4P31A

Crystal structure of a selenomethionine derivative of e. coli lptb in complex with adp-magensium
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
234
structure length
234
Chain Sequence
b'ATLTAKNLAKAYKGRRVVEDVSLTVNSGEIVGLLGPNGAGKTTTFYMVVGIVPRDAGNIIIDDDDISLLPLHARARRGIGYLPQEASIFRRLSVYDNLMAVLQIRDDLSAEQREDRANELMEEFHIEHLRDSMGQSLSGGERRRVEIARALAANPKFILLDEPFAGVDPISVIDIKRIIEHLRDSGLGVLITDHNVRETLAVCERAYIVSQGHLIAHGTPTEILQDEHVKRVYL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lipopolysaccharide export system ATP-binding protein LptB
publication title Decoupling catalytic activity from biological function of the ATPase that powers lipopolysaccharide transport.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 70
structure length 234
sequence length 234
chains with identical sequence B
ec nomenclature ec 3.6.3.-:
pdb deposition date 2014-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF12399 BCA_ABC_TP_C Branched-chain amino acid ATP-binding cassette transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4p31A00
3A8TA 4W5JA 1KGDA 4OI2A 1TMKA 4IDPA 2ZR9A 3B2EA 2D06A 4KFSA 1M7BA 4XD7A 5KHOC 3ADBA 4PFSA 4BEJA 4P33A 2ODBA 5KDOA 2ZJZA 3A1UA 1E79D 4RJLA 4B74A 8OHMA 1E0KA 1G21E 5H70A 5FTLA 5CLQA 5D3MA 3I5XA 4NDZA 2Q3HA 4IOMA 4JYBA 1NMYA 2DHRA 4NL4H 3IUYA 3A37A 4JLOA 5FR1A 3AKYA 1HA3A 3DEFA 1U99A 2J0QA 1U0HC 2QT0A 4F4CA 2JGNA 4ZKDA 4UQOA 1Z0AA 3GFPA 1R2QA 1SXJA 1OFUX 2VH5R 3NIBA 2J0UA 4B3DA 1VCMA 1IBRA 2DR3A 2WJJA 3B9QA 4Q1CA 3U44B 1JR3A 1CULC 1US8A 5AK0A 4XSHA 2JJ1D 4LRWA 3SJAA 2XXAB 3QEOA 1OXXK 121PA 1NL3A 3RWMB 4ZIRA 5G40A 2YWEA 4OHWA 4US1R 3U3OA 2FF7A 1E9BA 2A78A 2BOVA 3D6TB 3P1JA 3QKRA 4BLOA 4TLBA 3GEHA 1IN8A 3C4JA 4C0AC 1T6NA 1WP9A 3QKUA 4G5SA 1JEDA 2QTFA 4FMCF 4JLAA 4C0QC 3F8TA 5EUQB 3ZVNA 4KVGA 2QGNA 1SHKA 1KSJA 3LW7A 3ZVRA 4RD4A 4XWKA 3B1WA 4NE2A 1G19A 2F7SA 2FX3A 4KAXA 1N0UA 1S3GA 4HDCA 4O2LA 3NBFA 1F2UB 4JKIA 3D8BA 4C0JA 5EXTA 1GOTA 2O8DB 2OBMA 2VTKA 4AY2A 4TTRA 3AVWA 1RE0A 5HZHA 3REGA 3NEJA 1II9A 3AVVA 4FXPA 1HE8B 4XVUA 1QHNA 3AGQA 3SJCA 2ODEA 3MFYA 1JXOA 3EWSA 2LKCA 3CR7A 3LBHA 3ZS8A 3SS8A 1P62B 1ELOA 2OFXA 3K9NA 4DUGD 1QDEA 1KK0A 3ZD6A 1J2JA 1XMIA 1C1YA 2BEKA 5HTKA 4D0GA 5JWRA 1PLLA 1D9ZA 2ZUBA 4JKYA 5FOVA 4KHZA 4BFSA 3PENA 2ATVA 1P2UA 2ZYTX 4URYR 2VHCA 1QF9A 3OFND 4PR0A 4BE7B 1U2RA 4Q1AA 5L3QB 2CLCX 2H16A 2HYIC 1NLYA 1U8YA 1XDBA 3HR8A 3RS0A 3L8YA 4JYCA 1Z63A 5FUYA 3EC1A 1KJWA 4ASUA 4LSGA 4OHVA 3AQ4A 3UMRA 2ZR0A 4PC3A 3B8HA 5SZHB 4MKIA 2F9LA 3K53A 1NLZA 2G0TA 1ZUIA 2HXYA 2P3SA 2SHKA 2IBMA 4GFDA 3AVUA 1TEXA 5F9FA 3IPXA 3NKVA 2ZRAA 4LWZA 1E69A 5E7MA 4TYNA 2DCUA 4BRWA 2ZEJA 2X77A 3AF0A 4EPWA 4GI7A 4G5QA 5K8LA 2PT7A 2B92A 2MSEB 4Q01A 4U02A 3LH5A 4BFZA 2PX3A 1SZPA 2C03A 2JLYA 1DO2A 4B2LA 1Q3HA 1V43A 2X19A 2AN9A 1UBGA 4P31A 1KO5A 2REBA 3THXB 1OF1A 2HCJB 3U6KA 1G8YA 4P4SA 4IEEA 4HLQB 4OQXA 4A6PA 5JECA 4OK6A 2OCPA 4Q9LA 5TB5A 4DCTA 2G3YA 3EIQA 621PA 5IRCD 2J1LA 4C0BA 2F9MA 4IVPA 2EWVA 2BBWA 2D7DA 3K0CC 4IXMA 4PSVA 5BN3A 5FOUA 1VIYA 2ZRLA 4Q9IA 1KJYA 1SVKA 2JJ2A 3AKDA 4OI1A 3VQTA 3ICEA 1SGWA 1PLKA 1BYIA 1IY1A 2CHVA 1VTKA 2ORWA 3PG5A 2QL6A 3EZ9A 2CCJA 4GZMA 3B78A 1P2VA 2E1RA 2IT1A 2WSSD 4Q7JB 1OXSC 3FKSD 3EZ2A 4LYHA 2ZROA 1U9IC 1OB2A 4AG5A 4EJSA 5EZ5A 3TRFA 2O8FB 2F43A 1XEXB 1MO5A 3X1WA 4R7ZA 4DIEA 1KDPA 2WWFA 1X1RA 2J7KA 3GLHE 4TT3D 3AEZA 4LPSA 1XRJA 2C8VA 4JLMA 2BEJA 3NBXX 3O8RA 3CPHA 1OW3B 4NYJR 1W7AA 2X2EA 1Q1EA 1IY2A 2WSMA 3KDSE 2ZREA 3B1YA 3QEJA 1M1YE 2VL7A 4AYWA 3C41J 4AYXA 1K5GA 5JCZA 3RVBA 1E9CA 1U8AA 3CLVA 4B43A 2F1HA 3PUXA 3OIYA 4Z54A 3THWA 1KI2A 4PANA 221PA 1R0ZA 4D0LB 1Q44A 4DC9A 3BAFA 1BKDR 5JCPA 1E9EA 1OXTA 2YC2C 2NMVA 1JNYA 4MRVA 1CKEA 3VU9A 4DCNA 3EX7C 1FMJA 4G5OA 3FTQA 4M9XA 5GVRA 4D26A 4C7OB 2I1QA 3PFIA 1BIFA 3HR7A 4JVSB 2GNOA 3LWNA 1N2CE 1NN5A 4DB4A 1QVAA 2D3WA 3HYTA 3I61A 1F48A 2C78A 2QENA 3GJXC 2LCFA 3LBNA 5H68A 1F6BA 3I32A 3LNCA 1EX6A 4OQLA 5DSZA 2J5XA 4M53A 1XNJA 1AKEA 4LBVA 1UM8A 3LFUA 5B58C 1P4SA 3L0PA 1YZGA 2JLVA 2UKDA 3ASYA 2EW1A 5JJLA 2XTZA 1RRFA 2GVZC 3OEHD 1CEEA 3ZLJA 4UXHA 2FEOA 1NNEA 2ZSAA 5CB8A 4OHYA 1RYHA 4R2IA 5EE9A 5TDHA 4PHFA 2OT3B 1WE2A 3ETLA 2WM9B 1I4LD 1NMXA 2IC5A 2ZRGA 1Z6YA 3JVVA 4KLZA 3TAUA 1QHXA 4HSEA 2JLQA 4JLVA 2B7BA 3GJ7A 1N0VC 4CRWB 2BBTA 3FYHA 3IIKA 2JJ8A 3WRYC 4TMXA 2NIPA 1KO8A 2ZRHA 2GBLC 3IHLA 3SE0A 5JHGB 2O8EA 5AUQA 1GNQA 5D3MB 4BFYA 3R8FA 2W58A 3AVQA 3L0IB 2ZSBA 3K0FA 4LV6A 1FL9A 1N5KA 3IIMA 2V8OA 4TZ6A 4JVLA 1T5IA 2GEDA 2GJKA 1A2BA 4HLCA 1GNRA 2PX0A 2BIFA 1Q1BA 2PZEA 4OL0A 4NH0A 3RRYA 4DJTA 2CHGA 3FHOA 4I1OA 1E4YA 2MMGA 3BBPA 3GJ8A 3QKSA 2H92A 3I72A 4L15A 1A1VA 4AKIA 3LA6A 5F3WB 1Z08A 2Q6TA 4PO8A 4A82A 1XD2B 3G5UA 3LQQA 1ZM4A 2Q9CA 4ZIRB 1W36B 1E9AA 1J7KA 4URUR 2HJVA 4MKFA 3RLFA 1ZNZA 2VF8A 4MGKR 521PA 2KJQA 3PXGA 3THYA 1TU4A 1W0KA 4BLSA 2XTMA 1NN3A 3IBGA 5L8VA 4QGFA 1ONBA 4UKDA 2H5EA 3LLUA 5G3ZA 3P32A 4A8JC 1JR6A 3MCAA 3TQCA 4IOLA 4G5GA 4LDJA 2NTYC 3CO5A 1IXSB 3NBZC 1UDXA 4B33A 4Z8YA 2N1BA 3QENA 4E09A 1YRBA 3KQHA 1LF5A 2GCNA 4M9SA 3KXKA 1TNDA 3FFAA 5C4GB 1XXHE 1YU9A 1QHSA 3GLGA 2BVNA 3I8XA 1YR6A 1ZD1A 2OCAA 3CONA 4QC2A 2RGCA 4DHEA 3NHBA 5KUTA 4GP6A 4ITRC 4IHQA 3BGWA 3HYRA 4OK5A 1GRRA 2FZ4A 3KB2A 3H0KA 4HDQB 5A0FA 5AUOB 3B1ZA 3GLIA 3EPLA 2CL0X 3RDPA 5L3SA 1QHYA 2OAP1 2QP3A 2A7QA 2BMDA 3AV0B 3KZ1E 1JAHA 2V7QA 5JS8A 1T9HA 5B57C 4QXAA 1KNXA 1E9DA 2BMEA 1P5ZB 1Z6GA 3IO3A 2H57A 4LX0A 2UZ3A 4MITA 4CEHA 1AQYA 2NPIA 2HT1A 4TLAA 4PX9A 1TAGA 4TLEA 2UVQA 4DLUA 5CM9C 2R6GA 3BD9A 4C0HA 3D3QA 4PHHA 1D2EA 4P3YA 1OH7A 2ZETA 1P7CA 2GZHA 1NVVR 1ZC4A 1DAGA 1D5CA 4Z1MA 1HYQA 2XNDA 3OF5A 3PUYA 1BOFA 5FOXA 3VR6A 2ZS8A 2VLIA 4P4SB 2WBLC 3H84A 5G53C 1G8HA 3OESA 3AH8A 4HI0E 1E0AA 4FN5A 5C2JB 1MR3F 3RS7A 5F9HA 1LB1B 4BFUA 3DPUA 5EP2A 2FGKA 5JJKA 3IEVA 2Q3MA 4O25A 1DADA 2OG2A 4NPHA 2F55A 2YWGA 4Q48A 3VR3A 1PVOA 3DL0A 1T8UA 1KI1A 5DH9A 3FHTA 4AC9A 1WBBA 1CR4A 1G4AE 1MO6A 3S1AB 4V02A 2GCOA 3DOEA 3W8NA 2BBOA 3TSZA 3LVRE 1A4RA 4FCTA 5BN5A 1CR1A 4QNRA 2Y8EA 3A1TA 2A5GA 1L2TA 3T1QA 5KSOA 5BW8A 4AURA 3DKPA 2R8RA 2XJ4A 4KCGA 1NSTA 4EJSB 2BV3A 2G1JA 2QY9A 2ZRNA 2HUPA 3X2SA 2F43B 3QXJA 2ONKA 4RZ2A 2Z43A 4MGIR 1ESMA 3PJRA 4B32A 3SOPA 1W1WA 3U7GA 3AVXA 1G5PA 2ERYA 2FFBA 3WNDA 3BFKA 1GKIA 2ZRMA 1F2UA 1G1MA 4R98A 4R9UC 3ADDA 1XPRA 1NBME 2IEYA 1EX7A 2BHRA 1N5LA 2ZR7A 3IDQA 2NGRA 2GKSA 2QA5A 3QIAA 2VRWA 3K0EA 3CZPA 4KI0A 4NCKA 2CJWA 4D80A 1SKQA 4QGAA 4QHTA 3RWOA 3THWB 1XJCA 2PBRA 2IYTA 2GXSA 2QNRA 2Q3FA 1G4UR 4QL3A 1ZNYA 2YC4C 1JALA 2XTNA 3ASZA 4Q4HB 4X8MA 3SN6A 4M22A 1KOFA 2IHYA 1SQ5A 3ZZ0A 1TL7C 3VU9B 5FI1B 2J41A 4RD1A 1CJMA 2FG5A 2RKOA 3QSYA 5LDDC 1YR9A 4Q1DA 1LNZA 1N5IA 5L3QA 1W0KD 1NBMD 5FTJA 2GILA 1F3OA 2QPTA 2J9RA 4LJAA 4DBLC 5J4YA 2ZE5A 5JZVA 2FMXA 2QORA 1E79A 5EP1A 1IN7A 3QXSA 4M9QA 3UK6A 5E4FA 3SC3A 2ZJ5A 1GSIA 2ZTSA 3SQXA 4BASA 4PPGA 2ORIA 3U4QA 3CRRA 2QPOA 1N25A 1DTSA 4V0NA 4WZBE 1AGPA 3FMFA 5FOSA 4Q7LA 1KMQA 1XCGB 5IDVA 4DSUA 4ZV4A 4QFMA 2GDJA 2WJHA 2DFKB 3THXA 2JJ1A 1T3LA 1NVWQ 1DELA 2DWOA 1W47A 4U7DA 3A4NA 2GEVA 1KAOA 1FFHA 3TLXA 1ZU4A 3KKPA 1FP7A 4EPTA 4JBWA 3DZ8A 4IXNA 1Z8FA 5CB6A 3AM1A 3GQBA 1KZGB 4QHSA 1ZUNB 3T1TA 2O52A 1ZMXA 2NZ8A 2Q0HA 2O8EB 5KDDA 1S96A 2X2FA 4EFMA 3GMTA 4OBEA 4BZPA 2CXXA 4M9ZA 3K70C 2CBZA 5J4HA 2CE7A 1E2JA 5GVSA 1S1MA 4I4LA 3BB1A 2PH1A 4TL8A 4LV5B 1OH8A 2IYUA 1RYFA 5LD2C 4YDHB 3QG5A 4CDGA 1LV7A 3QVUA 4HB3A 4F7WA 2QUZA 1G16A 6Q21A 4KJZA 2H17A 2EFDB 4JJKA 5CDFE 1ZUHA 2Z5FA 2Q21A 1GRQA 5B30A 1ZD9A 3QKSB 4S35A 3EA5A 1JECA 4LZZA 2J0VA 2F3TA 4H9GA 4OJKA 4DUGA 2O8FA 2VP9A 3KL4A 5L3VA 3CW2A 2ZM5A 3P4XA 3MWYW 1E2QA 3AF1A 3O8DA 2OSBA 1JBKA 3V00A 1RRCA 1QBKC 4BRUA 4OKSA 1VCIA 1IONA 5E95A 3KUDA 2A5JA 1Q3TA 3EASA 3OFNA 4CT4B 4YMUA 2XOKD 5EP4A 3EA0A 1GL6A 3O47A 4EDHA 2FFHA 3RRZA 2JLZA 1SVMA 1NP6A 3IQXA 4WAUA 4DEXA 2R44A 2WJYA 4RZXA 5FBLB 4ZDKA 3U7HB 4A36A 1O3YA 1G8FA 4M1YA 5EE5B 1N6PA 1FP6A 2J7PD 2QE7D 1WBDA 5HR5A 3RNLA 3QPUA 1QG2A 2WOJA 3UXMA 2F1JA 5FPKA 2VP5A 3ZYCA 1UBEA 1R8QA 2FFAA 4Q9HA 5EE0A 2AX4A 3SJBA 2JLXA 2ZJOA 3GLGB 2QU8A 3EC2A 1AGRA 2IL1A 3MRSA 4B3XA 5DNYB 2GRJA 821PA 2P5SA 1E6CA 2ZYUX 3VR2A 5JJIA 2QAJA 2AKAB 3PR1A 1UJ2A 1CXZA 2ZJYA 3GLIB 1Q1QA 1ZAKA 3ECCA 1YZLA 1JAIA 4KODA 4LJYA 4AYTA 4DDUA 3PUVA 2RGNC 5BYKA 1E1RA 2W6JD 1YVDA 3PEUA 2QQEA 2IYLD 2WICA 3VHLB 3K70D 1N6OA 1NSFA 4CEHB 3CH4B 2HLDD 5AR1A 1T3HA 1ZINA 3GLFE 3QNUA 3P20A 2VF7A 2C9OA 3N70A 3GD7A 4R2HA 3MSXA 1JJ7A 3A4LA 4EUNA 3WBKA 2YYZA 5J47A 4HAXA 4KFRA 4NCHA 4PPNA 5FR2A 4XSGA 4LC0A 4KSBA 1II8B 2YOHA 1ZU5A 4A1FA 2QMEA 1DAEA 3N2IA 2WSSA 1XTKA 3FKSA 2IYXA 4LBWA 2H1LA 3BFVA 4JLBA 1DAKA 1I2DA 2ANCA 1VG1A 1GDDA 2NQ2C 1BO6A 2I4IA 3SR0A 1ZNXA 4JMPA 4QOSA 1EK0A 1DAFA 4TT3A 5KYKA 1DBSA 4IDOA 4URVR 1Z6TA 2HYDA 5JFGA 3RHFA 1E2IA 4UNNA 2ORVA 4Q00A 1AKYA 3FE2A 2GETA 4FCWA 2O8BA 1BS1A 1TQ2A 2V1UA 3RC8A 3P27A 2JATA 3DM5A 5DHAA 1KTVA 5HCIA 3SFZA 1TADA 1XTIA 4Q1FA 1P60A 2IYYA 2O0KA 3ADKA 3DVLA 2GCOB 4MQBA 3RS5A 4UNRA 1R0XA 3NVAA 2CEAA 2V55B 3FGNA 1P9WA 4PQRA 3DZDA 1S9HA 3R9IA 1XD2A 5EXPA 3M1IA 4HYYA 3GLHA 2UZIR 2NG1A 3TW4A 4BEBA 1X8KA 2QG6A 4CEJA 4KFUA 1FPMA 1XTQA 4AG6A 1SVSA 2CNWD 1NVVQ 4CEIA 1RC8A 4KBGA 4NYMR 5FOTA 2IHBA 3AVTA 5SZJA 1KK1A 2NOAA 2G1KA 4C9BA 4LHVA 4QBHA 2JEOA 3NXSA 1CU1A 1LTQA 4UNQA 3K0CA 1VMAA 4KLNA 1U8ZA 2OLKA 3LV8A 4QBGB 4HLUC 1N6RA 3TUIC 2J87A 4HAYA 2ONJA 4IDHA 2ZJ8A 4B34A 2H8KA 5H8WA 3WY9A 1E2FA 2XSZD 3Q5EA 2CJWB 3RRMA 3KQUA 1LY1A 4WOPA 2ZANA 3OEHA 1RW4A 2IYWA 1UKEA 4KYUA 2P2LA 2GJ9A 1YZNA 3CB4A 3MAAC 4NU0A 4B73A 4FWTA 2JAQA 1KKLA 5DO9A 1GFIA 1U9IA 1UFQA 4FMCB 4TMVA 3QF7A 4AKEA 1Z2AA 3CPEA 4B76A 1AK2A 3FVQA 1R5BA 3WMFA 2W00A 2DYKA 1E2HA 2DWPA 1NJGA 3VNUA 3MD0A 2FU5C 3DOFA 4TQUS 1S8FA 1Z0IA 1LF0A 1R4AA 5BYJA 2PLRA 4LJ7A 2VP4A 1G5TA 4ILEA 4KFTA 1XMSA 3CF6R 4WXRA 1IY0A 3EXAA 4JS0A 2XZOA 4UNPA 4CT5A 3U4QB 1SVLA 3BH0A 4PAMA 2WWGA 3SDZA 5DI3A 3ZDQA 2C9CA 2GA8A 5A5GA 1UKYA 4MUBA 2AHOA 2FSGA 2JLWA 3LBIA 4YMWA 5DE3A 5FUXA 1AA9A 1WA5A 3ZQJA 4LYJA 3WYGA 2ZI6A 2ZRBA 3OIWA 2IS4A 4C2TA 3I4LA 5FTMA 2ERXA 1C4OA 1SXJC 2MMCA 2OBLA 5AJXA 1E1RD 2RH5A 4IRUB 4QNMA 1OB5A 3CRW1 3KKMA 2CLSA 3QPWA 4JL8A 1W4AA 2QZ4A 3RS2A 5JBQA 1F60A 4Q66C 2ZQ5A 5G3YA 1IN5A 5J4KA 1KAGA 1E0SA 2QRZA 4D82A 1JB1A 3AGPA 4MRNA 3I62A 4DLRA 2IF0A 1NY6A 1N6LA 4M1TA 4F38A 3GJ0A 3S1AA 1KYIA 2PLFA 3HU1A 4IVRA 4F91B 5JRZA 1MABA 2ZSFA 2QM7A 3UKDA 4V03A 3IKJA 4BLTA 2GVDC 1SVWA 4TTQA 1ODFA 3TVTA 3W34A 3UG7A 1RVDA 1XEWX 4JJZA 1UADA 1Z0FA 3SU8A 4B3CA 1L8QA 3IPYA 3NG1A 3RSOA 1T8TA 2RCNA 2QT1A 1XMJA 1OYWA 4Z8XA 3U7FB 4MDEA 4ACAA 1FTNA 1H65A 2OV2A 1E94E 1IXRC 1P9NA 4TMKA 3X1XA 1TPZA 2PZGA 3TMKA 3IGFA 3IBYA 3MG9A 1FZQA 2FDCA 4DLXA 4B6FA 3SZRA 1G7RA 2GBLA 2GK7A 4JL6A 2F6RA 3Q7QA 1SXJE 4U00A 2FN4A 3SEAA 5DYIA 3PVSA 4A4DA 1JQLB 1QG4A 4IVQA 2EFGA 2V9PA 2Z83A 1OXUA 3C14C 2H7VA 3GFOA 4PSAA 4R71A 1Z0JA 4KO8A 2PL3A 4Q4HA 4URZR 4AKHA 3UWKA 4ZCIA 1AJEA 3L0OA 4GOJA 2EQBA 2AXPA 2ZYVX 3OIUA 3QOFA 1E4VA 3TVDA 3CF2A 1TQ6A 3M6AA 3REFA 4MYTA 1XB2A 5C46F 3SI7A 1R5OA 5KPDA 1A5TA 1M8PA 5FBQB 1VIAA 1RJ9B 2YHSA 4N0DA 1KSGA 3D7MA 3IILA 1R7RA 4JLJA 3SYLA 1NVXQ 1G3UA 3NDBB 2GTPA 4GSYA 3IHWA 1KK2A 3Q8XB 3MWKA 3BS4A 1E2LA 4TL9A 4Y0VA 3X1YA 2ZRKA 3E2IA 3WYFA 4A8JA 2CCGA 2ZI3A 2PEYA 4JLPA 1UKVY 4RD0A 5CJ2A 4LGMA 2QP9X 5DISB 1LVGA 3ICQB 4OI4A 1PZNA 1W4CA 1WMSA 4WIAA 4J0QA 1E9FA 1OXVA 4A0FA 2IS2A 1A82A 3K09C 3W6OA 2C04A 4ARZA 1G5RA 2P65A 4BLRA 1VYTA 3TR5A 1GUAA 1KMHB 3QPVA 2WJVA 1ETUA 3EARA 2FPLA 2FPMA 4US0R 4HUTA 2C9YA 2I3BA 3FB4A 2N42A 4JLNA 2AL7A 2QAGC 4LYAA 3X1ZA 4PXAA 4M1MA 3SBEA 1GWNA 2CE2X 5DN6D 4DB2A 2ANBA 3FHCB 2QI9C 1LW7A 2FGJA 4XTRA 2O8BB 1U90A 1Q12A 1Y63A 1N6KA 3AVPA 4NYIR 4C30A 1IQPA 1I4DD 3ZZUA 4M1SA 2AWOA 2B21A 1E32A 3F3YA 1GRNA 4TN1A 1T0JB 5TV2A 1G3RA 3BIFA 4YMSA 3H2YA 5TVKA 4EFLA 2DFNA 4M21A 3ADCA 2BCGY 2VSFA 3GLHB 1MKYA 4CEJB 1OKKD 4TLCA 1T3SA 1CF4A 2EYUA 4MDFA 3WXMA 2X8AA 4CEIB 2GXAA 2G83A 1S2MA 4PHGA 3SNHA 2YVUA 1NBMA 2QQ0A 1G8PA 3KTAA 2IEZA 1S3SA 1KI8A 4H1VA 4OQFA 3W6PA 2IK8A 2ODWA 5JMTA 1J8YF 2QMOA 5DIFA 2E87A 1XEFA 4Q4JA 1B23P 2XITA 5AWFC 2OUKA 2R9VA 4ACBA 4YQFA 4BFXA 3GJ4A 2DB3A 4LC1A 2YKGA 3PEWA 2Q9AA 1U94A 4MH0R 1ESNA 2PMKA 2FWRA 3H1TA 3D31A 2OBNA 4OJQA 4L4UA 2BC9A 4TMTA 3CRVA 2ZUDA 2VP2A 3AF3A 5UKDA 5B64A 4D6PA 2PCJA 2TMKA 2WWWA 2WAXA 2ZUCA 3PITA 3EZFA 3ZVLA 1NMZA 2HXSA 3FMPB 2WHXA 4A15A 2PZFA 1G41A 1XD8A 2OE2A 1W48A 1L7VC 1KO4A 4DIDA 2WVJA 1G7SA 3QVVA 2H18A 1KK3A 3HWSA 1XPOA 4JLKA 2NO1A 1VHTA 2JA1A 2V6IA 3ZVMA 3KJIA 2QMUA 1VYUA 1Z83A 2A9KA 3PEYA 3I92A 2CVHA 3DMNA 2V1XA 3TW8B 4AI6A 4NYMQ 2VHTA 2WWHA 3KB1A 1YJ5A 1G20E 1L4YA 1GILA 2Z4RA 4JIMA 1RRGA 4QRHA 2OXCA 2WJIA 1EWQA 1DAIA 1HURA 3CM0A 1II8A 1VCOA 4QJ4A 4W5WA 4PZZA 5DI3B 2Z6VA 2N46A 4FMDF 4RSGA 3WP1B 3ND8A 4GOXA 4N3NA 2W0MA 4DDVA 2W2TA 2ZI7A 2VP0A 1GL9B 4TMZA 3GCGA 4ZPXA 1E9SA 4YMTA 2HEIA 3TQFA 3R9XA 5J4LA 4IW3B 3X1DA 4GOKA 5JRJA 4HB0A 1Q0UA 3H86A 3W8RA 5M04A 1YR8A 1L4UA 4Y0AA 3UPUA 2CCKA 2ZRCA 2ZITA 2PEZA 4TL6A 4CZ2A 1CJKC 4A0RA 1HTWA 1T0HB 2XOKA 4QBIA 2IUUA 3KJHA 1V5WA 1CLUA 5JWOA 4A2WA 4KSCA 4NCIA 1U81A 3BXZA 1CJTC 2FE4A 1DG1G 5CDFA 1IN4A 1KDOA 4PPFA 5JSZA 1LS6A 1YR7A 4BLPA 2J7PA 1UBCA 2EFEB 2P6NA 1H8HD 2QE7A 3T12A 1IOZA 4RCZA 1MABB 1UDWA 4IFEA 4D4KA 5FPYA 4BWYA 5J4VA 5DI9A 3K0AA 5KOYA 3V4RA 1W2GA 4XVRA 2JIZD 2FJUA 1DS6A 1FQKA 2P6UA 1BYUA 3AB3A 3EW9A 5LBIA 4TZ0A 4V0KA 3SQWA 2AK3A 4LPKA 3CIOA 3R7WA 1ANKA 1KSFX 3V9PA 1TEVA 1U0LA 3K9HA 3AKEA 4Q4AA 4EPVA 1HEIA 1XX6A 3AUYA 2XNSA 3E1SA 4C0LA 1G18A 3PUWA 4NP6A 4RD6A 3C15C 1Z6AA 2RMKA 4ON9A 2QAGB 4JT2A 5K8UA 1QHGA 2W6JA 3B60A 5FTKA 4CIDA 3WP0A 4CGZA 2F1RA 1O87A 2AKYA 3AP3A 4JL5A 4MGZR 1NG1A 1XXHB 2HLDA 4IOJA 1IJFA 1YZQA 4BZXA 1I2MA 4D0NA 3QKTA 1OFTA 3RS3A 1G291 4TTPA 4AIIA 2K5UA 3R20A 3TJZA 1AS2A 1E2DA 2XAUA 2G88A 2ZAMA 2ZS9A 5EE3A 2Q9BA 4KV9A 3NDPA 4P0TA 1OT3A 5JEDA 3ZD7A 3CNOA 2GXQA 1PLJA 4GMXA 4AK9A 4ZO4A 1MT0A 5AUNB 2R6DA 4RCYA 1H8ED 5D3QA 2YWFA 3Q7PA 1Z2CA 4O2RA 1Z0KA 5GJVC 4NCNA 2YOGA 4Z51A 2B8TA 2VSXA 1T5LA 3GLFA 4BZQA 5BWMA 4M1WA 1D8TA 3LQRA 1RRPA 2HCBA 1W44A 4M4SA 1EWRA 4RZ3A 4Q5IA 4Q19A 4JT4A 2CVFA 4A8JB 4DSOA 3PV0A 3B6EA 2BM1A 3TUZC 2GF9A 4NYJQ 3PEVA 4QBFA 3BOSA 3TR0A 2WMOB 1ZYUA 1IN6A 4BFTA 4POAA 1Q20A 1GP2A 4HDOB 2GESA 2I1VB 1CJVC 4DKXA 3W90A 4LBZA 2IUSA 4Q47A 3TH5A 4TYWA 5JI3E 2HJGA 4ARZB 1EXMA 1OFHA 3ZGXA 3VR4A 4C0KA 4RD2A 4V0LA 2IYSA 2WWYA 4D25A 2OXRA 5CLLA 4DWJA 3CRQA 3E70C 1W5TA 1JPNA 2C96A 5KSZA 2CNWA 2AXNA 3SJZA 5LPNA 2RAPA 1EFRD 1C9KA 4GBMA 3U6BA 4GL2A 2QPAA 4DVGA 2RGNA 5DHFA 2C2HA 3R8CA 1GM5A 2HV8A 2QTHA 3AP1A 1AS0A 1G3MA 4URWR 3N5CA 2ZXUA 4I99A 1NF3A 2XZPA 3LDAA 3A1SA 5DGXA 1ZNWA 2EU8A 2JDID 1K5DA 1W4RA 4IDNA 3KKQA 1F2TA 3A1VA 4WBSA 5AUPB 1NI3A 2JCSA 4DCUA 4DLVA 3IO5A 1MOZA 3GJ6A 5EUMA 1XCMA 2XB2A 1TTTA 2XSZA 2WV9A 4L9SA 3RSLA 1YZTA 4HAVA 4C3ZA 4IEIA 4PO1A 1SHZA 5KU1A 2RGDA 2IS1A 1TX4B 3HPRA 3KQNA 2J0SA 1QRAA 2YWHA 3CWZA 1GKUB 1OLOA 1Q57A 4K8OA 4ZCMA 2FFQA 1E96A 2AR7A 3GPLA 2AFHE 1COWD 4P4UA 3RYTC 4IDQA 4ESHA 1FQJA 1X1SA 1KO1A 2RHDA 4I1VA 3KTAB 4ZDWA 4DXAA 1X8JA 2RGEA 1E98A 1JEEA 2RGAA 2QM8A 4ESVA 4Q4JB 4F92B 3IIJA 3MMPA 4I1SA 4CF7A 1G9XA 3M0EA 3VX3A 1ZW6A 5C18A 4LJ6A 1K8RA 3Q72A 4G3XA 2O5VA 1KDRA 2ZIAA 2OM2A 2CMKA 4PC1A 4PZYA 1DG3A 1VCNA 2B8WA 1AZSC 4KBFA 2GJSA 1DOAA 3Q85A 2QP4A 2B6HA 2QROA 3WHKA 1FNMA 4BQSA 1DE0A 3B82A 1WDTA 3I1FA 1FMLA 3LXXA 1E1QD 3TSWA 4E07A 1Z0DA 1NN0A 4W9MC 3PIRA 1RJ9A 5JS7A 3FWYA 2ZRJA 4RFVA 3V4FA 4PTLA 2G77B 3A36A 1KIMA 1ZRHA 2WJGA 5FTNA 1XPUA 2DBYA 4RKEA 3A58B 1J99A 2HDNB 1FW6A 4C4PA 5FPHA 2YOFA 3F5FA 2W83A 3NH9A 3OEED 4HLUA 5K8TA 4OI0A 1DAMA 3WYAA 1D6JA 1FUKA 1TQ4A 1XF9A 2IYRA 1XFAA 2J45A 3OE7D 5AJWA 1SVIA 4Q4LA 3NC0C 4CVNA 5EJEA 4BPBA 1E9RA 5FI0B 1R8SA 1G7TA 3E5HA 2FOLA 1X6VA 3MJHA 4YLGA 1E2NA 3UANA 4II7A 3UIEA 1GTVA 1HT2E 1PV4A 4PQFA 1HQCA 2KBEA 3ND9A 1KMHA 2AD5A 1XBTA 5KNBA 5CYPA 5LB2A 3U61B 4DDTA 2J3EA 2OLJA 2LKDA 3WNBA 1GNPA 4JLDA 3UWOA 2DY1A 1S1CA 4KXFB 4LJ4A 5EE1A 2IA5A 4M0LA 2R2AA 2ZJBA 3ZH9B 3T06B 3L2OB 2BJVA 4HB2A 2ZRFA 4GDFA 2FH5B 3FMOB 4I1UA 4MKHA 3ZIAA 2IYZA 2REXB 3B7GA 4B2PA 1XZQA 1TUIA 2ZU0C 3BE4A 4JBXA 1YQTA 4Q03A 4Q7MB 4TSFD 1QHHB 2HT6A 2OEPA 3Q3JB 4EPXA 4G5RA 4L16A 5JSZB 2VEDA 2QBYA 1VG0B 1ZM3A 2CL6X 2QMHA 1EFUA 1RZ3A 4TMWA 2PJRA 4C2UA 4FD2A 4XOIA 2JASA 1Z07A 1GL7A 5IK2D 2WPDD 4I81A 3K0AB 3EIHA 4E5UA 3GEEA 2WAYA 3FFBA 3KJEA 1ZBDA 2ODNA 4S2EA 5AJZA 4GP7A 2FSIA 1QHIA 1XWIA 2PCLA 4ZCLA 1IAQA 1KO7A 2HF8A 2XZLA 3KX2A 721PA 2WOOA 3QXCA 3R7WB 4D2IA 1T91A 4DRZA 1M2OB 5HKKD 5IT5A 5FL7A 3EZ7A 5E3HA 4Q4AB 2Z0MA 3M4YA 4M2LA 3EPKA 5GADl 5JI2E 2OZEA 1NIPA 1J8MF 4BECA 3TUJC 1ZVQA 4ZI3A 2C98A 3U2QA 3GFTA 3K70B 4TYYA 2AD1A 1MH1A 2NO9A 2ZS7A 2GK6A 2F1IA 5KSPA 1N6NA 3JVUA 4JSTA 5FL3A 1HH4A 5LD2B 1XJQA 3CRMA 3BH7A 2J46A 3I3SR 4W5HA 2BKUA 2F3RA 1TF7A 3ZZTA 1VYVA 4WW0A 4EPYA 3BC1A 2C5LA 3KKNA 3AKCA 2VHJA 3SYKA 1IXZA 2ECKA 3P4YA 4TL7A 1CS4C 4JVMA 1HY3A 1YZKA 2W2VA 4GRAA 4ZDIA 1W5SA 4KYIB 2C95A 1JJVA 5CM8B 2P5TB 1GAJA 3U7EB 1S9DA 1FUUA 1Y3AA 3LO5A 5CK5A 5FBVB 4X8HA 5FUVA 3GLFB 5A4JA 2NO0A 4HZIA 4TYQA 4EFNA 1BMFD 1XD9A 2E9SA 5DN6A 1SVOA 2GWHA 3WNCA 3DHWC 1JI0A 4WA7A 4Q1BA 3L0SA 3RANA 1XJ0A 4XVQA 1LS1A 1VHLA 4LHYA 1G7CA 4OHZA 4MGYR 1VKJA 1N6HA 1MO4A 4RVCA 5FUWA 3VX4A 4D4MA 1KI6B 1P3JA 2EYQA 1ZD8A 3RAPR 1GVNB 1N0WA 4V0ME 1OH5A 4ZKEA 1P2TA 4LJ5A 4BFWA 1TU3A 4NKRA 1E2MA 1D2MA 3HDTA 3QF4A 5TMPA 1OIVA 1OKKA 1W2HA 4G0NA 1J70A 3KXLA 4A2QA 2R6CA 3W6NA 2DWQA 4MRRA 5KO2A 3G82C 1ZM9A 1OHHD 1PUJA 1GZSA 4JSYA 3B1XA 3T1VA 2IYVA 1P72A 4UJ5A 3DDCA 1W36C 3BK7A 1KSHA 1FX0A 1ZJ6A 2VHUA 2AK2A 2GAAA 3KQLA 1F2TB 4C0SA 4O0MA 1UAAA 2V6JA 4HAZA 2BKEA 4MYCA 4WZAE 4WXPA 4EPRA 4B48A 1BH2A 3QXXA 5FH9A 1NVUQ 3GJ3A 1KNQA 1R10A 4PAOA 3K09A 4RZUA 4CYMA 2W6ID 5HPYB 1M7GA 1GKYA 4UNSA 1TF2A 2ZAOA 1E3MA 1VDZA 3KQKA 2XB4A 1Z47A 4P4TA 3SYNA 4LK2A 2ZE7A 3KKOA 3KFXA 2JLRA 4FWIB 4RKFA 1TUEA 2KI5A 1AN0A 2ZE8A 2G0NA 1EFTA 4B2IA 2QAGA 3ZIAD 5IHPA 1CBUA 3KUCA 1WQ1R 1QVRA 3KXIA 3EIEA 4M8NE 1KJZA 4PQYA 1M6NA 1RKBA 1XXHA 4XD7D 3ZJYA 2IXFA 3OZXA 4OHXA 1JR3E 1M34E 3B13B 3HJNA 1XP8A 3GJ5A 4MYUA 3CBQA 3B5JA 1KKMA 421PA 2DFLA 4LJ9A 1U98A 1MV5A 2CK3A 4DLZA 4LY6A 4O3MA 2ZPTX 2EVWX 2GAOA 4QJ5A 3AVYA 4QGHA 4LJ8A 4HEJA 4DLSA 4B6EA 4DLYA 2ZI5A 2PJZA 2WZQA 3CNLA 3K0SA 4BGDA 1G6HA 4KITB 3DMDA 5EXXA 4K46A 4A6XA 2GJ8A 1SULA 4YC7A 2QSYA 4HUQA 3RS4A 2R65A 1HQYE 5FL7D 1YE8A 5FPTA 5P21A 1SXJD 3UATA 2W2XA 3QY0A 3IQWA 5ELXA 1P9RA 4A0HA 3C16C 3LLMA 2RHMA 4HZUB 1KI4A 2VP6A 2VHQA 1JR3D 3BRWD 4YONB 4JVNA 3IEUA 1W36D 5B2ZA 2LWIA 3I73A 4Q1EA 1P6XA 1E99A 1YZUA 3C5CA 5KPJA 1EGAA 2RGBA 3HPQA 1DEKA 2GF0A 1NRJB 5HE8A 3EWAA 2IF2A 2DFTA 2QEQA 4QKQA 2EFHB 4GZLA 2OFOA 1H8HA 2BWJA 2IYQA 2ZSDA 2P6RA 1W0JA 4RFSA 3MJRA 2D4HA 1Z29A 3DKVA 4N0EA 3L8ZA 2JIZA 2XGJA 2VO1A 4DSNA 3TNFA 2WTUA 4OK3A 1XMVA 2ZVQX 3QI2A 2VBCA 5CIQA 2BMFA 4FI3C 3BORA 5SZIA 1M7HA 1CRPA 1OH6A 4HATA 1W46A 2GXUA 2OESA 4LHWA 4PC7A 3JZMA 3RABA 1R5NA 3AVOA 2ZJAA 5DYGA 5BN4A 2V54A 4EJSC 2C77A 2QTVB 3LY5A 1E2KA 4NBSA 1A2KC 3TKLA 4NCJA 1OSNA 1Z06A 2D62A 1P73A 4KU4A 2FNAA 1R6BX 2V4ZA 4M1OA 2WKPA 2QBYB 1IM2A 3ZQ6A 4NZYA 4NHOA 1DAHA 1I4TD 2WMNB 1HE1C 2RB4A 4LOAA 2NPFA 4ZI2A 5F98A 2WWIA 4ASUD 2HF9A 2FPKA 1P75A 2O8CA 1KZ7B 3C5HA 2WKQA 4NMMA 4XWAA 5EQTA 4HAUA 3VAAA 2KB0A 5KSYA 5F2EA 1Z6XA 3C8UA 3LW8A 2QSZA 2B7CA 1DARA 4EQ6A 5H1YA 3JZAA 1H8EA 2W0SA 1SXJB 1X3SA 3MGCA 1II0A 2J0UB 2MSDB 2XEXA 4OQNA 4ABYA 5HE9A 1GG2A 1XTJA 1US8B 5FBWB 3WRXC 1IJEA 4A9AA 4DCVA 5CJPA 4OQMA 4Q9JA 4DEYA 3G0HA 3SHWA 2GCPA 3QJYA 4US2R 4E03A 3VKHA 1NKTA 3PQCA 4E22A 4ZDJA 2BDTA 5BXQC 3QKRB 4TWZA 4YXWA 5ANRB 4U5XA 5CYOA 3I8SA 4AD8A 1F5NA 2AWNA 3T15A 4GPTA 4PO9A 4UXIA 3CNNA 1E0JA 3J81k 1SKYE 1NIJA 1Q1ZA 4PC6A 2JJ2D 2REOA 5AJYA 4BFVA 4GNKA 2RGXA 4UJ3A 4DT1A 1IHUA 1J90A 5EXSA 1XZPA 1NLFA 4QGGA 1YRAA 4YDSA 4XJXA 1W4BA 3VFDA 3SBDA 1ZC3A 5EP3A 1KY2A 3BB3A 4TQAA 3GP8A 4UXJA 4Q9KA 1KI3A 1MRSA 2QGZA 2A2ZA 4Q02A 2KBFA 4L9WA 4L8GA 3C7KA 3U5ZB 3CF0A 1EFRA 2GJAA 2OCYC 2A5DA 5CK4A 3FPAA 3UMSA 2ATXA 4B44A 5DLQC 4DLWA 1R0YA 4QM7A 4IJMA 5HCNA 1OE0A 2FA9A 2CDNA 3NC1C 3T61A 3W9YA 4Q21A 1G64A 2JDIA 1UPTA 2CK3D 3BERA 1ZCAA 3LAWA 2A3RA 4EKDA 1G6OA 1VG8A 4URXR 2WIBA 2X1VA 5HZKA 1GITA 1NG9A 4CW7A 3VKWA 4D4JA 1DPFA 4KVAA 4RY2A 4X8LA 5GJBA 3AUXA 4QG7A 2XJ9A 5E7JA 1HV8A 1RIFA 3CX8A 1CR0A 3HU2A 1RFLA 1OIXA 1E2EA 3RC3A 2MSCB 3THOA 2NZJA 2YV5A 1JPJA 3QF4B 2BJWA 2RGGA 4XH9B 3K9LA 1COWA 3K8YA 2CHQA 1AM4D 1JXMA 1XEWY 2OAQ1 3AF2A 3KFVA 1NKSA 4AWXA 2P0EA 2Z4SA 2D2FA 1K6MA 4LCBA 1NN1A 3U60B 2PMDA 1QHHA 2DPXA 2BM0A 3NBYC 1FX0B 3B1VA 1ZIOA 1S4QA 2FSHA 3SHFA 1DO0A 5JWHA 1TQDA 1QZXA 1VPLA 1HUQA 4FMDB 4L5BA 2VA8A 1W0JD 4QHYA 5LB4A 2IWRA 3T35A 1OPXA 5KDLA 4DZZA 4QM6A 1UEJA 1UF9A 3VR5A 2OCBA 4W7SA 3AF4A 2JLSA 1N6IA 1WB9A 1G8GA 2EWWA 4WVFA 1VG9B 5GJCA 2J59A 1MO3A 2VIIA 2KWIA 3QUSA 4K81B 5CIWA 3T5DA 3O8CA 1AIPA 2ZRDA 4GT1A 1OFIA 1TF5A 1E1QA 2IWHA 3BB4A 3K9GA 3TK1A 3CUEF 3T5GA 3QQ5A 4PSKA 2GZDA 3U44A 4MRPA 4M1KA 4B3BA 4DLTA 1AS3A 1KDTA 2O0HA 4TQ9A 1X86B 4MUAA 1UKZA 2NO7A 5C1BA 1FNNA 4XIGS 3KJGA 2XXAA 4DSTA 3CWQA 3CX6A 3OHMA 5KNCA 3W3ZB 1U0JA 3EAQA 2V3CC 5JEEA 1OV4A 1A7JA 2R6FA 3QG1A 2O0JA 4Q7KA 4QJ3A 3OEEA 1SKYB 3CX7A 2OFWA 1EFCA 4WZ6A 4LYFA 3OAAA 3OE7A 1CR2A 1Z3IX 2OO7A 4DDWA 2BCJQ 3LRPA 3TAHA 3FOZA 5J40A 4A92A 1G17A 1N3BA 5FPSA 2CLDX 1G3QA 2ASEA 4LV8B 3U3JA 2BMJA 2GEUA 4PC2A 3H4MA 4YMVA 3LX5A 4HUQB 2O8DA 3CR8A 2FV8A 3Q9LA 3BJIC 1AZTA 3W3AA 1KHTA 4DCSA 3BWDD 1N5JA 3OIVA 4PAQA 3PUZA 3NHAA 1Q21A 1Z22A 2WKRA 2OHFA 2GHIA 3CZQA 2A5YB 2KE5A 4IOKA 1YHNA 1P61B 4V0OA 5TXGA 1MRNA 3NTUA 2VSOA 2ZI4A 3L43A 1UEIA 2D2EA 4YXWD 3GLGE 4D81A 4TSFA 4Q18A 2BBSA 2IXEA 5EZ6B 2A5FA 4A2PA 1CTQA 1PUIA 4HB4A 3NH6A 2VQSA 2YINC 3B85A 2P67A 3BH6A 3GLIE 2C99A 2NO6A 4D4LA 1KI6A 4RFSB 4BLQA 5KTYA 5IK2A 2WWXA 2WPDA 3QBVA 4XWOA 3BFXA 1M74A 1R0WA 5SZKB 3U3MA 2IX3A 4FW9A 2YNMA 1S0UA 1CIPA 1ZM2A 2GZAA 3VR1A 3O8BA 1CP2A 4PPQA 2PT5A 4LHXA 4H1UA 1B0UA 2IS6A 3VKGA 3LVQE 4LUCA 3K1JA 5KNDA 3QBTA 5HKKA 1LFDB 4B71A 4FINA 2JLUA 1OYYA 4B3FX 1ZIPA 4LBYA 4RD3A 3T1OA 1ZM7A 3FMIA 4F4JA 4FMBB 3U3KA 1XCPA 1Z5ZA 4MKGA 4NONA 4B75A 3R9WA 4EIWA 3B9PA 3MUFA 1T4GA 1VECA 1W49A 3A6PC 3UMFA 2VPPA 4GMDA 1EG7A 2XX3A 4MA4A 1XU4A 2V7QD 3W5IA 3LD9A 3ONWA 1RPZA 4OYHA 4TLDA 5IF9A 3WMEA 3GEIA 5JHHB 3MWJA 3DM9B 3A4MA 3HU3A 1FOEB 2O8CB 5GJWC 4HLDA 2IW3A 3SFVA 3A1WA 1EESA 1WXQA 3TBKA 2WIAA 4HAWA 4P32A 3DO6A 1HT1E 4AKGA 3L82B 5BQ5A 3K0FB 3RRNA 3FKQA 1XTSA 1E2GA 4EQ6B 1NJFA 3LX8A 3ZS9A 2YJTD 4B35A 3W5JA 4IFBA 4XTCS 2QN6A 5AJVB 4Z1MD 3PCRB 3EPJA 4LHZA 2XNDD 4EAQA 2ZU6A 3FDIA 1NY5A 4PHTA 1FTSA 3EPHA 4A0GA 2A30A 1BMFA 4IKEA 5L3RA 2ZRIA 2ZJ2A 3P26A 3Q5DA 4G1UC 4LI0A 4MYHA 1XEXA 3N2EA 3QXHA 1YKSA 2OILA 1WCV1 1XTRA 3TIFA 3I5YA 3LXRA 2ZRPA 1ZCBA 2L0XA 2ZSEA 4G01B 5E7IA 3THYB 2FZLA 3VMFA 1CJUC 3QE0A 1P2SA 2QRNA 3NEYA 2IUTA 3UG6A 4NYIQ 4FCVA 1JQJC 1UBFA 3WHLA 5FOWA 3WMGA 4BUJA 3F0TA 3TE6A 4DT1B 3AP2A 5C4MA 3NWJA 2ZYWX 1KI9A 1KI7A 1OJLA 2R62A 1G3IA 3TGPA 4HZUA 2KSQA 5TY0A 4ERNA 4NTZA 5CITA 3HP1A 1AQUA 1WF3A 4B3GA 1EFHA 2FSFA 1X8LA 5J5CA 2G9NA 1WRBA 1D2NA 4MRSA 2ZVPX 4F4IA 1OHHA 1OIWA 3CKLA 1Q22A 4N1AA 1PJRA 4B47A 5FFMA 3VTKA 2VYFA 2D7CA 3TSOA 5K8IA 4C7OA 3EZ6A 3CPJB 5L3SB 5TARA 4JZKA 3CH5A 3OAAD 3WBJA 1GIAA 2D74A 3MWLA 2AFIE 3MLEA 5G41A 4PZLA 4FIDA 2FEMA 3VNVA 2ZE6A 4V0MA 4F93B 2CL7X 4TYPA 5JLJA 1D9XA 3U3RA 3T34A 1DVRA 1ZP6A 5FBRB 3VHXA 2G6BA 2W6IA 3EG5A 2EFCB 2IXGA 1CRQA 2ZI9A 4JBYA 1E2PA 2YZ2A 2R6AA 1Z28A 4X8OA 1KY3A
chains in the Genus database with same CATH superfamily
3A8TA 3U40A 1HPLA 2PDAA 5FUBA 5AVSA 1UP7A 5SY4A 4IDPA 3AEYA 1QPZA 4DV1B 4HDKB 4OGKA 1WPXA 4G4SP 4DQUA 4MVJH 3L5OA 2FFJA 1OYOA 5D7BA 1AOXA 4W8OA 3DOCA 5GZ6A 2J9FA 4EI9A 3FRHA 4KWCA 1YDHA 1C0EA 2FLWA 3GRFA 3HVUA 4BEJA 3UGJA 5J2TB 4YBRA 2ODBA 3AETA 5DOVA 3VO2A 4LN1A 5KTPA 3PYXA 1GXSB 1U9CA 1WF6A 3QKWA 2R68A 2GM3A 1E0KA 4L5JA 4E5VA 1RS0A 2NADA 3ZLUA 1SCUA 2UZ0A 4B6SA 3I5XA 1EZ1A 2Q3HA 4JYBA 2YNMD 1X8XA 2PZMA 4HH3C 1V5GA 4NL4H 3VC3A 2QRGA 3CLTC 3QU9A 4YHBA 5FA8A 5CA1B 5I47A 2C97A 2JBHA 4EHJA 4GZ6A 2J0QA 3O1IC 4CLDA 4CLEA 5E6UB 2QT0A 2JGNA 4QUHA 4X44A 2GZMA 4XIYA 4DIMA 4UQOA 2R96A 4KZPA 5KOHB 3LY8A 1QE5A 2VH5R 2WZBA 1Q95A 5ITVA 1ZH8A 3IT2A 5REQB 5AVZA 2WJJA 4Q3KA 1ZZGA 3U44B 3AFGA 3KCNA 4FGLA 1US8A 5AK0A 5IJ9A 1ZWLA 3BRWA 2JJ1D 3G0GA 4RVSA 1JKJA 3OH8A 2J9GA 4Y1RA 1QMGA 3RWMB 2RB5A 4WKCA 1PD1A 3AXSA 2QLLA 2UYCA 2FF7A 3VNUA 2A78A 2BOVA 3P1JA 3QKRA 3LUGA 3GEHA 3AO0B 2Q6LA 1BHSA 3I9KA 2QTFA 3OZVA 4C0QC 4KN5A 4HXEB 3MTQA 4KWTA 4KVGA 2QGNA 4M46A 2VBIA 1H9AA 4ZI7A 4L50A 1DU4A 3KU1A 1KSJA 4JA2A 3CG4A 5H5JA 1T4BA 3ZVRA 1DJNA 2PX8A 2QYHA 4O4JB 2H1VA 4RD4A 1O97D 3N0XA 3OQBA 1G19A 4NE2A 4JUIA 5AP9A 3R77A 4HDCA 4JKIA 5EXTA 3CTPA 4TTRA 1C9YA 5CT5A 5JPIA 3AVWA 3LXMA 2A1UA 3REGA 3AVVA 1H1LB 4O1IA 3S2UA 3MFYA 2Y68A 2CZGA 5T57A 1VLVA 1VPVA 2FP3A 2LKCA 3MLAA 4EJ2A 1KTIA 3LBHA 3LECA 4YV1A 2DQZA 3L6RA 4IEFB 5FFFA 2OFXA 3FUWA 1FTWA 3D0KA 3K1ZA 1XMIA 2BEKA 4N6OA 1YNSA 4ZRMA 4EG7A 4S1NA 2FSSA 4Y2XA 1RJFA 4R2KA 3BXGA 1MX1A 3VPGA 1P2UA 3CVXA 4URYR 8LDHA 3WGZA 4RM2A 5JH7F 4BE7B 1GTG1 5K4HA 4Q1AA 4ZOLF 2H16A 2J30A 4DJAA 1XDBA 2OG1A 2Q5FA 1WOMA 4OB8A 1RRMA 5FUYA 1G5QA 3RT1A 1LSOA 4QIHA 1VB5A 3X43A 4AJ1A 1IMJA 3KKKA 4CWAA 2Q4EA 1MN6A 2QX7A 3CLTD 5DM60 3QLEA 1NVAA 5SZHB 5GQSA 3IB3A 2A9QA 2QTNA 1NVDA 3SSOA 5LWQA 2H4JA 3IELA 1KPHA 4RBNA 5F9FA 1ZG3A 3DDHA 3NKVA 2O7NA 4OQZA 3VBCA 5E7MA 4ZK6A 3ROKA 5D6OA 4F96A 2DCUA 4QU9A 1CB7A 4BNKA 4BRWA 4EPWA 2J4FA 5E0OA 2YX1A 3AL2A 4Q01A 4U02A 3UMGA 2O5EA 1PYDA 1R0KA 1SZPA 1L1EA 4JEHA 2XKJE 4MVXA 1I6MA 1PX0A 1DO2A 3H2KA 4M0DA 2JLYA 3H04A 1V43A 2X19A 3KCQA 1UBGA 3CQ9A 3T6KA 1O6ZA 3B6IA 4AS3A 1JS1X 3WQQA 2CUTA 1A8QA 2R7LA 2HCJB 2QLBA 4CTMA 3U6KA 1OV6A 3QHPA 4L8WB 1GYPA 3OHPA 1MQSA 4OQXA 2GBPA 1BCSB 1TRKA 4X71A 4A6PA 5JECA 4OK6A 2OCPA 5TB5A 3PHCA 4DCTA 2G3YA 2OV6A 1UWKA 4YJ2F 1DCFA 1SHJA 1VE6A 3QNMA 4C0BA 2H1CA 2CFCA 3NHKA 2EWVA 2BBWA 5K1ZA 3AX6A 3M6LA 4GPZA 2I6SA 4PSVA 4UM9D 3KSBC 1T0PA 2ZRLA 4Q9IA 3Q3EA 2VZLA 2JJ2A 2ONZA 3TQTA 3IQDB 4IGEA 2AG8A 2V7VA 3ICEA 1Y1TA 1PLKA 1BYIA 1T5SA 3CXUA 3HFGA 3U31A 4F06A 1EP2B 4E4TA 1Z2DA 5B4UA 2QL6A 5BUZA 3TG8A 3PR2B 2IUFA 1Z0UA 2DR0A 4R84A 3B78A 2E1RA 4CFYA 4H7EA 2Q1SA 2AQIA 2IT1A 2WSSD 3TZKA 3TVYA 3UAWA 3V8VA 2HSEA 1QPBA 3OCXA 5AM1A 3PGXA 4GQBA 3RSFA 3DWGA 1ZWKA 2DULA 3NQ41 2FN7A 4MAMA 4LYHA 4MWTA 4EI8A 1YQUA 3O2NA 1M54A 2QNIA 1XCJA 4Y67A 4AG5A 4ND6A 5J5AA 1N1GA 5ADHA 5DCWA 1UOEA 3GVXA 2F43A 2PK3A 2YY5A 4BPRA 4TVKA 1Z7EA 4XJSA 2SKDA 2V74B 2HJWA 1IUNA 2ZKLA 3BDVA 4X3OA 2V6BA 4W1QA 3TFWA 4M1QA 4QEZA 3W8FA 3PUKA 5C8XA 4LPSA 1EPUA 4R1MA 2QN1A 4AXBA 3OPQA 4B9EA 3NBXX 2R8ZA 1T3TA 4EY5A 4NYJR 1AQIA 4WLOA 2EW2A 1Q1EA 4BQNA 2O20A 2R6HA 2XZTA 2H5LA 3QEJA 4ZARA 3TF5A 3EB9A 4IHJA 1K5GA 3VZBA 3OICA 5JCZA 3Q87B 2YMPA 3T3GA 3DKKA 5LIRA 1L9KA 4GE3A 5FNZA 5K2MA 3SAJA 4W5OA 4PLHA 3EZYA 1S7GA 3PUXA 3OIYA 4RTLA 1VJGA 3AFIA 3THWA 1KI2A 2ID8A 3K6SA 1YSCA 1BKDR 1C3OA 1QZ3A 3OE5A 1YBVA 1EXVA 5JASA 4J16C 1GCIA 3IMCA 3U37A 4E30A 4OLBA 5B37A 5JUWA 2NMVA 3A4TA 2R1VA 1FMJA 2HLHA 5KYXB 1X1QA 5LUAA 3FTQA 3OCWA 5JBIA 3PWKA 2I1QA 3PFIA 3ZBUA 2RHBA 4JVSB 3HR7A 3KYCB 1OWMA 3LP8A 3LWNA 3ESXA 3H5IA 4NV1A 1HORA 4YV7A 2AFRA 2C78A 1J97A 1ECJA 2C20A 3LCMA 4KE6A 5BW6B 1DKOA 3S44A 4CN9A 4AY5A 4NOJA 2XDAA 1XO1A 3R6WA 4ZA2A 4Y9DA 3NTRA 3RHSA 1UM8A 4J7UA 4MWCA 1QIFA 4C6TB 3I52A 1YGYA 1VL5A 3A6HA 3I37X 3L0PA 4BO9A 3HGQA 3ASYA 3TMAA 2RGUA 4KN9S 2XTZA 1C1HA 1PT9A 5HFNA 4FFLA 2FEOA 1JAZA 4OHYA 2FEXA 1GLNA 2C2XA 1CDDA 3M2PA 1CRLA 3OZUA 1YFKA 3IVGA 4R2IA 5BNTA 5A5DA 1GU7A 2YRWA 4PZUA 3IEKA 3VPHA 4R2WA 2IC5A 1HL7A 4JLVA 3FZYA 4DA8A 3FPCA 3G17A 3OCZA 1ODJA 4ALKA 4CRWB 2BBTA 4N7JA 5EKDA 2JJ8A 3WRYC 1A3CA 4LDAA 2XCIA 3E4DA 4LSZA 4XJVA 2I22A 1P0FA 1DCTA 1AV6A 1V7CA 4RHUA 3DE0X 2ZRHA 5CB4F 2H7XA 4NF2A 4OXXA 2PL9A 4R6WA 5CW1A 2D0IA 4I50A 3B6KA 1M1ZA 2W58A 4Y6OA 3DO5A 3UUWA 4UPEA 3WMXA 2ZSBA 1E5QA 4NFHA 4PCAA 4YJKA 3V2HA 1KH2A 4EBFA 1JDNA 3C48A 1HR0B 1T5IA 4LXXA 2GJKA 1KE2A 2SCUA 3CW9A 3FPJA 4BQIA 1Q1BA 3HCEA 5MGNA 4MIEA 2WTEA 4DJTA 3RUPA 3FHOA 3IAXA 4OQDA 3TLYA 4YCBA 1E4YA 2MMGA 2HMUA 1B2LA 5EVCA 4TXNA 5MGBA 4AKIA 1XLWA 1Z08A 4PO8A 2FPWA 3EEIA 3G5UA 3LQQA 3KU4A 4BV9A 1W5FA 3CMMA 1E9AA 1UPCA 1Q0RA 1O8CA 2HRBA 3K8QA 3LQYA 4PX2A 1ZKDA 2JCXA 3QE9Y 1S2IA 4URUR 3AOEC 4RJJA 2XH8A 2VYVA 3GFGA 4MKFA 1JE1A 2O1SA 4HADA 4YO7A 3UENA 2FWNA 4BNZA 521PA 2KJQA 3THYA 1BDIA 1LLDA 4RGVA 1WMFA 2PAFA 4CG1A 4WD3A 3IBGA 3ST7A 3F2VA 3FZQA 3ORHA 4L51A 4UKDA 3CC8A 3N1UA 3P32A 5JAQA 3WFZA 2PT6A 3TMYA 4E88A 1JR6A 2EWMA 1SKBA 3SHQA 2WILA 1YRHA 2G9ZA 4F1JA 4OMCA 5EJ7A 3I39X 4DF3A 2EQAA 3DXXA 4K9SA 1UDXA 3PNMA 2H4WA 4L0MA 2GGSA 4HO1X 2C31A 3KKLA 4E2FA 4RMNA 1YMUA 3FFAA 2CDAA 2K87A 2FY8A 5AI0A 4LDQA 1P77A 1YU9A 1HDRA 1O89A 1CS0B 3LUBA 3BILA 2OCAA 3VJKA 4L85A 4ZEVA 1WVMA 4QQNA 1S01A 1XQYA 2DXIA 1E64A 2PUDA 3AHIA 5KUTA 4GP6A 5A0FA 4OK5A 2JIOA 3MCUA 3B1ZA 3G9TA 3GLIA 2IXTA 2CL0X 3OECA 4POOA 1QHYA 2XY4A 5J63A 1X7DA 1AC5A 4CKXA 4UD6A 2A7QA 1M5TA 4ZXFA 1FP2A 5E1BA 2JNWA 5EJ9A 3AI7A 2V7QA 3EUFA 5E2BA 4GOMD 4P6VF 1LZKA 3MEQA 1GPBA 1KNXA 7YASA 4TKUB 1BROA 3HXQA 1HT0A 1X77A 3R23A 4CKZA 5KREA 2FW0A 1Z6ZA 9ATCA 3LVBA 1RABA 1O94A 2P4QA 3IO3A 2UZ3A 1PT7A 3ELDA 2NPIA 3LKZA 3VNQA 4H1TA 4PRKA 2HT1A 1VA5A 1XROA 2FPGA 4X91A 3ABZA 2M1ZA 4TLEA 5AKKA 4DLUA 4Z6KA 4QTZA 5FT9A 1AE1A 2EL9A 1U1DA 1PGJA 1JIIA 1JHDA 3WB2A 5CH5A 1L5FA 1LX6A 1NJ6A 1XKLA 3H1GA 4J3FA 3GRVA 4OL9A 2QMZA 4Z1MA 1OAOC 3VR5H 1EJ0A 5C5EA 4MVYA 4FI3F 1N5DA 1M67A 2H3HA 3GVPA 3KQSA 2I67A 1JSXA 1T3ZA 4GRDA 2B2CA 1TGYA 3UYKA 4ERXA 1PQUA 1I2AA 2O7QA 4CV3A 2ZS8A 4OGLA 4P4SB 2WBLC 1OTXA 1Y0BA 1Q6YA 3H84A 3ESRA 3WMWA 4B7AA 4JN6B 4DA9A 2VNSA 1Y8RA 3OESA 2P5UA 1E0AA 4FN5A 3IS3A 4AF6A 1RVV1 2AR0A 2IPAB 2AMFA 3JYQA 4L2IA 4RSMA 1X2BA 4JJAA 4W6QA 3DPUA 2OXFA 2XIJA 4FPXA 1EB8A 2JF0A 2ZK7A 4ZQBA 5C53B 5EJFA 3VI3B 4NPHA 2DX7A 2YWGA 2YZMA 1MENA 4Q48A 1MC8A 1NOJA 1EFPB 1KEUA 2EIXA 1GZDA 2VLBA 5DH9A 2JFUA 2P9HA 2BELA 4RK7A 1BN6A 4GGPA 1CR4A 1MO6A 3DCYA 5K0NA 2JGEA 1X7YB 1M2GA 1PHRA 3E05A 1NQOA 4OHPA 3C1OA 4GHWA 4JODA 1KC1A 2WVHA 4P54A 2HI0A 1OLXB 3L77A 3TOZA 5AFSA 1MDBA 1CR1A 5BN5A 3CT6A 4C4RA 3A1TA 3OLZA 1SPBS 4QVGA 3BJRA 1T26A 3JWPA 5EIOA 1E6LA 3CLUC 2ZYHA 4FDLA 4NBLA 2XJ4A 4EJSB 2G8NA 3SKYA 3JQ9A 2ZRNA 5LBTA 1SBTA 4KXUA 4QT4A 4X66B 1XPJA 3BF8A 4QO7A 4HAOA 1GNSA 1Z2NX 4RZ2A 3QH4A 4MGIR 4PX3A 4X7RA 4BHTA 1KFEB 2FZCA 3PJRA 5HBGA 4MMZB 3SK0A 1FMTA 3U7GA 4PIVA 3IOMA 3AVXA 1PS9A 2ERYA 1T2NA 2X7XA 1BMDA 1JB9A 4JB8A 4S2UA 1Z5VA 2FQYA 3BFKA 1F2UA 1BHQ1 1G1MA 1QCDA 1TZKA 3EC7A 1VLJA 3QEKA 3ADDA 1JHOA 2EZ8A 3DMRA 3IAS6 1NBME 2HDWA 2XUJA 3Q0EA 1QAQA 1FBTA 2ZBPA 3HUTA 3KG2A 4AZ3A 2WB2A 2I8AA 2GKSA 3FUTA 1XVIA 1XR3A 1ONSA 2VRWA 3CJRA 3FZNA 4R2JA 4FX5A 3T0GA 3ZCUA 4NCKA 1M8JA 4OCZA 4RQAA 1VYHA 4IJWA 4ESOA 3A4IA 4QHTA 3R7SA 1REQA 1XJCA 3V8BA 2A9OA 2B2XA 2IYTA 2XB6A 3HR4A 3ZOKA 5CDSA 1PT8A 5CH3A 4ENQA 3O6VA 2JH8A 4L95C 4PAGA 4QL3A 2X3FA 1GSAA 2XQJA 5BSMA 2XTNA 3FNIA 1ATIA 1XKXA 2HA4A 1UM9B 2DUNA 2G40A 4Q4HB 4X8MA 4CCSA 4ENRA 1Q16A 1KOFA 1QDLB 1SQ5A 2IHYA 4GKAA 4YN3A 5FI1B 3VU9B 2P0AA 2GN8A 2VDLB 4MUMA 2WB4A 1ABEA 3VU0A 4WESB 3EFEA 3NVMB 1FDTA 4YAFA 2CJXA 3GNLA 4JXKA 1WB6A 4Q1DA 1NBMD 3N28A 4I9GA 5FTJA 1MCZA 3T95A 2GILA 5KNDH 2W48A 2O50A 2QPTA 3EY9A 5K0CA 1NXPA 2JHAA 1K7YA 1VLZA 1Y8QB 2QT9A 4CHGA 2HZBA 1JI3A 2ZE5A 2G5CA 2QORA 2R79A 3A9RA 5DTEA 5JZVA 4KQ2A 5EP1A 1CZHA 4EA7A 1J0EA 3D4PA 3QXSA 3UK6A 1IOVA 2ZJ5A 3I6ZA 4BX2A 4IUDS 3GAFA 3KZOA 1ZI8A 3OT1B 1I5RA 2LGJA 1HRKA 1RD4A 3IAUA 1H93A 4PPGA 2FG7C 4BVKA 3HRHA 3PRYA 3OX1A 1NR5A 4D9CA 1EHCA 4EW3A 2QPOA 1N25A 3TJMA 1DJQA 1IWBB 2R11A 4RO0A 4YDQA 3FMFA 3TSCA 4C07A 1P1FA 5IDVA 4QOFA 3ZDZB 3UMVA 1GQ2A 3ELYA 1H4TA 4XARA 5K9ZA 1CUGA 1W47A 2G4LA 3DBVO 3WFIA 3A4NA 2ZUVA 1FFHA 1G21A 2YWBA 1QS0B 1RI3A 2EZTA 2P91A 4JBWA 1XZ8A 3DZ8A 4IXNA 1MAWA 1TMYA 3L6OO 5HSGA 2I6GA 3F2IA 1GU0A 3NZEA 4WN9A 3EFHA 4XX0A 2O8EB 4CG3A 1YH3A 3RR2A 4KIWA 4G24A 5LQMA 4LRQA 5J4HA 3OJEA 2CE7A 3AERA 3JAWA 1S1MA 1GPH1 1H23A 3TLBA 3O3OB 4LV5B 4ZVUA 4OGFA 2IYUA 4ZZ2A 1X14A 2Z2ZA 2FPOA 3QG5A 1LV7A 4LNUA 4RPHA 4MUHA 4YDHB 3KZKA 5EWLA 1B2RA 3FNHA 1K6XA 3GFBA 4AJOA 6Q21A 2JB9A 2BR3A 4WOJA 4YA6A 4QQRA 3G7NA 4JUFA 4NU8X 3OSUA 3EDYA 3UMYA 1F06A 4F21A 2PX5A 4N3CA 1ZUHA 2Z5FA 3I2FA 4BVFA 5B30A 1J5PA 2ATIA 3NLLA 4RHXA 5SYNA 3EA5A 1VRCA 2WU4A 3SD7A 1ISGA 2J0VA 2OUIA 2CN1A 4N9QA 4AJKA 4AJHA 3LM8A 5K0SA 4LDNA 5L3VA 3CW2A 1YB5A 4OPMA 5M34A 3P4XA 4HQKA 3HBJA 3ZJUA 1E2QA 3AF1A 3LCCA 1AY0A 2EFYA 3O8DA 3V00A 5LP6B 4MICA 2OQRA 3AIKA 3BZWA 3L7IA 1GADO 4EX7A 1VCIA 1Q7BA 4OU4A 3OFNA 3EASA 3WL8A 3BX1A 3JPWA 2OGUA 4RZSA 2OBBA 2B1IA 3EA0A 1XTZA 4X84A 2MCFA 4CJXA 5IT0A 2FFHA 3WTCA 3RRZA 4N47A 1NP6A 1T9DA 3R2JA 4WAUA 3RJTA 3LF1A 2RGYA 4DEXA 3BICA 5FBLB 4ZDKA 1XRLA 4JWTA 4I55B 1SZJG 3EOZA 5EHQA 3KUXA 5FWYB 1FP6A 3HCWA 3OLQA 3R3JA 5JXHA 1DFGA 4FUQA 3NT5A 1DBIA 1USVA 3QPUA 5LJLA 2A9VA 2V59A 2O5RA 2QUBA 2X0KA 5AW2A 4MYSA 3ZYCA 3U0VA 3SJBA 1PV2A 3PA8A 5I9MA 1CQJA 1MVLA 1AGRA 2IL1A 2QU8A 3EGWA 3KPWA 2LTAA 3MRSA 4Y6PA 5F64A 3NFYA 4HWOA 3R3UA 3U81A 4N6GA 2EX4A 1SUFA 5BRNA 3EFOA 3EXFA 3TTTA 3BWXA 2BFEA 2AKAB 1OVMA 1UJ2A 5AI8A 1CXZA 2ZIXB 4R1PA 3T5MA 1K8YB 1Q1QA 3TO5A 3ECCA 3ZUGA 3A04A 5HHTA 3NALA 4A16A 1K27A 1MIOA 4DMRA 1RZRA 1FS4A 3B3QA 3I9JA 4AYTA 5F3DA 4J07A 1EWKA 3ZJ4A 1DQYA 4K03A 3SIWA 4FZRA 2SKCA 1JMVA 2W6JD 3UF0A 1L5KA 5BYKA 1CW2B 1JQBA 2IYLD 2HUNA 4ODIA 3S1LA 2YWDA 3U0BA 1MAHA 1EJ6A 5GM2A 1ZINA 4DMMA 1I1HA 3GLFE 2XLBA 3FOWA 2VF7A 2C9OA 3DCIA 4CKWA 3N70A 5LWHA 2CHFA 5I5GA 4R2HA 1JJ7A 4LTNA 4I3GA 2GCIA 2HM7A 5B12A 1F8XA 3WBKA 4BNDB 3QYFA 5J47A 5CPBA 2DP4E 3EGXA 4ZCRA 3BMNA 4EKGA 4HQLA 4J2OA 4OJYA 1XQWA 2R6JA 1X42A 2VF5X 2YOHA 3FCAA 4B5LA 2L19A 1TMOA 5DNWA 3S2YA 2P9GA 2VQDA 4PCLA 4H77A 3QP9A 5FTWA 5DBEX 1AH2A 2EGUA 3O93A 2IYXA 4LBWA 3BFVA 2OZLB 2SICE 1UC5B 4QULA 2EJCA 1VG1A 1GDDA 4CTJA 1UQTA 4DQKA 1QYRA 4EB6B 3RAJA 1HLDA 4QUBA 4D5EA 5IULC 1JMYA 1PGPA 1X94A 5BWBA 4JXZA 4IV0A 4ND1A 3EGDA 3FLEA 1K7SN 3G5TA 3M7IA 4TT3A 5FKJA 4IDOA 2CNKA 4CQJA 3IKLA 5BQOA 4XZ3A 1JDJA 4UNNA 4OUKX 2PJUA 1AKYA 4HH1A 4PQGA 2N75A 3O4RA 3PE6A 3PFWO 5BRAA 4LC9A 1PR4A 4D9IA 4L73A 4IIJA 3RTBA 5F2NA 5EWMB 2Q5CA 4LMPA 4O33A 3DM5A 4XLTA 5H82A 1UR5A 3U4IA 5LZ5A 2ZWPA 3UHFA 2QPLA 1GPUA 1XTIA 4YUWA 4Q24A 4JFAA 5BWOA 4I46A 1FP1D 2ZBDA 3JRXA 1L7BA 4U8GA 3AJ9A 5DYNA 3H13A 2IDZA 3CEHA 2ENWA 2ZT7A 4FJ0A 5BW5A 2BP7B 3RS5A 1NDHA 1R0XA 3BG5A 3NVAA 5AHXA 4D0SA 1NMSA 1RPTA 1U5CA 4PVCA 1P9WA 5LJIA 1IHOA 4GI2A 1TK9A 3R9IA 3B3AA 4MR8B 3ZLBA 3ETDA 4QTXA 3TW4A 1X8KA 2PZBA 2QG6A 3GZ4A 4IDFA 3TBFA 3W9UA 1LLUA 5TPWA 3WC4A 4OJTA 3E2PA 1P45A 1AHIA 1UMBB 4CEIA 4KPYA 4PX5A 1CRZA 4JP1A 2YHIA 1M1YA 2PGJA 1PAUA 2W6QA 2BW0A 2G1KA 4G4IA 4C9BA 2XGGA 3ZEIA 1CU1A 4L6IA 5KNLA 4LGVA 2G72A 2X4LA 3BXEA 1LTQA 5KBYA 1MJGA 4BO7A 1V11B 1YJ8A 4QBGB 1D1SA 3LV8A 5HEKA 4D8TA 4LFAB 2A1IA 4HLUC 4KH0A 4O8ZA 4CF3A 1RXEA 1KFKB 2J87A 2VDRB 2ONJA 3RIYA 3GLSA 1GR1A 2CV2A 2ECOA 3WGYA 4H7JA 1E1NA 1N2BA 4EG0A 3QOXA 5C5DA 1E2FA 3AHEA 3BZUA 2CJWB 3KQUA 3WAJA 1HE4A 1NOIA 4TRRA 4CF5A 4QG3A 3DLHA 1ZK1A 3IESA 1NBWB 3NAGA 3TNLA 1Q0HA 3Q10A 4MJXA 3U3XA 1CUCA 1LQTA 2WUWE 3V8MA 4DY4A 1FTQA 1DHRA 1K2WA 1MUUA 2W70A 3IAM6 4EKNB 1I6KA 1N2CA 2JAQA 1KKLA 3O73A 2AFIB 5DO9A 5CBKA 3WK8A 5ER6A 2HIHA 1Z2AA 1SG0A 4O29A 1VIVA 3JYNA 1IVSA 4XFKA 5EJ2A 1AKWA 4CMEC 3UBTA 5A0VA 2DYKA 2ZT8A 1E2HA 3BF7A 3ZWCA 2DWPA 4G65A 2VTBB 3IP5A 3QE4A 3LDGA 1EDEA 4KAFA 3WFJA 2OZPA 5ITZB 3LLVA 3MINA 4BKRA 2L42A 2V4UA 2JARA 1PJ4A 4FEAA 1FEZA 5EQJB 4CV1A 1Z4NA 1G5TA 5EERA 4U63A 1JG7A 1XMSA 2CVQA 3CF6R 4IYJA 2QG4A 4E3ZA 4JS0A 2XZOA 3OKCA 4LXYA 1Y8CA 4CT5A 4FOSA 1U7TA 3U4QB 2BFFA 1TAHA 1QIJA 1F17A 4ZCPA 2JIRA 5FLYA 1YCDA 5I8PA 2I6XA 5DI3A 2C9CA 4FMPA 3E1KA 5HF5A 5JFOA 3TGLA 3KJFA 4NVRA 3D7KA 3GEMA 1UKYA 3WWYA 4D4HA 5K7SA 2FSGA 2JLWA 4YMWA 5DE3A 1EWTA 2R25B 1W0CA 3TLGA 5CGQB 3GGJA 3ZQJA 1H3EA 1VHWA 4DJEC 5A3JA 2HJSA 2PZLA 2AOWA 3HHPA 3PQDA 4B80A 4BMPB 5A9RA 3EXIB 3INYA 3OIWA 4JOQA 5CNJA 5AVOA 2XGMA 2WEKA 5FTMA 2DT8A 1Y5LA 1Y7LA 1LPMA 2GFHA 5EA2A 2P2YA 3C6XA 2BGTA 1E3WB 4H1WA 4FSXA 1C7RA 4KXNA 3GQBB 4JL8A 2VXYA 1Y9AA 1Z3CA 4IGFA 3RS2A 2WJAA 4QELA 4PYKA 1F60A 4GD3Q 1GV1A 3S8EA 2ZQ5A 5G3YA 1FF9A 4JY7A 4RJKA 4Z53A 1JB1A 2DCMA 5H83A 4RH0A 5AXBA 2GWRA 1FFEA 4L9AA 4OD0A 4Y18A 1N6LA 1ZH0A 3OQVA 4OHBA 2R87A 3H1EA 4QRDA 1TKBA 3F74A 3DZHA 3S1AA 5AVUA 4PWZA 1EDZA 3UCEA 1JQ5A 1Y4DE 2C0PA 2IHZA 4DNQA 3DHEA 1QBGA 4HEQA 3UKDA 1M5RA 4V03A 5JQGA 1JHAA 2GVDC 3TVTA 3W34A 2VP3A 4F0JA 1BHO1 1RVDA 2ABWA 4JJZA 4B3CA 2O3QA 1L8QA 3CEAA 3NG1A 4Y1EA 3SS7X 3LMKA 4XOUA 1T8TA 2B0CA 2QT1A 3N0WA 3AU8A 3OY7A 4RDCA 2IZ6A 5KOIA 4BCBA 1RJGA 2OV2A 1E94E 2Z1MA 1YJAA 4IMPA 1IXRC 4L4XA 3Q7IA 1M6VA 1W87A 3H1BA 3ILSA 4TMKA 2QKYA 3MIZA 4KGZA 4L4RA 1AXEA 1TLLA 2G28A 4ZO8A 3ETNA 3IGFA 2ZW9A 2EX0A 1WOYA 2X13A 3EF0A 3IOEA 4DLXA 2FDCA 3ILHA 4MVJE 1CP3A 3SZRA 1GSOA 2GKGA 2PH5A 3N39C 4JL6A 2XQIA 2XUQA 1JFFB 3Q7QA 1F7VA 2WG0A 1I1OA 4U00A 3TRDA 1T29A 4EJ6A 2KMLA 1Q0PA 3PVSA 1JQLB 5BMVB 1Q0TA 4AULA 3TLEA 4UARA 2HA0A 3FBGA 2EFGA 1LRKA 1IDOA 5JS6A 3KOXA 2V9PA 4BMCA 1YC5A 3OJ0A 4KX5A 3I83A 4TRJA 1ZXLA 4U2CA 5EUCA 4ENTA 1T15A 4MQEA 1B1AA 1ZD2P 5C32A 5HS6A 2A9FA 4IIGA 3JQFA 3MELA 3OSZA 2PL3A 2BJHA 4JENA 4OU5A 3ZY6A 1PZFA 4ND2A 4AKHA 3VZDA 1CUVA 4U9HS 3HSKA 1X74A 4GOJA 5ILQA 3WMRA 2F59A 4F84A 2ZYVX 3NWPA 4MVJD 3QOFA 3CF2A 1TQ6A 4GW3A 1PJ8A 2Y3IA 1XB2A 1HC7A 2J5RA 1R5OA 1U0FA 3CKMA 3OA2A 1T6YA 2GBFA 4DMHA 1CPYA 4RY9A 1RJ9B 1KSGA 1R9MA 2NV0A 2W5UA 3AFMA 3LQ1A 3LSTA 3HBNA 3IILA 4E2WA 3SYLA 2QN8A 4EG8A 4DWVA 4GSYA 3DQPA 4OG2A 2LD4A 3X1YA 1VBNA 2GRUA 3WYFA 2Q5IA 1HZZC 1QGUA 1HEYA 3EMKA 4X24A 2IUEA 2GRAA 1L6RA 4UW9A 4IIJF 1JEQA 3WRWA 1CG6A 5D5PA 3W04A 4B0PA 4WIAA 2JL1A 4E5KA 4XVHA 1AHNA 4DV5B 4A0FA 1FLVA 4E5DA 2Q1YA 2VQ6A 3K09C 3W6OA 2C04A 4ARZA 1M0SA 1L5QA 2P65A 4NI5A 4DZTA 4UHFA 3G1WA 1VYTA 2PWBA 2G07A 1E63A 3RADC 1KDZA 5C0OE 4S1PA 4H59A 4DSNA 4ZZ3A 5AD1A 4M0PA 4KGVA 1SXGA 2WK1A 1YHZA 3HXKA 1A9QA 4OBBA 4US0R 2I3BA 4L4SA 2W6CX 3K2BA 3MSCA 4MVJF 3IMKA 3X1ZA 5L4NA 4KGDA 4M1MA 4DTIA 5GONB 1GWNA 2QN7A 2YN4A 3D5QA 4AU1A 1ZJWA 1CEXA 1T34A 1YJCA 2QI9C 5F2KA 3ID6C 1RE1A 4QREA 2ZATA 5JCOC 1LW7A 1NBIA 2RHJA 1SIWA 2XV1A 1B8NA 5KTSA 1U90A 1Y63A 3HXTA 1KFCB 4D96A 3KHSA 4BMOB 4O2BF 2GEKA 2Q8QA 4NYIR 4OHCA 3ZZUA 2R8XA 1R9GA 1V1MA 3DNPA 3R7DA 2EBWA 2EG9A 2EBHX 2V7EA 2J3LA 2VPWA 1GRNA 3VVMA 2FZGA 1RCTE 1XHEA 2W2PA 3BIFA 4Z9BA 2QM3A 4QPNA 4M21A 4PF1A 4B81A 4U0JA 3ZH2A 3WGVA 3GLHB 3BMXA 3CUVA 4CEJB 1T5TA 2O05A 3GU3A 4QGSA 1T3SA 3RBVA 2VATA 5I9TA 3K30A 3OFJA 4AIRA 5CD9A 1K2VN 1J2TA 1MBZA 1WXIA 3ACCA 2JJMA 1Z25A 1RC1A 1SG6A 4JELA 3I9OA 1FYDA 4TS3A 3PTAA 1KI8A 3KAPA 1RLTA 1GCUA 3CF4G 4A0SA 5A0TA 1U7DA 3HADA 4OYRA 5G02A 3CR3C 2W8BB 3RBAA 1U8UA 2ODWA 3RKSA 1J8YF 1JFLA 2IIPA 4TV8B 1KBOA 1IHDA 4LMAA 2OBXA 2W93A 1B23P 5AWFC 5B1EA 2OUKA 4ACBA 1OASA 4QTUB 2Z8ZA 3UV3A 3ZLTA 1NXVA 3D8RA 3PEWA 1F0YA 2G67A 3QI7A 2BMAA 1DTWB 3H1TA 2H11A 3D31A 3LUAA 4OJQA 2EQ5A 3WGQA 2PKEA 5CFMA 2BC9A 3O03A 3V42A 4Q0MA 3RS8A 4TMTA 4ZANA 2XUPA 2VP2A 4C1NA 3U16A 1QLJA 2TMKA 4MWOA 2ZUCA 1NNLA 4AROA 1D8AA 1QIIA 1Z8NA 2GHRA 4H4EA 3ZVLA 4DBVO 3LQ2A 4ABTA 4U7HA 4A15A 2PZFA 1BQ4A 1XD8A 3E7DA 3UZUA 4KWEA 4QWMA 4O4HF 5DHPA 2WVJA 1K6EA 2C0CA 1XZGA 2RJNA 2YV4A 1P8JA 1RCUA 1TPYA 2FLVA 2E18A 4JLKA 4AW9A 3A7EA 2JA1A 1D2CA 2IEGA 4RIHA 3ZVMA 3DT8A 1PEKE 1Y33E 1MC5A 3G49A 1JG6A 1KOJA 1RQNA 1MOPA 2QMUA 4G9BA 3I92A 4H6VA 1B42A 2CVHA 4LS3A 4JI0B 1JHMA 4NYMQ 3UJDA 3S5JA 4FFDA 1XZJA 5KWEA 2E4YA 1GILA 3COYA 3KB8A 3M4ZA 4ZCTA 2XVYA 5ALVA 5LQDA 1Y7TA 4AVYA 5H02A 2DTEA 2WJIA 4NMLA 4RK6A 5KC9A 2C29D 5T41A 3K5HA 1HURA 4FJ1A 3TDKA 1II8A 3GJYA 4YQZA 3G8AA 3ESZA 1N9GB 3LUHA 2PGOA 4RSGA 4R0MA 2W0MA 3ORQA 4DLKA 4JYMA 3C5VA 1TVMA 2V5AA 3GCGA 4GVPA 5AICA 2OA0A 5JQGF 3FUUA 4FEEA 4FHFA 2PBLA 4Q3NA 4UHCA 1UBHS 3MWGA 5F7OA 5JRJA 2BGKA 3RF6A 3T3PB 1PG5A 4FS3A 4TTJA 3I09A 1XQVA 2P4EA 4CKCA 1P2BA 1YR8A 3WBBA 2O8FA 5JNSA 4M37A 3IHKA 3OKAA 4X7BA 1CJKC 3PVCA 1EYZA 3WLSA 3FJYA 4QBIA 5JLAA 2Z2XA 2C5BA 3HFJA 4OVKA 2NXWA 4UMFA 3WGGA 5ILGA 5ADWA 2PFGA 2DPLA 3C6QA 3QVTA 4JBGA 4UM7A 1N33B 3F47A 4ZT3A 4QATA 1U81A 3ER9A 2VAPA 3TNJA 4AX8A 3JQ7A 1PIWA 3JYOA 2QI9F 4INOA 4BLPA 2J7PA 1UBCA 2AXQA 2PUJA 3G02A 4UEQA 5D86A 1PG2A 1UDWA 2GZ3A 4UBLA 5CM2Z 5FPYA 3OZEA 2WFMA 3Q15C 3U09A 1N78A 2HHJA 5KVCA 1L8AA 2PYDA 4UTOA 4U9IS 2BY4A 2JIZD 4U3JB 3W1VA 4YREA 3G0DA 4DG5A 5HIKA 3AB3A 2D5LA 4A03A 1W52X 4I4IA 1XFDA 1ZIDA 2AK3A 2WUFA 3ADPA 4JCCA 3T38A 1W76A 4EG1A 5HFJA 3OX4A 3W3AH 1ANKA 4ZYXA 2PRJA 1S2GA 4K9KA 1E7WA 2IOYA 1GQRA 1LJUA 5IZCC 2FJPA 3AUYA 3OPYI 2XNSA 3UNXA 2AOUA 4NP6A 1M1NA 3AEKB 4CMBA 1Z6AA 2RMKA 3K2QA 1LBEA 3C3JA 2CV0A 4CG0A 1LC0A 4DR1B 4HJRA 1INLA 2AKYA 3AP3A 3ESQA 2YJNA 4IDGA 4MGZR 3S55A 4G89A 4HWKA 1DJPA 3M82A 3OCCA 4BX9A 4ZVOA 1L5YA 1P7PA 2JAUA 3IBTA 4HDMB 5JAHA 2VUHB 3DWEX 3R7FA 3ZY4A 1DDIA 3PXDA 4IX1A 3ZE7A 1A0OA 4WNAB 2J67A 2C4UA 2BTEA 1G291 5FUMA 1CUFA 4AIIA 3C6KA 3WSTA 1HYHA 1H22A 1O5IA 3BL6A 4WI1A 1AS2A 3S29A 4S05A 1TEZA 2QU7A 3DDOA 4QA9A 3WGIA 2G88A 2ZAMA 2ZS9A 5EE3A 5DTMA 3I12A 5AVXA 3MCTA 1OT3A 3O8LA 5JEDA 4P4LA 4MROA 1M2VB 1PLJA 4AK9A 4WBNA 4ZO4A 1MT0A 2QL9A 3ZZNA 5ERGB 5MN5A 3EXHC 3EISA 4CQLA 2YWFA 3FPEA 4DMFA 1Z0KA 1OA0A 2WP0A 3D7RA 5EY5B 4Z51A 3IJRA 5FNVA