3PDHA 4DFDA 2PGJA 3ZX4A 2DVMA 1RI4A 4PRLA 3R3XA 4DA8A 1OHHA 3VNAA 2XUKA 4BVBA 1C1XA 1CFZA 2PIDA 4DEVA 3AJEA 3A05A 2LGJA 1GTSA 1XWIA 2NPOA 1W85A 2CXPA 3HKEA 5TQ2A 3HO6A 2VNJA 2YQ4A 2TMGA 2XMDA 2F7SA 5DWVA 4KPFC 2NX2A 5CBKA 4ALKA 3ZU3A 2PAFA 1D2CA 2LUOA 3PT9A 4MIKA 4X64B 2VNHA 4QUGA 1JGTA 5A4KA 3LBNA 4F85A 5IM4A 4D25A 1EM8A 4KBGA 1N6NA 4DA0A 1TTTA 3NQ41 4RLFA 2YIMA 1QO0D 4MVJE 4H6WA 2GEKA 2YVKA 3A7DA 1RAEA 1P44A 1UJCA 2AEMA 2QNBA 4JAVC 2CDRA 3T99A 2I9KA 3A9SA 5AI6A 4EJSA 4YHBA 1HZJA 2Q0QA 4YUVA 2BV3A 2AJCA 5FWXA 3RT9A 5TQ0B 4XE5A 3AERB 3F46A 3RIGA 1K0FA 3NNSA 3OHPA 1GDTA 5CHYA 2DHRA 3IBTA 2KW5A 1TVMA 1U4NA 3BPSA 1W47A 4UZFA 2YZ2A 2FETA 2I80A 3FWPA 2C9ZA 4P7FA 3WWCA 4XVCA 4RKFA 1DS6A 1ZH4A 3QVJA 1OC2A 3T7AA 3HJBA 4IHKA 5CCXA 2G04A 4QWMA 2OXFA 4R16A 5GJCA 4E5NA 3Q8WA 4F45A 4UOEA 5FLEX 4WLEA 3JARA 2EP7A 2Y4NA 1VSQA 3BH6A 4G23A 3WLLA 3ZXYA 3FVWA 3CN7A 2ZR9A 4Q00A 3R9XA 3KX2A 4C04A 4HPJB 3RU7A 1JEAA 3LUPA 1DAGA 1QYVA 5K3FA 3EFHA 3W0LB 2ZRHA 2W2LD 1ZSYA 3ABRB 5HTKA 2H8KA 3N76A 7ADHA 2FSHA 1NVXQ 4PNHA 3SF0A 1UT8A 1FX0B 4X00A 3B9QA 4EEXA 4EVSA 3ZDDA 3G9QA 2B98A 2CK3A 1SCQA 3G2QA 4DDMA 4DVGA 4UNRA 1RNLA 2XUPA 4Q15A 2B30A 4WBNA 3VR4A 2WT4A 3F7TA 5FPKA 1K88A 2NTJA 1FFAA 3KD3A 2O4CA 2BFMA 1ABFA 3PRYA 5B3AA 4TTRA 2R86A 1RI2A 2DSNA 4DBLC 2HN9A 5LBTA 1R6BX 1K4MA 1XBTA 2QW0X 3M1IA 2WRZA 2DH6A 3V33A 3ZR4B 2WAOA 2VXCA 3N8KA 4EPRA 1KI7A 3PL1A 4AXXA 4B6EA 1CS4C 2FN4A 2VTDA 1R3UA 5IXSA 3F2IA 3T12A 1NNLA 2EL7A 3KSAC 4ND7A 3ENZA 3EVNA 3QA9A 1DEKA 1T1EA 2XQFA 2CV2A 2UZ3A 3FF1A 5LR6A 4AZSA 1V3QE 1O0CA 4TUYA 1IWPB 3DZBA 4QASA 1N57A 4YMGA 3GRVA 4FOOA 2FRDA 1N2GA 2OV3A 4HDKB 2P9JA 1J8DA 1EGAA 1M1YB 3OWXA 2MHCA 1PR6A 4JGIA 2YMQA 4D9HA 5BR7A 3IPCA 1KWGA 2RAVA 2YZKA 2WPDD 1RYFA 3S55A 1MW8X 3Q7EA 1BDHA 3GVCA 5DRTA 2I6SA 3M81A 2XUAA 1N8KA 3KPJA 4MCJA 1P9LA 1V11B 4HGQA 4U7WA 5D2CA 2EZTA 1OFHA 1B0UA 1HBJA 1T9HA 2HK9A 2J32A 2Y0EA 1XHEA 3K9NA 4PTLA 1I94B 3K20A 5J4KA 4J0DA 4KREA 3IJRA 4FFBA 2KBFA 4BNMA 4KR2A 5M3BA 1Y48E 1RBZA 3V8EA 4AG5A 1DP4A 4KQJA 4BZPA 2VZ0A 4OHBA 4O2AF 2RKOA 5K3BA 4QYTA 4EY8A 4HB2A 5AJZA 1Z5UA 4AJIA 1GQYA 2JRLA 4BATA 1E5TA 4BVHA 5D3MA 4BZQA 2Q27A 2WWYA 5JZOA 2WM8A 4QQFA 1T3HA 3PJEA 1WRBA 4ZRMA 5LQDA 4NZZA 3OEED 3O9VA 5LBIA 3DL0A 2QTCA 2WAMA 4ITUA 1D4AA 1DAPA 3OX4A 1H2ZA 1XE3A 4GP6A 2DFVA 4DWOA 2JNWA 4H08A 1KI6A 2GF9A 5FPYA 4QOHA 3VJRA 5TQVA 2GJ9A 3U7GA 5EERA 5H3CA 4LJRA 2A0YA 2ONYA 3WGKA 2Q3MA 3HCEA 1T3TA 4XOIA 3PR1A 1UBSB 3FLAA 3RGGA 3HG7A 4AWAA 1F0KA 4PGAA 5C9ZA 1SB9A 5KU7A 3RIYA 1B43A 2VHZA 3BERA 1OAOA 2GVNA 3BFXA 2Z2YA 4BB5A 1ZQ9A 4R8MA 1WXIA 3HZOA 3EIWA 1WUIS 4JEMA 1E9BA 3PNLA 4Q3CA 4RPGA 3TR5A 3QHQA 4M88A 3HXLA 9GPBA 3W2TA 1VFNA 1IG0A 1C50A 4JEIA 3IVGA 4X6YA 4BV8A 4DV5B 5LP6A 2GPAA 2NT4A 3O74A 2FOLA 3TAXA 4DSAA 3RYHA 3NC0C 4IH4A 1UK6A 1S7GA 3KD2A 1CEYA 4BUCA 1EWYA 2O52A 3K9WA 4JYCA 4UMFA 3RS0A 1W5SA 2QPAA 3WZMA 1UJ5A 4HNHA 2Y3IA 4R9UC 3JATA 1GUAA 2UU9B 4XSHA 1NPTO 3GG9A 4LJKA 3L6UA 5EJGA 4ZANA 4MGYR 4O1HA 4CKCB 5ICSA 4F1KA 2CHEA 3IXMA 2MSDB 2EQ5A 3PJRA 2V98A 4Z9XA 4WXYB 4ZKDA 3REOA 1VG8A 2ZANA 1GPH1 4OYHA 5CX4A 5AKZA 3QXCA 1O6GA 1GNQA 4YNBA 2GEJA 5DLQC 1ZIPA 3V8MA 1CUBA 3KQVA 5GOZA 4E5UA 3Q5DA 4JEUA 1A5SB 1AN9A 4AW9A 1T4CB 5CIWA 2Q49A 1Z2DA 2GN6A 3AUKA 4Q37A 2C1EA 3ZD9A 1R2QA 1PDOA 4Y3UA 1R0ZA 5C4IA 2D06A 3OFSA 1UK8A 4HGPA 3C7CB 1F2TB 1RC1A 2GZMA 3EZ9A 3FN4A 1F51E 3O5AA 1L7EA 3EGWA 1NP7A 3T06B 4YT2A 5CFNA 1GUYA 1PJ4A 2NV0A 2O2YA 3DE3X 3H3XA 4WNYA 3RKUA 1EDOA 3UG7A 3KSDO 3CJTA 3GJXC 1GRNA 2Z8ZA 3MELA 3QWAA 2ZE6A 1T8SA 3T7RA 1RHUA 1RJDA 4JJEA 4E7PA 1FLNA 4Y2JA 1T1GA 4EFKA 5GMOA 3O8BA 5REQA 1OPRA 3LPDA 5BW6B 2OCKA 5K0CA 1HE1C 4IQ8A 2XUZA 5ARBA 3EAQA 2G0AA 1UXJA 2I4OA 1G8GA 2HCTA 2VTEA 3RU9A 1JPJA 2QUZA 3AHDA 3DR5A 3FSRA 4PGFA 3ZDRA 1W6RA 3DVAA 3B3JA 1AQ6A 4JJZA 4N7RA 5LC1A 4Z49A 3C6MA 5IARA 5L3ZA 4QVKA 3AF5A 2ZR8A 3S3TA 3TCKA 2X58A 2XOEA 2Q8NA 4RZ2A 3R7AA 4WK0B 3VSDA 3U9TA 1DJNA 5G0VA 4NHEA 4C0SA 4DNXA 5M34A 1SU8A 3NHAA 1J2RA 2GAFA 1DJPA 3DDHA 1GGFA 1E2DA 1VE6A 2AFHB 4RGVA 4TQAA 4F11A 4ODIA 2QMEA 4DDUA 2B4AA 2WWWA 1GHTA 4UATA 3E2IA 4B35A 1Q74A 1GXSB 2XGGA 1P81A 1PL0A 3L1VA 5BYJA 1ZS9A 3U2QA 3T1NA 3OOHA 4A0QA 2AHRA 2OC4A 4TSRA 1AQIA 4GDMA 5FO0A 3SIWA 4E22A 5K9ZA 5L6LB 2NU6A 1HO3A 3A36A 3PD0A 1MNQA 2NT3A 1UT6A 2ZK7A 2OHOA 2YC2C 4RFSA 4Y9DA 1Y34E 5CNJA 3A9CA 1JIQA 3IOEA 3F3YA 2EP8A 2PUWA 2IYYA 4NAHA 3PDWA 3SEZA 3VYUB 4GI5A 5H80A 1A9XA 2XRZA 5CA1A 3T5GA 3OCWA 2BHNA 3AETA 2CKDA 3H4MA 4UAVA 2FUG6 2J5XA 2DUUA 2XYVA 3QVLA 1XCPA 1QORA 3RSQA 3S40A 4EF6A 1PW5A 2BFBA 3F47A 1QGAA 5IJ0B 3BL6A 4HZIA 4B5KA 1XOIA 1ULAA 4HAUA 1I5EA 4O33A 4DLRA 4FXOA 5BWMA 1E3WA 2FGKA 2G1UA 2FPPA 2O2XA 1JALA 1CP2A 3R7FA 4PN3A 2DLCX 1BROA 1XJQA 1Z2CA 1J0AA 3KAPA 4H0CA 3UT6A 621PA 5JH7B 2XCIA 3AR4A 3E9RA 4Q1VA 4IMIB 4DIUA 5JBIA 3H9EO 4OK3A 3RRXA 4G84A 4IQGA 4M83A 1FFXB 4QDXA 1VTKA 2Z3WA 2QTBA 4DE5A 1R5JA 1YGYA 3QKTA 3L6DA 8AT1A 5LWHA 1F0PA 4W5NA 4CIVA 5BNZA 1TEZA 5FBVB 2O8BB 4NCAA 2CXOA 4TWRA 1NDUA 5JDIC 5KIAA 3R9WA 2A4MA 1U2DA 1WAMA 5CXQA 1ZUWA 3CS3A 1FF9A 4DIBA 4ZCSA 1BHO1 1BXGA 4TYNA 5KNCH 4HUQA 1EA5A 3MHTA 3FHLA 3GWGA 1E4VA 1YRWA 1P2SA 3OZFA 4BU0A 2C04A 1MO3A 3G8BA 1EB9A 5CLJA 2XQIA 5FNVA 1N3LA 2WDPA 2PRKA 3T95A 1GL6A 4MHTA 3NEYA 3EG9B 3E1KA 3NHKA 4U00A 5ADWA 1RCTE 2UAGA 3UKDA 3U5TA 4RHXA 4ER3A 3TI7A 5E9WA 3SKYA 4KWIA 1EUCB 2WVHA 4MXDA 1YZUA 4P4SB 4WGGA 3E5RA 3E3AA 4QJ4A 5HIIA 3USZA 1ABEA 4HX5A 3HUTA 3CEAA 2KLBA 2Z57A 2ZU6A 3M3PA 1TZCA 5BWOA 1HLPA 5EQTA 5EHZA 2JI9A 3MA0A 3S27A 2XWBF 4AS2A 3W1EA 4UE3S 4E46A 2NQ8A 1V39A 4WQMA 1WB5A 5KMGA 3IEUA 3EQ7A 1KEPA 2BFDB 3ORRA 1E2PA 3FCYA 2G6TA 5H3HA 1HQKA 4G8BA 3KT6A 4RFLA 1ZH0A 2IHZA 1ODCA 1P2UA 3EXHC 4XD2A 2VQDA 4CCYB 3LC0A 2ZYVX 4ZDKA 2P3OA 3F71A 2BEJA 2EV9A 2FEAA 2A0XA 3KZNA 2VDOB 3OP4A 4I99A 2P6OA 4PSKA 4YX9A 1Y6JA 1S2GA 2YFKA 4B4VA 4DZRA 5IT5A 3TJRA 4YRAA 4NE7A 1LSUA 1XK6A 3L0PA 3DHEA 1JJBA 1T0UA 4M49A 3JQFC 1DO2A 5F7XA 2ONZA 3KWFA 1HNWB 4HQ0A 1DEAA 3F7OA 4N12A 1JQAA 2VHJA 1B8PA 1AKQA 2HRZA 2Y93A 1RJ9A 3UK0A 5KQSA 1SZCA 3GLFB 3WGVA 4M2LA 3GLRA 4QXPA 4FKBA 3DTVD 5H9VA 5C46F 1QP0A 4CGZA 1QAMA 1PRYA 4Y9SA 3RVKA 2X2OA 3OZDA 2JJ2A 5GTDA 4TTSA 2R1UA 4M1MA 1OGJA 1UK7A 2GKOA 3EGEA 2RDMA 1Z4NA 3SSNA 5ENDA 1N6PA 3KR1A 3P9NA 1YJBA 5F35A 4OI0A 1E0JA 4RACA 5E6UB 1QKIA 5FTKA 4ZDWA 2PWAA 1C4KA 2WIAA 4CDNA 1KVQA 2VP5A 3KT8A 4M1WA 5MN5A 1H3EA 1ICIA 3OTHA 4INAA 3P0IA 1ZD8A 4ZIRB 4LXIA 1VZ3A 4XEHA 1BEZA 2BFCA 4EO7A 1IN6A 2FFRA 2C03A 3EF3A 4FC6A 4HQLA 2PBLA 3DVQX 4KV7A 2AYYA 3ZUPA 4RSRA 4YJKA 1T2VA 3TDKA 2DC1A 4JGBA 2HY7A 3GRAA 2G9QA 2JGKA 4K40A 5LA6A 2X9GA 1OI2A 4HDCA 2OOKA 3MVEA 3JD2A 5ELLA 2BEWA 3KWLA 5CDSA 2V1XA 4KMSA 3AK4A 4ITRC 1HYEA 3CT4A 3KOYA 5I3ZA 1J90A 3TDNA 1U2GA 5KNBA 2PD3A 2NO9A 4HKTA 4LOHA 4D43A 5CCDA 2LWIA 2VDPB 3QIVA 3USES 4CV1A 1KPIA 1H9AA 2GD2A 3AVPA 3D7KA 3CR7A 4NNPA 3E8SA 1L5LA 3IUMA 5LN1A 3MJEA 2W71A 4B7AA 3WB9A 4KPUA 1D4FA 3P52A 2Q2QA 4YJFB 1FOEB 1G41A 1K7FB 2PR7A 4OHCA 3HGQA 5FPSA 1CERA 1PFKA 5GZ6A 2H17A 1GEGA 1NQXA 1WDMA 1IQ0A 4HX9A 4OU5A 5L7YA 2Y1XA 1ENPA 4JODA 3RWOA 2CHGA 3WLAA 2XVXA 3G13A 2HLDA 5ELMA 1HMYA 2QX8A 1AU9A 2FQXA 4IR7A 8MHTA 2WPNA 4PG5A 1LVHA 2WTBA 4RTMA 1VYHA 2WFMA 1XDDA 2ZUCA 3OPYB 1H2WA 2R1VB 3JAWB 3A25A 2XVMA 1NLZA 4DMGA 1L4FA 3CLRC 3OTIA 4EOGA 2HGSA 4MI6A 2CWDA 2Q0SA 3VOSA 5A0VA 4N48A 1EFVA 1N3YA 3GT0A 3I01M 3N2EA 5BPFA 3ICCA 3H65A 4W7IA 4QUEA 5DOVA 3KTAB 4XQ9A 4JL5A 4F6RA 2XHEA 1BGXT 3R7WB 3BA1A 2V7XA 5BUZA 3PX3A 1KVUA 4Q9AA 3ZX5A 4IHQA 1JP7A 2B35A 5ALKA 5IUJC 2GN0A 4WV3A 5KDDA 5HZGA 1KORA 2HYDA 2REBA 1L7PA 3IA7A 3QHPA 2CNLA 4BDTA 1WY5A 1RWWA 5TJ9A 3SHVA 3BMNB 4JWTA 4DDHA 4E07A 3HLTA 2H4YA 3QF4B 3X1XA 3QU7A 1E5XA 1NVFA 1PZHA 1QFJA 1W5FA 1XZIA 2QYTA 2RGCA 3CH6A 3PK0A 5KAMA 4BGVA 1VE5A 4S1VA 5CYPA 4YJ3B 1VJDA 3TBKA 4DHWA 1MN6A 4ZYTA 3N7TA 4N03A 4XX1A 1BO6A 3QXGA 1WV1A 1Z6TA 3IP7A 2GD1O 4OI2A 3WRXC 1RQLA 2Q5JA 4PG7A 4CFYA 1QGZA 4EVQA 5CR9A 4AS1A 4D9FA 2ZYSA 1IEVA 1OR8A 1SKQA 4HYTA 3U3XA 3W3AA 3Q72A 4GBGA 4Z0PA 3S28A 1AUXA 1NVBA 4GE0A 1VLJA 4KQMA 1C2YA 1J0DA 4JP1A 4TKMA 1WU7A 2H11A 4E03A 4DR7B 5B1SA 5D00A 2YJ6A 2A33A 3PWTA 2PGLA 3ESCA 1Z9BA 3IKMB 1KSJA 3HCNA 3U6KA 4YH1A 1BN7A 1EI9A 2PGDA 3L4BC 3C7DB 4LV6A 2QN7A 2R25B 2HKIA 2IHUA 1K75A 1LBQA 4WHMA 5J4HA 1ABBA 2YRXA 5BN4B 1JBEA 3DCJA 3MCVA 2NSHA 4JLNA 3WBFA 1JT2A 1PUXA 4WKGA 4I1PA 2HJVA 2V74B 4R2LA 4IFIA 5CDTA 2W90A 2Y6UA 2H2GA 4K6HA 2DUJA 4ZCMA 1U99A 5E8RA 4CF6A 2PNJA 2GQ0A 1QQ6A 3UMRA 5C5EA 2NXEA 3G2NA 2HK6A 5CM9C 2DWCA 3I58A 2AUNA 3UV3A 3PEVA 4DEXA 3U4QA 1XZMA 1D8AA 1EGMB 1Y4ZA 5BWBA 2XBLA 4OLFA 2C5SA 1H5UA 1UBGA 1N5IA 2HF9A 3ZDZB 1KMHB 4GPZA 5B4UA 1PJAA 1U6JA 3NU1A 1B8NA 4TZTA 5CGZA 3IP8A 1AHIA 3DYIA 3T38A 3HDQA 1JU4A 4G0VA 1P1KA 1E1RA 1XNJA 1ZN7A 2BEUB 2H18A 3FYSA 5CRIA 3TR0A 3ZHCA 2DULA 5LOVA 1L5ZA 2HSGA 1SVLA 2M9MA 2X5OA 1WCIA 1QYWA 4U7HA 1VRWA 2ZI7A 4U3JB 3DTNA 4Y2UA 1AV7A 4FI3C 1QK5A 3M4ZA 5LJLA 1ZPDA 5B57C 1BCRB 2YWXA 4HFMA 3LVFO 1ETUA 5JISA 1W0JD 4JROA 4KHPB 5LA6F 4GKKB 5BW8A 2ZRBA 1VPEA 2OMEA 3UJCA 3UBMA 3A6EA 3EISA 3CGWA 4LV8B 1ZN8A 4KTVE 1DC4A 1BDMA 1XZAA 3R3WA 4HEQA 1W9MA 4F92B 3DVRX 2J9GA 1Z0ZA 5B5SA 1ONSA 2ZBVA 3MG9A 1DCFA 4NOMA 2RONA 4OOEA 2I2FA 4GYKA 4QU5A 2IV2X 1M6HA 1QPBA 5H59A 4OHUA 1ZOOA 2CC2A 1OWOA 3TQTA 2XEDA 3MGGA 2OMKA 3U3ZA 2D59A 3WAKA 2VVTA 1Z22A 2HFJA 4PM4A 5KSWB 1J2UA 1U4OA 1CUEA 4Q7QA 4JVSB 5FL7D 4GP9A 2G1PA 1E8MA 4S12A 4GLBA 4N7BA 4RMHA 1U7UA 5K8LA 3QX3A 4GKAA 1Y3FE 1WL8A 5T6MA 3ROFA 2R6GA 3UATA 3PEUA 3CW8X 4WECA 1C8KA 4KOEC 1CDZA 3DHNA 4P82A 1ZITA 1SWWA 4ZEXA 1U3WA 3GI1A 2XODA 4QPDA 5K7SA 1AA6A 3WA6A 4Y0NA 4MUIA 5DHTA 4TPKA 2D8AA 2GASA 1OLUB 2X8JA 3I4CA 3V4LA 2DR0A 1IMJA 1BS2A 4ZOQI 3COSA 5U9CA 3MTEA 1KAOA 2LVBA 3DBLA 4N18A 5IC5A 2WI8A 4H1UA 4WUVA 2WFLA 2HX1A 5JV5A 2PKQO 3OZAA 1YS2X 5KYYA 1WXFA 2OLEA 3OA0A 3QEOA 2YVLA 1BA3A 3UA3A 1ZGZA 2AEJA 4G6ZA 3K6SB 1CQWA 4TLDA 4D3ZA 5FH9A 4TWZA 3D7SA 4ZVKA 3CPSA 2ZWOA 5G02A 3L18A 2H57A 3G6KA 2DM6A 1VSVA 1YO6A 3M49A 3WWOA 2XITA 3SCZA 3VHQA 1E2QA 3KB6A 3CKLA 1LDEA 3OU6A 3OZTA 3TSZA 4E4YA 3FPJA 2NUTA 4M0EA 4R0VA 4ZPXA 2W2PA 4G1UC 3IBCA 4IZHA 4NYIQ 4X61A 2NZ8A 3FCUB 4NU5A 4AJ4A 2PUJA 4LPSA 4DMUB 3OZSA 5COBA 4CL3A 4DC1A 4QE3A 5AKLA 1CQZA 1U9IA 1IG3A 2G0TA 2YIJA 4WWHA 3NKVA 3F2VA 2PS9A 1JMVA 3P0RA 2V0GA 3HSYA 1U2SA 1X42A 2IS2A 5ILGA 1Z5VA 1DWUA 4XRRA 2WWVD 2YY7A 3I9KA 1P7CA 2VSNA 2BPOA 4C0KA 4ZV9A 3DXZA 5BVGA 2JGDB 2W8ZA 2PS3A 3MOGA 1NN0A 3G0CA 2YZGA 4HH3C 3PE3A 3H7AA 4EG7A 1IHPA 3OE1A 4LXGA 2CDNA 2JI6A 3SIRA 2R6AA 2ZI4A 2ZIUB 5PNTA 1OX4A 1IOVA 3DAPA 5GGYA 4IRUB 3WX0A 4IF6A 1YOVB 1E2EA 1ML4A 1L1RA 1L5QA 2CLEB 3EXFA 2FSGA 4JXKA 4MWGA 1GAJA 2QIPA 4OAPA 1LWOA 2P79A 3V1LA 4C4ZA 5IZCA 4BNDB 1V9SA 2XYQA 5GY7A 3ZQKA 1M0TA 4C4PA 3PDJA 4MB2A 2X2FA 4O4HA 3TVYA 3I1FA 3TX2A 2BE9A 3BMXA 3C87A 4RDHA 1P60A 5A9TA 4NL4H 2DGDA 2EHJA 4HBZA 4GLJA 4JUIA 4P08A 4XGIA 3OZRA 3AH8A 4Q4AA 3X1MA 3QQ5A 3OZUA 4OHMA 1I32A 1NBHA 1BE8A 4C87A 5CX1A 4H1VA 1W48A 4RTKA 2YN0A 5ITZB 5E4FA 1O54A 3C3XA 2XE6A 4C7KA 4JUCA 3D3WA 4TKUB 2IP4A 4KMMA 4EF5A 2C2ZA 4YREA 5ES4B 1QRTA 4Y2PA 4O08A 2NXWA 4TRMA 3V5NA 4EHDA 3L84A 3GGJA 5FUMA 5I4KA 2VYQA 2WG1A 2VSYA 2X4DA 4WXMA 3WGMA 2QTFA 2BAGA 1G6Q1 3IVAA 3RVRA 2BEVB 3WKDA 1GZ5A 4QU8A 2REQA 3KKEA 4ZZ2A 2QXTA 2DQYA 1ODJA 1PL8A 2OECA 2QM8A 3LUDA 3VPBA 3SR4A 2H4JA 1X87A 4QPCA 1AE1A 3DB2A 3AEUA 5TJHA 3WLJA 2B9EA 2ZROA 3DB1A 2G1AA 4IEIA 5AYVA 1ZRHA 3EAFA 3STUA 5CPFA 2OO3A 3EZ6A 3UYLA 3AHJA 4LJ5A 4IHJF 1ZLXA 3TUIC 1UWKA 2PQ6A 1ZQ1A 1BGVA 4CV3A 1RIFA 4B4WA 1FPQA 4PRYA 3RRMA 3TTXA 4B80A 4JI1B 1RACA 1S01A 3NC1C 3EVCA 2I3GA 5CT9A 4JR2A 3OFKA 3WWPA 4UDNA 3PT5A 3IPYA 3WE7A 3ZW8A 1KPGA 1IEWA 1DIGA 4WCFA 1XPRA 3N2GA 4B2PA 1FVFA 3HP4A 1D8TA 3NVAA 4QG7A 5IP5A 3TTUA 3OM8A 2Q0HA 3GEPA 5JT1A 2OCLA 5FYDA 1IL0A 4Z3DA 2C5GA 2J4DA 1C0PA 4J0GA 1OILA 2ROQA 5DGCA 4XVHA 2W93A 5CJPA 3VVLA 4BX0A 4ZCIA 1VSBA 1ECLA 1YVRA 2FKAA 3ANXA 2O5EA 5FFFA 4D3XA 2HRBA 4LJSA 5FR1A 1ORIA 2O07A 3LC2O 1FU7A 3U13A 2RC5A 1IB6A 4JBIA 1F8GA 4JLUA 5K51A 4ND2A 1B0PA 2PS0A 2ZBRA 5JADA 3PC4A 3ZU5A 1VPLA 2PKEA 4RTRA 3UCXA 4MJ7A 4IXTA 1PSDA 3S1LA 5FWAA 1RYMA 5BSHA 1Y98A 3AZQA 1ECJA 3EC1A 4OH1A 4PNEA 3GCGA 1E2JA 4MW1A 1K66A 3DZJA 4F3YA 2XT0A 3OC6A 2BW0A 2VLIA 2IEGA 1DUSA 3KL2A 3NYWA 2G72A 1EUYA 2ZIXB 1FTWA 3IEVA 1NHWA 4B09A 2JIMA 5IUKC 4XB1A 1BCSB 2RI6A 1YL7A 2POCA 5IABA 1SPXA 4C43A 3UOGA 5HQ3B 3EIOA 2PGIA 2HMYB 2QAJA 4CEJA 1L5RA 4PC3A 2COKA 5EMNA 2HRDA 5JVDB 2WMNB 4X20A 3OQMA 4N8DA 3ONNA 5CUQA