4P31A

Crystal structure of a selenomethionine derivative of e. coli lptb in complex with adp-magensium
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
234
structure length
234
Chain Sequence
ATLTAKNLAKAYKGRRVVEDVSLTVNSGEIVGLLGPNGAGKTTTFYMVVGIVPRDAGNIIIDDDDISLLPLHARARRGIGYLPQEASIFRRLSVYDNLMAVLQIRDDLSAEQREDRANELMEEFHIEHLRDSMGQSLSGGERRRVEIARALAANPKFILLDEPFAGVDPISVIDIKRIIEHLRDSGLGVLITDHNVRETLAVCERAYIVSQGHLIAHGTPTEILQDEHVKRVYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Decoupling catalytic activity from biological function of the ATPase that powers lipopolysaccharide transport.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Lipopolysaccharide export system ATP-binding protein LptB
total genus 70
structure length 234
sequence length 234
chains with identical sequence B
ec nomenclature ec 3.6.3.-:
pdb deposition date 2014-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF12399 BCA_ABC_TP_C Branched-chain amino acid ATP-binding cassette transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4p31A00
1N2CE 2OO7A 4FCWA 1DAHA 4NU0A 4YMSA 1AN0A 3U3RA 4D4MA 1CLUA 1G18A 1OW3B 3T35A 1J70A 3L0SA 1IXSB 3Q85A 3C14C 2VP6A 1E2PA 2W0MA 4P4SB 1KMQA 1UAAA 1Z07A 3AVXA 3LW8A 3THXA 1XTQA 4B74A 1YE8A 1XTRA 4C0SA 1E0AA 1NG9A 1N6RA 1N0VC 2DBYA 1TAGA 4B33A 1FL9A 1XTIA 1AZSC 3NIBA 4JLPA 1CS4C 3B1YA 4KI0A 3KUDA 1W47A 1T6NA 3RRZA 4Y0AA 5KHOC 3LNCA 4ERNA 2YJTD 2QP4A 2Q9BA 2W0SA 2ZRBA 4JS0A 1V5WA 1U8YA 2YZ2A 4KU4A 4RZXA 3VKGA 1AA9A 1TF5A 4V0ME 2PCLA 1FFHA 1YVDA 3OZXA 3GJ5A 3DKVA 4DLUA 2AN9A 1Z6GA 4KYUA 4DUGD 2GTPA 4MRVA 1GVNB 1QVAA 1UEJA 5M04A 3KQLA 5EXXA 5CB6A 1ZD1A 1Z6XA 3GJ3A 3K09A 5FOTA 3OEHA 2OCAA 1R2QA 2JJ8A 2QI9C 2VP4A 3CLVA 2ZRCA 1CJUC 4M0LA 4LPSA 2J7KA 3TW8B 4QL3A 2FX3A 1ZM7A 3VR5A 2BBTA 2CBZA 4DDWA 1E9EA 1TNDA 3WHKA 2V6IA 4NL4H 2EFDB 1BKDR 3AQ4A 4A0RA 4XTRA 1AGRA 1QHGA 5HZHA 3QE0A 5SZJA 4CW7A 821PA 2WHXA 5CJ2A 4Q1DA 1DELA 1GG2A 2FWRA 3BFXA 3SBDA 4BASA 2WWWA 4BQSA 4DLWA 3ZH9B 4LBWA 4JLOA 3BH7A 4HATA 2KBFA 4DDVA 2WOJA 4ZCMA 4CT4B 3U6KA 2F6RA 3MFYA 2RGXA 4DSNA 4V0OA 5J4HA 2HCJB 3P4YA 2MSCB 3L43A 1IQPA 4GT1A 4JYBA 4Q21A 3SHWA 3FOZA 5EZ6B 3A6PC 1U0HC 4CEIA 2FGJA 3NBXX 4PSAA 4D0LB 3FB4A 2F3RA 1NLFA 4YMWA 4LYAA 4OKSA 3VNUA 4Q7JB 3TNFA 5HCNA 1VCNA 2KE5A 4XTCS 4C0JA 1DEKA 2ORIA 1R5BA 2VLIA 5KO2A 1ZNZA 3WMEA 1B23P 3U44B 4LGMA 1U8AA 2VHCA 5CJPA 2O8DB 3SJBA 2H1LA 2XNSA 2AWNA 5GJCA 3THOA 1XMJA 5BYKA 1S9DA 4YDHB 3WY9A 5CLQA 5FOWA 1RRFA 2BVNA 4Q03A 4JL5A 3SN6A 3D6TB 4C0AC 3GQBA 4US0R 4TWZA 2X77A 4PHGA 4G5OA 4R2HA 2AX4A 5J47A 2J46A 2BEJA 1DAEA 3BJIC 1XEWY 2VH5R 4LYHA 3Q5DA 4Q01A 3B7GA 2VF8A 1E9SA 1GNQA 5UKDA 3T61A 1SVKA 3P27A 1SXJE 2HYDA 2VEDA 3BB3A 2JEOA 4Q4LA 4AKGA 3IBGA 3K9NA 4EPVA 2ZSFA 1ZD8A 4K46A 4NE2A 2GBLC 2X1VA 4WZBE 1W5SA 2VF7A 1KDRA 1ZUHA 1CJKC 5JWOA 4RY2A 4JKYA 1CKEA 2A7QA 4Q02A 3WBJA 4RCYA 4UNNA 5AUPB 4BEJA 3EZ6A 3A4NA 2JLYA 3U4QB 1K5DA 3LBIA 2VHQA 4URVR 1RC8A 5G3ZA 3EXAA 3VHXA 1Z83A 2WVJA 3L82B 3ZGXA 5IT5A 3BFVA 1CJTC 3AUXA 3FE2A 3PV0A 4GL2A 2ZREA 2EW1A 3HDTA 3UG6A 3ZJYA 2CJWA 3QPUA 2EYQA 4LJ9A 1SHZA 4IFEA 2W58A 2IYLD 2OCYC 4ARZB 1LS1A 5D3MB 5DE3A 4ZKEA 2J9RA 1N5JA 3AF0A 4JVMA 4L16A 4Q9KA 4XWKA 4Q7MB 3HPQA 4MGYR 1BS1A 3W6OA 5JRJA 1W44A 2EFGA 2W83A 2Z6VA 3CPEA 1YJ5A 3B1VA 3QEJA 1WF3A 3AGQA 4A8JB 5F9FA 4DEYA 5KSOA 2QPOA 4GZMA 4LV8B 1CU1A 1FNNA 2BKUA 1NP6A 1KY3A 1VIAA 4GNKA 4CYMA 3PUVA 4N1AA 3ZS9A 3CZQA 3FMPB 3H2YA 2QN6A 1W4AA 1SXJB 3PITA 4KYIB 5JI2E 5K8IA 3OFNA 1JR3A 3NHAA 1KI1A 2WICA 2HJVA 1N3BA 4CEIB 1II0A 1ZCBA 4B6FA 2EVWX 3RS3A 4YXWD 1E9AA 4NZYA 4UNRA 5B57C 2ZUCA 2ZI3A 3EAQA 5DISB 1R5OA 3FKSA 3I3SR 2BKEA 1US8B 3QY0A 1UBFA 4QFMA 2IYTA 1U98A 3VX4A 5KU1A 1LFDB 3EIEA 3BD9A 1JB1A 5JJIA 1GKYA 2BHRA 2E87A 3PUXA 1L4YA 2QA5A 4MRPA 3VR3A 2VPPA 4CDGA 4QGGA 1ODFA 1OFIA 5G3YA 3C4JA 1X8KA 2IA5A 3QVVA 4G0NA 2ASEA 1OFTA 2IYUA 3DM9B 2BDTA 4ESVA 2RAPA 3SYNA 3KFVA 2XXAA 2NO1A 4C7OA 1E2LA 4RZUA 1P72A 4TL6A 1E1RA 5AR1A 1L2TA 3ECCA 4HDCA 1QG4A 4KVAA 4X8OA 1QHSA 3N70A 2R44A 5FBQB 3EX7C 1ZUNB 3CRQA 4A2QA 4IDPA 3GJ8A 2V6JA 4Q9LA 1G8YA 2AHOA 3QIAA 3BC1A 2HEIA 4C0KA 4Q00A 5CDFE 2IW3A 4B3FX 2CNWA 1COWD 2P65A 2A3RA 1ZU5A 2XB2A 4PZYA 5AK0A 5B58C 3MD0A 1W36B 3LXRA 4WAUA 1E0SA 4EJSC 5JMTA 3I73A 2CDNA 1OXVA 2QMEA 1W2HA 2XNDA 3H84A 4JBXA 4ACAA 1GAJA 2HJGA 2VSOA 4MGIR 5J5CA 4A36A 1E2GA 4LJ7A 1UPTA 1JAIA 3W8NA 1I4LD 2QQEA 4GMXA 3AF1A 1TF2A 2RKOA 5TB5A 1NN3A 1NL3A 1OV4A 4I1SA 4BFTA 2B7BA 4PZLA 4B48A 2F1IA 1DAMA 2CJWB 4EPRA 3O8RA 4DXAA 4WBSA 5SZKB 3UWOA 3AF3A 3O8DA 4IW3B 4ESHA 2WSSD 1M34E 5D3MA 5FPHA 5HE8A 1CR1A 5HCIA 2Q9AA 1NN1A 3TUIC 1E2HA 1KI6A 3L0IB 2ZR7A 4UNPA 1CP2A 4ZV4A 2QT0A 5TARA 1NLZA 3BRWD 4DHEA 2XX3A 2WWFA 2GZDA 3LQQA 4PHHA 4US1R 4TL7A 2A5GA 3TJZA 5K8LA 4A8JA 3U6BA 5KSZA 1N5IA 1BIFA 3PUWA 2ZE6A 2IUSA 3RC3A 2CK3A 4B3BA 1R10A 4CVNA 2ODWA 4M9SA 5ANRB 4HLUC 5HTKA 3VR4A 3U61B 3CO5A 3EASA 2AK2A 2GCPA 3NEJA 4XOIA 4XSHA 3LVRE 3SHFA 1MOZA 2Z83A 5CLLA 1ZU4A 4PAOA 2WJJA 1JQLB 3EZ2A 3Q7QA 1IY2A 2RGNA 3A4LA 4IOJA 4WZAE 3I61A 3ZVNA 3MUFA 5BN3A 3EC2A 2Q6TA 3K70C 4URUR 5DN6A 4DIDA 1HQCA 3NBZC 5AUNB 1Y3AA 4QBHA 2JDID 1TQ2A 4NBSA 4A8JC 1P75A 1Q3HA 1M7GA 5JHGB 2R6DA 1L8QA 1Q22A 2IL1A 1EFTA 3KJEA 1NBMA 2ZRPA 3NDPA 2L0XA 4LBYA 2PLFA 3X1WA 4CEHA 1OB2A 4HLCA 4C7OB 3CR8A 3IDQA 3R8CA 2BBOA 2GILA 2GZAA 3V00A 4DCNA 1SHKA 2AWOA 4PHTA 5JECA 1NRJB 1Z0KA 1I4DD 2UZ3A 1G8FA 3BWDD 5EP1A 1F3OA 1NMYA 4HAXA 5A0FA 4EKDA 4G5RA 1PUIA 1IN5A 1UDWA 2QRNA 5EUMA 5C2JB 5JS8A 4JLBA 4ACBA 3BOSA 2F7SA 1Z08A 4DUGA 1XNJA 2VRWA 3KXLA 2G1KA 1S96A 5EE3A 5EXSA 1P2SA 2QSZA 4MYTA 1G3IA 3IBYA 4M1SA 4M53A 4F92B 5LB4A 2YHSA 5JSZA 1C1YA 3ADBA 2AFHE 5IK2D 4MDFA 3JVVA 4R98A 1SXJA 2P67A 5HPYB 4QKQA 2NPFA 2F55A 3FHCB 2J0UB 2IS1A 1U8ZA 1P4SA 3X1XA 3EA5A 3SE0A 1OXXK 1UKZA 5IK2A 5L3SB 5BN4A 2VHUA 5HKKA 2D7DA 4G5SA 1KDPA 3IEUA 3EZ7A 1G3UA 3U3KA 3RS5A 5HKKD 1GRRA 2A2ZA 3QBVA 1UBEA 1DADA 2REOA 2VYFA 4PC7A 2XOKD 2NO0A 4KCGA 1XRJA 3SU8A 4CGZA 4LCBA 2GJKA 3R9IA 5E95A 2OCBA 3D3QA 4OK5A 2AXNA 2R8RA 1EFRA 1UEIA 2ZRLA 4TQUS 4IDOA 3CRRA 1FP6A 3N2IA 5DGXA 5L3QA 4B44A 1H8HD 1XCPA 1GITA 4UXHA 1CRQA 2XJ4A 2ZYWX 2OBLA 2ZJ2A 1G3MA 4IHQA 4A9AA 1G4AE 5H8WA 1GSIA 4Q19A 3SC3A 1Z0IA 3RC8A 3L8YA 3TGPA 1RYFA 3KQUA 1W0JD 2D2EA 1ZM4A 4AKHA 1IHUA 3DMDA 2WAYA 3KL4A 1E0JA 1Z22A 2ZRNA 2VQSA 1G8HA 1LF5A 2G77B 2J45A 3ZDQA 1FOEB 1VG8A 2WAXA 2OT3B 1BO6A 1R5NA 3MWLA 1XB2A 2FZ4A 2QP3A 2ZRGA 1ZP6A 1W5TA 3RVBA 5FUXA 1E2MA 3TW4A 3TSWA 1K6MA 3K0EA 3X1DA 3Q5EA 5JLJA 1JECA 3EZ9A 3QXJA 4BRUA 2X19A 3I8XA 1XDBA 2QL6A 1R0XA 2W2XA 2ZE5A 4R7ZA 621PA 1HT1E 2GAAA 3NH6A 3BB1A 4K8OA 4Q4HA 3JZMA 4UKDA 2D7CA 4UJ3A 3R9WA 3FGNA 2FA9A 2HCBA 2BV3A 3A1UA 2CLCX 1JBKA 1KI6B 3QENA 2WIAA 4JLDA 1WBBA 1U0JA 3KFXA 2BCJQ 4IVRA 4L8GA 1YZUA 1XU4A 1MRNA 4RD1A 5TY0A 3ZVMA 5AJZA 4CZ2A 3ZD6A 3B1XA 1WCV1 3UK6A 2A78A 3W6PA 4OI4A 3C5HA 2NPIA 4I99A 1OIWA 2PEZA 3VKWA 4D0NA 1N6PA 2PMDA 1E4YA 2D62A 4XVQA 3P20A 3VR1A 2WJHA 3L0PA 2JAQA 4L9WA 1EGAA 2ZI7A 3CKLA 2XZLA 4TLEA 2NIPA 2RHDA 5AJYA 5J40A 4GOXA 3MJRA 3C15C 4Q4JB 5P21A 5L3SA 5DNYB 1Z0FA 1GRNA 2OM2A 5KDLA 3ASZA 2NZ8A 2BC9A 1Q20A 3EPJA 2PX0A 2DFKB 4FW9A 3TUZC 1S1MA 4YXWA 3S1AA 3QF4A 2FFHA 3AKEA 3QG5A 2A5YB 1CF4A 3NC1C 3AB3A 3HR8A 2OHFA 4ON9A 1D2EA 5FUWA 4IKEA 3T06B 3REGA 2RHMA 1KI4A 4KXFB 2FEOA 1XP8A 2EFHB 5EUQB 2WWYA 4OQNA 3QJYA 1TMKA 1XD9A 2H18A 3U4QA 4BLOA 2ZRFA 4IOMA 4Q4AA 3IKJA 2ZQ5A 2FPKA 4XVRA 1HURA 1ZC3A 1KHTA 2ZSDA 3CONA 3GJXC 1OLOA 3QUSA 3SJZA 2ZU6A 1KO5A 5LB2A 3ZLJA 3CF0A 3H86A 3MRSA 1M7BA 1COWA 1BYUA 4CT5A 5JI3E 1VYTA 4BFUA 4GRAA 5E7MA 2Q0HA 3PEUA 5JCPA 1AQUA 1LY1A 1QHXA 4OQFA 3KQKA 3P1JA 1GP2A 4FINA 4Y0VA 4J0QA 5FTJA 4CEJB 4FWTA 2FMXA 3OE7A 2J7PD 4P32A 3ND9A 4DCSA 1P3JA 4A6XA 3WP0A 1DOAA 2J0VA 2O8EB 4IXNA 1Z6YA 2CE2X 2ZRIA 4OI0A 4MYHA 5FR2A 5GJBA 5G40A 2VHJA 4V02A 3RS2A 4KSCA 1DAKA 2W2TA 4QNMA 3QEOA 3TR0A 1WE2A 4M1OA 5CB8A 2GCOB 2IS2A 1E2IA 1HE1C 2NG1A 4B75A 1LB1B 4EQ6A 4ZDJA 2CL0X 5K8TA 2OLJA 3A36A 2QTVB 4HZIA 1RZ3A 5FBLB 1E4VA 1N6OA 2C78A 2OFOA 4MA4A 3T15A 3ZVLA 2ZI6A 4FI3C 2R6FA 2HF9A 3FPAA 2GHIA 2GZHA 2QAGA 4A0GA 2XTZA 2ERXA 2ATVA 1XEFA 4DT1B 4BUJA 2QPAA 1B0UA 5AWFC 4MGKR 3HPRA 2JLUA 2IWRA 1QZXA 2GAOA 4MQBA 1GIAA 5LD2C 5E4FA 5TMPA 3CIOA 1G4UR 1TL7C 3TH5A 3WYFA 1WB9A 1AS2A 2PZFA 5BWMA 1YHNA 2O8BB 1JNYA 4YMUA 4ILEA 2IHYA 1Z3IX 4QBIA 4P4UA 2XGJA 2PCJA 3R20A 2I1VB 3E70C 3K0AB 2QGZA 3IPYA 1YZLA 3SJAA 1MO5A 2NTYC 4RZ2A 1NN5A 4F4JA 3KKMA 2ZJ8A 1K5GA 4Z54A 1E2EA 2ORWA 1ZINA 2ZRJA 1G1MA 2GJ8A 2QROA 2O0HA 5H70A 1SVLA 1W1WA 1C9KA 1E9BA 1NIJA 3QF4B 3IHWA 3I5YA 4F4IA 1T3HA 2P0EA 1FX0A 2ZR9A 1DAIA 2ZANA 3WYAA 3BORA 1GL6A 1HUQA 1SXJD 1Z28A 2QUZA 3GFPA 4HLUA 2YKGA 3A58B 3QVUA 4Q1FA 1J2JA 2ZXUA 2D06A 4B43A 3NBYC 1GKIA 3QXSA 4QJ4A 1DAGA 4RFVA 4DBLC 3QSYA 2BJVA 1BMFD 4TQAA 4WXRA 5FTLA 1N6NA 2AR7A 5EP4A 1IBRA 2QP9X 3JVUA 3B1ZA 1X8JA 3W90A 2IC5A 1CR0A 5FI1B 4DLZA 1XJ0A 2C03A 3PQCA 5HR5A 1M7HA 3LA6A 4OI2A 4WIAA 3AVYA 2V54A 3DL0A 3MWKA 4JKIA 2RCNA 1JR3D 4D4LA 3V4FA 1JPJA 4DC9A 4Z1MD 3AH8A 1Z63A 3A4MA 1GFIA 2EQBA 3HP1A 1ZNWA 2FPMA 4ZPXA 1WQ1R 4RCZA 3TBKA 1X3SA 3RS7A 4LUCA 4B71A 1IY0A 1DO2A 1OJLA 3HJNA 2BEKA 2GCOA 4EFNA 1ZC4A 4P4SA 1R0YA 3RWMB 4X8MA 4LHWA 1DG3A 4H1UA 1UKVY 3LH5A 1O3YA 3X2SA 4I4LA 3F3YA 4H9GA 2OLKA 2RMKA 2A30A 1Z0JA 3C7KA 3W6NA 1W48A 2RH5A 3EA0A 4Z8YA 5FPKA 3QQ5A 4BRWA 5KNCA 1KKMA 3SR0A 2PL3A 1LNZA 1XJQA 3IGFA 1SKYB 2B7CA 1CJVC 3FKSD 2QORA 1OXSC 1IOZA 4EFMA 5FBWB 4OK6A 1KZ7B 3UG7A 2FFBA 2GXSA 3HWSA 4JT2A 1RJ9A 2GKSA 2YWFA 4QHTA 2GCNA 4TSFA 1Q1ZA 4MKIA 3WNBA 2H92A 1P60A 1Z6TA 2JLQA 3J81k 4TL9A 2WM9B 3K0AA 1Q1QA 3SQWA 3LV8A 1F48A 4FMCB 1NSTA 5LDDC 2P3SA 1I4TD 1ZYUA 1CTQA 2KI5A 4OJQA 2NMVA 1IONA 2XOKA 1NVVR 3AEZA 4LY6A 3HU3A 5IDVA 3AGPA 1DTSA 1ZM3A 4IDHA 4NH0A 4G5QA 4KBGA 1LVGA 2W6IA 3ZIAA 1QG2A 4URYR 5KUTA 1AKEA 4CEJA 1GTVA 4IDNA 2V7QA 4C0QC 3FMIA 4HAZA 1G20E 4FMBB 4GDFA 3Q7PA 3ZQ6A 1XMSA 5DYIA 5EE5B 4BZXA 4JVNA 4FMCF 5HE9A 1KIMA 4LDJA 5BQ5A 1XTKA 2FOLA 1KNQA 4NMMA 2VP0A 4O3MA 2ZVQX 3QXCA 2I3BA 2J0QA 4EQ6B 1CULC 4HUQB 4LBZA 4Q7KA 1GOTA 3UMFA 2G83A 2N42A 2ZJZA 3OAAD 5CM9C 4TLAA 2FJUA 1OKKD 1UADA 4D80A 2WMNB 2BBSA 3VR2A 3NTUA 4URXR 1KSFX 3A1TA 2YOHA 3M4YA 3DMNA 4DSUA 1P9RA 3MJHA 1AJEA 3I4LA 3F0TA 3RRYA 2VP2A 4IOLA 1BYIA 3CRW1 1QBKC 1ANKA 1UBCA 2AD5A 2O8CA 5FR1A 1TPZA 3BE4A 3H4MA 1JALA 3KDSE 3UMRA 1W0JA 2HUPA 5JHHB 2GEUA 4TYNA 1GL7A 2HT1A 4B2IA 5L3QB 3NVAA 2VSFA 1DS6A 1OFHA 1XMIA 4AKEA 4M1YA 1VMAA 3AVOA 4HB0A 2WJVA 3DOEA 4V0NA 2FU5C 4E22A 4UXJA 1DE0A 4ZDIA 1FPMA 1IAQA 1ONBA 4Q1AA 3ZZ0A 1KOFA 3FDIA 3QNUA 3SDZA 5GJVC 5JBQA 3B13B 2V1UA 1E79A 3AVVA 3LQRA 1FTSA 2GESA 2OE2A 2JLXA 4HYYA 1W0KD 3AVTA 4EPWA 4KFRA 1CR4A 2HF8A 2PT7A 4ASUA 5JWHA 4URWR 3ADKA 2HXYA 4MKGA 4B35A 4NCIA 4LC1A 1HV8A 1S2MA 3AVPA 2DWQA 4L9SA 1GZSA 2IS6A 3EWAA 5A4JA 3CH5A 1QVRA 1FQKA 1S3GA 4DKXA 1E3MA 4B73A 1FUUA 3T5GA 5KSYA 4RD3A 3CX7A 1NY6A 1P2TA 1OIXA 2V9PA 1YR8A 4LRWA 1KKLA 4WOPA 3I62A 4ARZA 2ZTSA 1P9NA 4P4TA 3CF6R 6Q21A 5FOSA 3QPVA 4HB3A 1EFUA 3I5XA 1E98A 4QXAA 1Z5ZA 4UJ5A 3MSXA 1ZCAA 4LHYA 2WSMA 4P33A 3LXXA 4DCUA 1JR6A 2DR3A 1ZMXA 4IVQA 3RWOA 5J4YA 2F1RA 3PEYA 1F2TA 3IO3A 4DLRA 4HLQB 2YINC 2P6RA 4JVLA 1Z0DA 3L0OA 1A4RA 3C41J 2BM1A 4TTRA 2RGNC 3BGWA 1TU3A 4C4PA 2J5XA 2WKQA 5L3RA 4A15A 3TUJC 4C0LA 1OH8A 2KBEA 2K5UA 4Q4JA 4KAXA 1KJWA 3KJHA 1HEIA 2AK3A 1J8MF 5FI0B 5KSPA 1OYWA 2YWGA 1US8A 1T4GA 3CNLA 3CW2A 2HYIC 1NKSA 1H8EA 2DWOA 2C99A 3LX5A 3B2EA 4NP6A 3IQXA 1X6VA 3QPWA 4M2LA 2OAQ1 3EIQA 1N25A 1RW4A 4HZUA 5B64A 2J41A 1HH4A 1EFHA 3W5JA 5DN6D 3MGCA 1M8PA 1CRPA 4B2PA 4NCKA 1G3RA 2XXAB 3K8YA 1MO6A 4B3XA 3KJIA 4PO1A 1TQDA 3TAHA 1SGWA 4M1TA 5DI3A 2OFWA 1U9IA 1VHLA 4DEXA 2YC4C 1KI9A 2IUTA 3GPLA 1VTKA 2WJGA 1E2FA 1EX7A 2AKAB 2UKDA 4MH0R 4N0EA 3UKDA 4HAYA 2OXCA 2OSBA 4NCJA 2C95A 2H8KA 4BLPA 2C8VA 3PUZA 4OL0A 5J4LA 2I4IA 2RGDA 4OI1A 1X1SA 1G9XA 3UWKA 1G7SA 2D3WA 5G53C 2DY1A 2GBLA 4GBMA 1CBUA 4QHSA 1MV5A 3BAFA 3M6AA 3QBTA 3HU2A 4A82A 4A1FA 4Z51A 1D2MA 2MMCA 3CR7A 4KJZA 4NCNA 2FG5A 2OESA 3CNOA 5FPTA 4YDSA 4U00A 3U3JA 2EU8A 2Q21A 4W5WA 4RJLA 1G291 4HEJA 1D5CA 2WOOA 1ZBDA 3LO5A 3TR5A 1GWNA 2IYVA 2XJ9A 3DHWC 2R2AA 3PVSA 4G3XA 1T0HB 3H0KA 4RFSA 5DIFA 3A8TA 1HY3A 1KI8A 4BFYA 2KSQA 4PC6A 1G3QA 1XFAA 1G17A 5FTNA 1II8A 3PUYA 2QAGB 1KJZA 3NXSA 1KSJA 4F93B 1F2UB 2FE4A 5F98A 2QEQA 3OEHD 1NVUQ 3L2OB 4LYFA 5D3QA 2SHKA 3RRNA 2ZRDA 3FVQA 1A82A 3Q72A 4MYUA 5J4KA 4EIWA 4OHWA 5JWRA 2CEAA 4X8HA 2O8CB 1PZNA 2F1JA 2NZJA 5CYOA 4D0GA 3TVDA 4I81A 1NN0A 2O8BA 3U3MA 1VYVA 1J90A 3LRPA 2RB4A 2ZYVX 4B32A 1ZM9A 4RKEA 2C5LA 4D25A 1TF7A 5JJKA 3DEFA 3AP3A 5CK5A 3P26A 4BFVA 4HAWA 5AJWA 3GCGA 3TVTA 1T91A 2LCFA 3FMFA 2AD1A 2QTHA 3EARA 3LD9A 4ZDKA 1GM5A 1AIPA 3WMFA 2BOVA 4PSKA 4OYHA 1CJMA 2LKDA 1FX0B 4HUTA 1S4QA 3R9XA 2GRJA 2J0SA 2ZM5A 2B8TA 3DDCA 1T0JB 3EIHA 1KSHA 3L8ZA 1FNMA 2IXFA 2IWHA 1G64A 3FTQA 5FBVB 2Q3FA 3LAWA 4A0HA 4CEHB 1VCOA 1EFCA 3H1TA 5CDFA 4TTQA 3G82C 3KX2A 2IUUA 1NJFA 3GFOA 3RNLA 5IHPA 2FSFA 3QG1A 4IXMA 4ZDWA 4QGAA 3SOPA 4ZI3A 2EYUA 4AIIA 2GVZC 1D8TA 3OE7D 4NPHA 1CEEA 4TYQA 1EK0A 1ZUIA 2ODEA 4JVSB 1VDZA 2D2FA 3UMSA 5AUOB 3AKCA 3EPLA 2AFIE 3QI2A 4TTPA 4R9UC 1NJGA 4HAUA 2OFXA 3PR1A 4LK2A 4Q9IA 1DVRA 4IJMA 2QU8A 3K70B 5FL3A 1R7RA 1QF9A 4HDOB 2WIBA 4GI7A 2Z5FA 1F2TB 4OJKA 4Q18A 5FH9A 1I2MA 2KWIA 1D9XA 3FKQA 4FMDF 4A0FA 2ZI5A 4TMXA 2C96A 2VIIA 3SNHA 2ZSEA 4WW0A 1E32A 5DH9A 4RD6A 2IK8A 4DCTA 2DB3A 2G0TA 1E2DA 1OXUA 2QTFA 4HI0E 2ZRAA 4CIDA 1AS3A 1OIVA 3KZ1E 4KHZA 1P2UA 1YR9A 4EDHA 5C46F 1KI2A 2CVFA 3B82A 2ZI4A 4LX0A 3UATA 1MR3F 2VA8A 4KBFA 5EXPA 3BFKA 4LV5B 4PFSA 1N0UA 3F8TA 3SZRA 4AG5A 4W5JA 3LY5A 2VTKA 5BYJA 1QRAA 3C5CA 4JLKA 1E2NA 2ZYTX 4JSTA 2YYZA 4UNQA 3QKSB 4XJXA 1OHHA 4LWZA 5FUVA 2BBWA 1RJ9B 4QJ5A 1ZNXA 5FUYA 1FTNA 2CHQA 2LKCA 4M1WA 2UZIR 3I8SA 4KO8A 4Q66C 1P6XA 5EE9A 3PEWA 3GJ6A 4I1VA 1T3LA 4DB4A 4YLGA 1SZPA 2MSDB 2P2LA 3UANA 3NC0C 2IF2A 4FMDB 1IM2A 4GFDA 3OHMA 4Z1MA 3QF7A 2H17A 2P5TB 3NWJA 4BFZA 3K0CC 5E7IA 1NBME 2XSZA 2PLRA 4DDTA 5HZKA 4PHFA 1EFRD 3NH9A 2FEMA 1G21E 3C16C 4G5GA 1TUEA 1OHHD 1VCMA 1TEVA 1NSFA 2PT5A 221PA 1XPUA 3CPHA 3CUEF 3N2EA 4US2R 2B8WA 4P3YA 4QG7A 4PC3A 3QOFA 1NNEA 2FFAA 1SVOA 2H16A 1E9RA 3CRMA 4TLCA 4B3DA 5C18A 3K09C 2J7PA 2ZROA 1RPZA 4BECA 4FCTA 3KXKA 3SS8A 4HUQA 5KYKA 2ONKA 1XD2A 3IIMA 2CE7A 3P32A 4Q4HB 3WXMA 3GLFA 1ZM2A 2ZRHA 2QAGC 2O8FB 1HYQA 4P0TA 4OQXA 4OHVA 4NKRA 3ZYCA 2F1HA 2A5JA 1II8B 2QM8A 3FFBA 4AWXA 2JASA 1NG1A 1RIFA 2G0NA 3GJ7A 3SBEA 2V55B 1ZW6A 3GLHB 2YV5A 2V4ZA 3EZFA 3O8BA 4LBVA 1A1VA 4A4DA 3QXHA 1A2KC 1MT0A 1NI3A 2Z0MA 1SKYE 3HU1A 4QHYA 2ORVA 3ZVRA 1G19A 3ADCA 4Q47A 4RD2A 4U5XA 4OQLA 4E03A 4LHZA 4NYJR 4B76A 3GD7A 1GNRA 1VIYA 1J8YF 3Q8XB 4GOJA 1G41A 1KMHA 1PLLA 2XTMA 2O0JA 4II7A 4D6PA 3GJ0A 4JL8A 1OFUX 4L15A 4JMPA 1N0WA 1P2VA 4QM6A 3K9HA 3W3AA 1SXJC 2OCPA 3CWQA 2WWXA 5TXGA 3OIVA 4IEEA 1KY2A 4NYMQ 4D4JA 5H68A 4KFTA 4YONB 3TQCA 5KNDA 2OAP1 2DYKA 1SKQA 4Z8XA 1W4BA 2G9NA 2P5SA 3NEYA 2CCKA 2FFQA 2JDIA 4YQFA 3BERA 3WBKA 4FXPA 2QE7D 521PA 1FUKA 2JLZA 1AGPA 1T9HA 2JJ2D 3R7WB 1KK2A 2WPDA 4D81A 5FL7A 3BS4A 4U7DA 5CYPA 4TLBA 3GEHA 2H7VA 1YZKA 2CCGA 5DYGA 4M9QA 1DBSA 2GXUA 4OBEA 2FPLA 5CIQA 3EPHA 4HB4A 5FBRB 3K9GA 4MKFA 4EPXA 1M6NA 3AKYA 4NYMR 4DJTA 2WV9A 5C4GB 3ZZTA 4L4UA 1C4OA 1Q0UA 1HE8B 5J4VA 1M2OB 3DO6A 3UIEA 4JJZA 3MG9A 1SVSA 4JBWA 1OYYA 2R62A 3AKDA 3KJGA 4S35A 2XITA 2C9YA 2GNOA 4E07A 1UKEA 1V43A 2YWHA 4GSYA 4UNSA 1KSGA 2PJZA 3MAAC 1LV7A 2IEZA 4PQRA 2YNMA 2O8EA 3I72A 4M8NE 2FNAA 4M1KA 2ZEJA 3T1OA 2FSHA 2ZU0C 3LX8A 4S2EA 2ODBA 3TAUA 4A92A 1W0KA 4PC1A 3K70D 4O25A 4HB2A 3CZPA 3NDBB 4RD4A 2DFLA 2W6ID 4LOAA 4NYIR 2RGEA 4YMVA 2ANBA 4FN5A 1AK2A 1UJ2A 1G5PA 1VG9B 3B6EA 3AF4A 3TIFA 4PTLA 1VYUA 2WWHA 4KVGA 4XIGS 4DSOA 3GLHA 4ZIRB 1MABB 5KDOA 5SZHB 3OF5A 3RABA 2V8OA 3T1TA 3AM1A 2G3YA 1Z6AA 4HZUB 3A1WA 3QKSA 3RLFA 1EXMA 3OIYA 1R8QA 4PX9A 1P9WA 1AS0A 2R6GA 1XCGB 3I32A 1XEXB 4A2PA 3A37A 4DLVA 3KXIA 2BWJA 2IT1A 2R6AA 1FZQA 2ZS9A 4HSEA 5LPNA 3LLUA 2CLSA 2BMFA 4A6PA 4TYYA 2JLRA 2WTUA 3TE6A 5DI3B 4KSBA 2P6NA 2GF9A 3GLIA 2X8AA 3X1YA 3JZAA 3THXB 1ESMA 4KV9A 1WXQA 3NBFA 5FL7D 3R8FA 4KLNA 4B47A 1D6JA 4HAVA 3KKNA 4XVUA 3EW9A 2AKYA 1E79D 2RGCA 1CIPA 2QG6A 4IEIA 2B92A 3E5HA 5IF9A 5KTYA 5GADl 4ZI2A 2ERYA 1E2QA 4QOSA 5FPSA 3TK1A 3EG5A 1IN4A 3WRYC 1ZD9A 4O2LA 4JZKA 1PJRA 5LD2B 3GJ4A 4C2UA 1GRQA 1P73A 2XSZD 1NY5A 3REFA 1RRPA 3OIUA 2PX3A 1SQ5A 2NO7A 4N3NA 1KDTA 1ZJ6A 3WNCA 1KK1A 1MO3A 2HV8A 3LBNA 3WMGA 2C77A 5KPJA 1AQYA 5JS7A 3ONWA 1KK0A 5KPDA 4MRNA 2BMDA 2B21A 2PH1A 1NLYA 4W5HA 4BE7B 2YVUA 2IEYA 3VR6A 4EJSA 2CHVA 4NHOA 2F9LA 2Z4SA 4LYJA 1LW7A 4QNRA 3TSZA 2HLDD 1F2UA 2WJIA 1N5LA 2BM0A 3GEIA 4WXPA 4ZCLA 4M22A 3RYTC 3SYLA 5JEEA 3QKTA 4D82A 3K1JA 2O0KA 1G5RA 2VP9A 1Z2AA 4IFBA 3WP1B 5E7JA 4OK3A 5AUQA 2C9OA 4PPNA 2GJSA 2ZE8A 4TYWA 3D7MA 5EXTA 2Q3MA 1M74A 2W2VA 5DHAA 4C0HA 4PXAA 1YZTA 1FP7A 1OH7A 3VNVA 2CCJA 4IOKA 4Q5IA 3KQHA 3EC1A 5H1YA 4OHXA 3GEEA 1UKYA 2H5EA 4JIMA 4ITRC 4LC0A 4RSGA 4LJAA 1T3SA 2WKPA 2R6CA 1XX6A 4ZIRA 1G16A 3CM0A 2REBA 3U44A 1YZNA 5GJWC 1ESNA 3ADDA 1WRBA 3IPXA 1OE0A 1J99A 5DLQC 3R7WA 1I2DA 1ZRHA 2NOAA 3BK7A 3VU9B 2AXPA 1W4CA 4FD2A 1HA3A 3F5FA 1R8SA 3U7HB 1ELOA 4GOKA 2BJWA 2IYYA 4LJ4A 2FSGA 4EPTA 3V4RA 1N6HA 1GNPA 1JXMA 2KJQA 4K81B 4XSGA 4D4KA 3AVWA 2R65A 3IQWA 2GJAA 3ZZUA 1EESA 4AKIA 2FZLA 4PPGA 1AM4D 2IYQA 1VECA 3SEAA 1QDEA 4TMKA 2OILA 4JBYA 2NQ2C 3NG1A 5JFGA 1AKYA 3B78A 4PPFA 1GILA 1KO1A 4DB2A 5GVRA 1S3SA 2VHTA 4AYWA 4PAQA 4AG6A 1QHYA 5E3HA 3CX6A 2G88A 4I1OA 4JLAA 3E2IA 1PUJA 3VFDA 5KOYA 4Q7LA 3U60B 1OPXA 4KODA 5AJXA 1NVVQ 3GLHE 1OH6A 4ABYA 2QAJA 4BEBA 4F4CA 1CR2A 3DVLA 2Q9CA 2HDNB 1PLKA 4RZ3A 1PV4A 3K0CA 4DVGA 2RGGA 2YOFA 1G5TA 4L5BA 1E94E 1UDXA 3IUYA 1XMVA 1ETUA 1SVMA 4PR0A 2ZAOA 3VAAA 1ZAKA 2GVDC 4A2WA 2DPXA 1DG1G 2FH5B 1FW6A 3KB1A 3FFAA 1JPNA 3TRFA 2QPTA 2ZR0A 2XZOA 2QBYA 2WJYA 3PXGA 4BFXA 3FYHA 3T12A 5BXQC 2IXEA 2ZJBA 5FTMA 3ZD7A 3FWYA 3CNNA 2XAUA 1GKUB 1YR6A 1NKTA 1JEDA 1TU4A 1GL9B 3IILA 4F38A 1KTVA 2PZGA 1XEWX 2QT1A 3SFZA 4C9BA 2GF0A 3MWJA 3M0EA 1E0KA 4PO8A 3IIKA 4UXIA 3U3OA 1UF9A 1U9IC 2GDJA 3MLEA 2J59A 3ASYA 5EP3A 1HT2E 1KK3A 3K0SA 1S1CA 2A5FA 3LW7A 4W7SA 4NDZA 4R71A 3QKRA 1E69A 3GLIB 4NCHA 2JATA 3KUCA 1TEXA 3GLFE 3K0FB 2ONJA 4TT3D 4M9ZA 1W36C 1XD8A 4DLXA 1T5IA 2BMEA 4QC2A 1TQ4A 1UBGA 3AP1A 1Z06A 4KLZA 4AI6A 1EX6A 4MUAA 1HQYE 2R9VA 1P5ZB 3VU9A 4BZPA 3N5CA 4DWJA 1S0UA 4X8LA 1W36D 2ZUBA 1SVWA 1NMXA 4M9XA 3RS4A 1P61B 4PANA 4KITB 2UVQA 3CF2A 3GP8A 1Q12A 1D9ZA 4LJ8A 2QM7A 1T8TA 5L3VA 1XD2B 5BN5A 1L4UA 3W8RA 1EWRA 2QRZA 4G1UC 4MDEA 2O8FA 1E96A 5AJVB 4GZLA 1IN7A 4RD0A 4C3ZA 2EWVA 2OUKA 721PA 1KNXA 2ZS7A 1W4RA 4IRUB 3RS0A 2VO1A 2JJ2A 4V0KA 3SJCA 2E9SA 3U7EB 3CPJB 4IDQA 4MRSA 4PSVA 1DPFA 2D74A 3HR7A 1TUIA 3DOFA 2Z43A 4O0MA 2IYZA 3W34A 3T5DA 2G1JA 1IJFA 3G0HA 1RRGA 3BXZA 3B8HA 4HDQB 5DSZA 3C8UA 1VKJA 3VTKA 4BFWA 5JJLA 3O47A 1XXHB 4WVFA 3T1VA 1K8RA 1LTQA 1YR7A 4XD7A 4OHZA 1BH2A 4M4SA 5EZ5A 5EQTA 3WHLA 2NO6A 1JJVA 1P62B 4Q1EA 5DI9A 4AYXA 3QKUA 3GLGB 1U81A 4QBFA 1KGDA 4GPTA 2QBYB 4JL6A 4V0LA 1NVXQ 4AYTA 2WZQA 1U2RA 3ETLA 3TSOA 3TLXA 1H65A 3IIJA 3Q3JB 2ZYUX 3AP2A 8OHMA 1X86B 5KDDA 2IYXA 3ICEA 3W3ZB 1DO0A 4PAMA 4MITA 1VCIA 2WKRA 4JLMA 4NONA 2XTNA 2KB0A 2C2HA 121PA 4KFUA 4DLTA 1FMJA 4E5UA 1JI0A 2DHRA 1OKKA 4XWOA 2A9KA 1OF1A 4C30A 5TDHA 4AK9A 2PJRA 4CRWB 1BOFA 2ZRMA 1R4AA 3AV0B 3B60A 2JLWA 4LJ5A 3TMKA 1CXZA 3K0FA 3RHFA 1UFQA 4TQ9A 4URZR 3KKPA 2PBRA 3W9YA 4B34A 2N46A 1JJ7A 3AF2A 4R2IA 2ZVPX 5DHFA 1GUAA 4MKHA 1TTTA 3LFUA 2W6JA 1R0WA 4ZKDA 1RYHA 1YU9A 2H57A 2PMKA 4BLSA 2RGAA 1XXHE 4AURA 1XJCA 2F43A 3D31A 1PVOA 1IXZA 1WA5A 1F60A 2CL7X 3BH6A 4JYCA 3TQFA 1SULA 2DWPA 2Q3HA 2CVHA 3ZIAD 2GWHA 3GLGE 3CWZA 2BMJA 5EJEA 1T5LA 1M1YE 3ZQJA 2REXB 1XPRA 2CXXA 2BIFA 1E9FA 2FN4A 3HYTA 1GDDA 2EWWA 4RFSB 4EFLA 2IS4A 2IF0A 2ZS8A 4JLVA 5JZVA 4NYIQ 1EG7A 5JRZA 1KO8A 1X8LA 2J87A 3LLMA 4TSFD 2BCGY 2C9CA 4TZ6A 2ODNA 1HTWA 2ZSAA 4DLSA 4DIEA 1YRBA 2ZI9A 2CNWD 4WA7A 1G6HA 1AZTA 2FV8A 2GK7A 2QZ4A 3BIFA 3RDPA 1D2NA 5G41A 4UQOA 5KNBA 3U2QA 1NMZA 2NGRA 5F3WB 5JSZB 4MGZR 1XEXA 4PC2A 2YC2C 3X1ZA 1OH5A 2QMUA 1XXHA 3SQXA 3DZ8A 4TL8A 3OAAA 2J0UA 1N6IA 3M1IA 2WWGA 3VHLB 3GLIE 2ZJYA 1KDOA 3QKRB 2ZJ5A 5FPYA 3VMFA 1ZIPA 5EE0A 2WPDD 1XZQA 1MKYA 2CLDX 4Q1BA 4CF7A 3PFIA 1OT3A 1S9HA 3AVUA 5B2ZA 2QE7A 4GP6A 3THYA 2JJ1D 2ZIAA 3G5UA 4U02A 4EPYA 4F7WA 3GFTA 2WMOB 1KO4A 4QGHA 3B1WA 3P4XA 1MO4A 4TMWA 2FDCA 1WP9A 4F91B 2O8DA 2CMKA 1JXOA 2QNRA 3CRVA 3KTAB 1U0LA 4NTZA 1QHHB 1R6BX 3ICQB 2OV2A 3IEVA 1KAOA 5JCZA 4M21A 1X1RA 4MYCA 1E99A 4I1UA 5CM8B 2ZE7A 1VG1A 4G01B 3OFND 2X2EA 4JLJA 4JSYA 1EWQA 3K9LA 1F6BA 2NO9A 3PENA 3KKOA 4AD8A 3U7GA 4TZ0A 3MWYW 2GK6A 3IHLA 421PA 3RRMA 3A1SA 3BBPA 1MRSA 3UXMA 4P31A 2ECKA 1JQJC 2JCSA 2WBLC 1KZGB 1H8HA 4KFSA 1XWIA 1QHNA 4QJ3A 3RSLA 3CB4A 1Q1BA 1Q1EA 2QQ0A 3HYRA 1XCMA 4GP7A 4ZCIA 4TYPA 1KO7A 4BFSA 2IYSA 2V3CC 4PPQA 3WNDA 1ZVQA 4POAA 1TADA 3OEED 2GJ9A 1Z0AA 4TN1A 2VSXA 1RKBA 1U99A 1LS6A 1RVDA 1E6CA 1JR3E 2PEYA 5FOVA 2ZUDA 3EWSA 5DO9A 4EUNA 3OEEA 1G7CA 3B5JA 3PIRA 1RFLA 2OEPA 2DFNA 3PEVA 3THWA 2QGNA 3I1FA 4JLNA 1W2GA 4DSTA 2A5DA 4C2TA 1F5NA 1MH1A 4BLTA 4AC9A 2Y8EA 3PG5A 1RE0A 1E1RD 4TMZA 1VPLA 2GXAA 2DCUA 2F3TA 4QRHA 3KQNA 4D26A 4LHXA 3K53A 1ZNYA 2RGBA 1FQJA 2OBNA 1XTJA 3KB2A 1Z2CA 3LDAA 2WWIA 4LZZA 3U7FB 1IXRC 4RKFA 5IRCD 2B6HA 2N1BA 2HLDA 2OBMA 2IBMA 1Y63A 3B9QA 2XB4A 5B30A 3CX8A 1G8PA 2PZEA 2JA1A 4LV6A 1W46A 3D8BA 1BMFA 4MRRA 3VX3A 4GMDA 1TQ6A 2ZSBA 4O2RA 3WYGA 1YQTA 1XF9A 4D2IA 5FOUA 3THYB 2OG2A 5F9HA 1N6LA 1WDTA 1Z8FA 2YOGA 4Q9JA 1UM8A 3DPUA 3KKQA 4RVCA 3S1AB 2HT6A 3SYKA 2QMHA 3AVQA 3O8CA 2ZJAA 3PCRB 4AY2A 3BB4A 1A2BA 1A7JA 1KYIA 2W6JD 3PJRA 4TLDA 2G6BA 4WZ6A 2F43B 4OHYA 1QHHA 1KI7A 5SZIA 1WBDA 3QXXA 2XNDD 2JIZA 2ZJOA 2DFTA 4B2LA 1II9A 1KAGA 2V1XA 5EP2A 1YRAA 1E1QA 1FMLA 2JJ1A 3DZDA 3VQTA 5FFMA 4Q4AB 3DM5A 2F9MA 1A5TA 1DAFA 1IN6A 2J3EA 4XWAA 5JEDA 1YKSA 5A5GA 3NHBA 1JEEA 3GLFB 1YZQA 4H1VA 4PZZA 1J7KA 2ATXA 1OSNA 4EAQA 2XZPA 4FCVA 1IY1A 2VP5A 3TKLA 2V7QD 2IXGA 5F2EA 5L8VA 1Z29A 1RRCA 1G8GA 4BLRA 4EJSB 2ZAMA 4V0MA 3CH4B 2EFEB 2CHGA 4C0BA 4DZZA 2EFCB 2CK3D 3I92A 2OXRA 5C1BA 4ZO4A 3FHTA 1E1QD 1XTSA 3B85A 3MMPA 2JGNA 4PO9A 1SVIA 4DCVA 3LBHA 2HXSA 1U90A 1S8FA 2ZPTX 1KMHB 2C98A 4LSGA 2OZEA 2P6UA 2X2FA 2JLVA 1R0ZA 5EE1A 1T8UA 3NKVA 5CK4A 4LPKA 1G7RA 3U5ZB 2GXQA 4DLYA 1Q21A 4FIDA 4NYJQ 1NBMD 4XH9B 5CITA 3OIWA 4B3CA 2FF7A 2VBCA 3UPUA 2XEXA 3THWB 4LHVA 4LI0A 2MSEB 2QMOA 1NIPA 2C04A 4TMTA 1LF0A 2D4HA 5TVKA 4E09A 1W49A 4DT1A 1OB5A 2LWIA 1WMSA 5K8UA 2QY9A 3GMTA 4PQYA 2FSIA 1Q44A 4OQMA 4BWYA 3KTAA 1W7AA 2ZRKA 1N6KA 5CIWA 4TMVA 4M1MA 1XZPA 4DRZA 1DARA 4XD7D 3WRXC 2CL6X 2J1LA 3V9PA 4IVPA 1QHIA 1VG0B 2I1QA 3ND8A 1IJEA 2YWEA 2IX3A 1Z47A 3SI7A 5FOXA 4B3GA 3LWNA 2IHBA 3RSOA 3T1QA 5FTKA 2FGKA 2GETA 2AL7A 3LVQE 2JLSA 3MCAA 3B9PA 2TMKA 5BW8A 2QSYA 3FHOA 2JIZD 2O5VA 2IYRA 3CBQA 3RAPR 1NVWQ 1P7CA 1U94A 3OESA 4W9MC 1O87A 4BLQA 4JT4A 4YC7A 1IN8A 3SFVA 4ASUD 4BZQA 2W00A 4Q9HA 1Q3TA 3FMOB 5LBIA 3ZS8A 4V03A 4N0DA 1JAHA 2ANCA 4LJYA 3EPKA 4FWIB 1Q57A 4DDUA 2ZITA 4QGFA 4QM7A 1XPOA 1E2JA 4HLDA 4QBGB 1XBTA 5C4MA 5GVSA 1E2KA 1H8ED 4JJKA 2WSSA 3E1SA 3A1VA 2IYWA 4LJ6A 1KJYA 3BH0A 2MMGA 5TV2A 1ZIOA 4BGDA 5ELXA 3DKPA 1KI3A 1NF3A 1G7TA 2E1RA 1VHTA 4B6EA 3GLGA 3VKHA 2QENA 1TX4B 1PLJA 4Q48A 4MUBA 4TT3A 1MABA 1G6OA 1YZGA 2GEVA 4YMTA 4BPBA 2VL7A 3IO5A 1OXTA 2GA8A 2GEDA 4Q1CA 1N5KA 1E9DA 3AUYA 3W5IA 1E9CA 3Q9LA 3RANA 4PQFA 3T34A 1L7VC 2Z4RA 2ZETA 2O52A
chains in the Genus database with same CATH superfamily
1C1HA 1RI2A 4GEKA 3AERB 3JVDA 5AFSA 2EKPA 4YMSA 2FYTA 1KPHA 4QIHA 3MQFA 4WACA 5H59A 3U3RA 1PL8A 2OO5A 3T35A 4A8HA 3N53A 5G1PA 3HO8A 4OX9B 4QUGA 4E12A 1GFWA 2YJZA 3JTMA 2YHIB 4PFJA 3C7DB 3VH1A 1Y8RB 1E2PA 4P4SB 4NMXB 4WUTA 1HEUA 1R50A 4ZYLA 2CY0A 2FN8A 1UAAA 1FTQA 3W6ZA 2C4WA 1XTQA 1E0AA 3SS7X 3LKVA 4CM9D 3DC2A 5LP6A 1XTIA 1AZSC 3CLUC 5ALSA 3ZE0B 5DIZA 4XIJA 3KG2A 3LYAA 3EVCA 1PR6A 3KUDA 1P39A 4KI0A 4NQZA 4NZMA 1T6NA 5CFPA 8ADHA 5KHOC 4FEYA 5KTPA 2DQYA 1WSDA 3G13A 4HH3C 2C5EA 4DXHA 2YJTD 3CGWA 1YBAA 2QP4A 2W0SA 3VKGA 5CFLA 1V5WA 1U8YA 4R8VA 4MWDA 4X95A 1AA9A 5G0TA 2A14A 1DUVG 4GZ5A 1AKWA 2QX8A 4ALNA 4KSYA 3FAKA 3X2EA 1D07A 1E4EB 4DUGD 1XKXA 1GVNB 4ALMA 3DLHA 5M04A 1PYGA 4CCYA 3KQLA 5CB6A 1UQUA 3GJ3A 1E64A 3PVZA 4F0JA 3OEHA 2HWXA 2OCAA 2V5AA 3OFVA 4JUIA 3VYVA 3CNQS 4J49A 3WGZA 2RC5A 4P58A 4G0ZA 2QI9C 1F5SA 1T6YA 1M9NA 2VP4A 4INZA 3BWEA 2ZRCA 4DARA 2JGMA 1CJUC 2NU7B 4MKRA 2FPWA 5J2TA 4IS3A 4J4HA 3M33A 3FNBA 5IUNC 4F56A 3LDHA 3COVA 3IUEA 1NE2A 5AK3A 1K89A 4KQIA 1ZM7A 2CBZA 4DDWA 1E9EA 3V6MA 2P90A 3WHKA 4DV0B 1QOQB 3EEQA 2EFDB 4XZ3A 5M5BA 1AV7A 1V7CA 1Q15A 1AGRA 3EXFB 2C42A 4ZGGA 1RAGA 4CW7A 4RK4A 3RVDA 4WE3A 5I7HA 1K06A 2FWRA 3BFXA 3PJGA 1C9EA 4OH7A 2WWWA 1L5LA 4LBWA 4JLOA 3BH7A 3GV0A 1RWPA 2KBFA 3LUHA 3U6KA 1N8KA 1C30A 2F6RA 2ONCA 2DF8A 3A4VA 4I1RA 2OFPA 1WZIA 2EAUA 4M37A 5BYBA 4C43A 2PY6A 2RKBA 3R23A 4IHJA 1HK7A 5NULA 1U0HC 4CMGA 3GGOA 5ALIA 2FGJA 3NBXX 4OHBA 1Z26A 3RODA 5LOVA 3GYBA 3ZU5A 5F5LA 4XGIA 3EG9B 1ZMOA 3TNFA 3L7DA 1VCNA 3MN1A 4GKKB 1R5BA 3KTDA 5HOQA 3T6KA 2VS1A 2Q9UA 3DNPA 1B23P 4LOLA 2VHCA 3B3AA 1L5WA 4GBED 1ZH4A 3T7DA 4LIPD 3A9SA 3QVWA 5BYKA 3THOA 1XMJA 3NIDB 2MTBA 1KGSA 1A9YA 4U63A 1UANA 2CF5A 1S9DA 3KLMX 4YDHB 5JDIA 5FOWA 3OHSX 1OYVA 3WIEA 1G98A 4Z4HA 5FA6A 1GZUA 2C2OA 1VM6A 1NOIA 2HMVA 2O7VA 4ZODA 3ANSA 4MO2A 3COYA 4XOUA 1SPBS 3BJIC 3WDKA 3IX7A 5DHTA 4BLVA 3DZBA 5K3BA 1VLJA 4R6XA 1KVRA 3OC0A 1SXJE 3EFEA 5IULC 3B70A 4Q4LA 1BFDA 2JGAA 4EKYA 1SXGA 4EPVA 2CYCA 2ZSFA 1X1EA 3P2YA 1ZD8A 3OTOB 5EJGA 1TRHA 5LNK1 5L4NA 2R60A 4MB6A 1T34A 1H6AA 3ISTA 1ZPDA 1NTOA 1JBQA 5EIWA 5I8ZA 5JWOA 2VCHA 1ECGA 1I0LA 5BUSA 1MA0A 2C31A 2L18A 2YY5A 5EQFA 3CNHA 4Q02A 4CKCA 3WBJA 4EH1A 4MO9A 4ZOEA 4H3SA 1G60A 1VKHA 3ACDA 3MS2A 3VKUA 1QKKA 1YS6A 4J07A 4CFZA 2BSAA 2Z5VA 3U4QB 4TUYB 1HT3A 1FFBA 2VHQA 2YWDA 3LX6A 1L4FA 1RC8A 3DFZA 2CDRA 3FCXA 3L82B 5TGTA 2PSEA 4NJEA 5KYGA 1TEZA 2CL5A 3HJTA 2ZREA 1JGTA 1ZMRA 2ZWOA 3UG6A 1MZPA 3ZZNA 3I4CA 1QC5B 2XH8A 4GO1A 3TB4A 4BYMA 4LJ9A 3UAOA 3JRXA 5GAJA 3TKYA 4EA8A 4OHKA 4YJKA 2YXEA 4ZKEA 2P9TA 1H6CA 3FNQA 1DTEA 1FRVA 3E5MA 3M5WA 1M73E 2C7BA 3G5LA 4K2AA 1FFCA 1BS1A 1GGJA 1NW3A 1W44A 3DUWA 3PHIA 1KMNA 1YJ5A 4QO7A 3RADC 3AGQA 3TEFA 2G9QA 4A8JB 4C7KA 5F9FA 5KSOA 3JQAB 1UFOA 5IJ0B 3I9V6 1CU1A 4YP6A 3EB9A 1NP6A 1KY3A 1VIAA 1WCIA 3DT6A 1TOAA 4C22A 3AESA 3DAPA 1ZR4A 4IQGA 4UAGA 3CZQA 2DY0A 4BV9A 3PITA 2FMFA 4AL4A 1GGEA 5JI2E 1BW9B 5JQWA 1GDTA 1U28C 2A9JA 3NHAA 1KI1A 1H5UA 1YB7A 3IP8A 3RBZA 3DAOA 5FQNA 1II0A 4XKJA 1ESEA 3UTCA 3FCEA 1QXSA 4WINA 1SUAA 4CCWA 2VQ3A 3I45A 2V9ZA 3TECE 5C5EA 2FEWB 1KZ9A 4AG3A 4CBVA 4UNRA 4F1WA 2CW5A 1VFPA 2W6QA 3EAQA 2IV2X 1W73A 3P5BA 4GD3Q 1UBLS 3Q3EA 1CY7A 2XECA 2XMRA 4AULA 4AUNA 2I3DA 1UBFA 2O5EA 1K6IA 4MDYA 5EZQA 3RFFA 3CV3A 1LFDB 3EIEA 4DA4A 4MR9B 2FLKA 3EF3A 3DT8A 4R84A 1QB7A 5JJIA 2VJOA 2QA5A 1UZLA 4MRPA 3F4LA 3SX2A 3UW1A 3GAFA 4CDGA 5A4MS 3BQ9A 3E8MA 5LIRA 4TVSA 2WD7A 3C4JA 1X94A 5EIEA 2IVZA 2JGJA 1YV9A 4EI7A 4RVFA 1BDMA 1Y9AA 4MJ3A 3QNWA 5EHGA 2XI4A 1WNTA 1E1RA 2GJ4A 2B3TA 4GUDA 4HDCA 4X8OA 5EWJB 1TM1E 1DKPA 5BN5B 5LLSA 4BC0A 4QUHA 3N70A 3EX7C 3H0EA 1EEHA 1G6KA 3OLQA 4IJQA 3GEBA 3HKCA 2H9AA 2QV7A 2RHRA 4W4TA 4Q9LA 1MFZA 2CXQA 2YW9A 1Q91A 4MIOA 3H13A 4B3FX 4DMLA 3KZXA 2P65A 4CODB 3AUJB 5AK0A 2Z4TA 3KZCA 4M1EA 4XX1A 1ZI9A 3BZUA 3T8YA 2BTQB 2DM6A 3K1TA 4X0EA 4OHRA 2GQ0A 1TIKA 3LXRA 3TQTA 3CKMA 3TCNA 3I73A 3BE5A 1IAVA 3S2YA 1W2HA 2DFVA 5E6RA 1M2GA 3OFKA 2HH9A 4HL6A 4B82A 3S5JA 1H3NA 5I9SA 3C6XA 2B1JA 2VSOA 3SVZA 3UY4A 3K5IA 4QGBA 5J5CA 3V7YA 1PQ4A 3W8NA 1YU6A 4L74A 5AM3A 2JRLA 4FU0A 4GMXA 1LQ2A 3CH6A 1HI9A 4R5MA 2B4KA 1NN3A 1NL3A 3Q7IA 4IXWA 3R7LA 1C4XA 4GYWA 2YYAA 4JT9A 1VIVA 2OCDA 2Y1GA 2F1IA 4QT4A 1TLLA 3G7SA 3DKIA 1JEOA 2QRQA 2G70A 4WBSA 1H2WA 5BOSB 3G9UA 2Q28A 5I45A 4IX9A 1HYGA 5D3MA 4LC9A 1CR1A 2Q9AA 4QXQA 1XU9A 3L4BA 1K4KA 2D3TA 1KI6A 1H5QA 2ZR7A 3F96A 3Q3IA 2QR3A 1YBHA 3NBMA 4TQGA 4ZAFA 1CP2A 5IBPA 4YUZA 3K6SB 4GRIA 2X9LA 3LOUA 1VLMA 4PHHA 3LQQA 4RH1A 3X44A 4LXXA 4TL7A 5K8LA 2XIJA 3H9UA 2QI9F 3U6BA 1Z13A 2ZE6A 5A71A 3B12A 1XAGA 3IQGX 1MX3A 3JASB 3PJDA 3ZCVA 2CK3A 4Y9TA 1R10A 3MW8A 4ZXPA 5J1SB 2P2NA 1WBJB 1L7EA 3JQ9A 4AP9A 4HJXA 1UOPA 1CDOA 5HTKA 4F1KA 2Q1SA 2RJNA 2PRIA 3I37X 3VR4A 1XVLA 3U61B 1X2BA 1I4OA 2AK2A 2GCPA 3C3BA 3REQA 3H0CA 3IDSA 2EBWA 3LVRE 1I7NA 2I6XA 4RIFA 1JJFA 4RGVA 4PAOA 4GOLD 1XXLA 3NM4A 2WJJA 2RGNA 1U0GA 2J3HA 3A4LA 2FSSA 4CQMB 2VJLA 3PNVA 4U3JB 1GN8A 1V71A 3ZVNA 2C4NA 3RARA 2UU9B 1KEEB 2Q6TA 3DV9A 4RXUA 4URUR 4DIDA 3K70C 4XASA 1YIDA 2IXDA 4ZVSA 1TZJA 5BO5A 3QITA 4QBHA 4EKGA 5BORA 4L78A 1A7KA 5KJFA 2ZT8A 3E7DA 4BCBA 4P81A 5SICE 3BRCA 1W96A 2DBVO 3SIPA 1L4NA 4EVSA 1GZ7A 2JGDB 3UWMA 1LLUA 2IL1A 5HIIA 3ZCXA 1H66A 5JC8A 4C7OB 4PQGA 4EG5A 3BMXA 2CUZA 2Y1EA 3DDOA 1SG0A 1Y7HA 1FPQA 3DOUA 1DJNA 1V11B 1WB5A 2BBOA 1EJ6A 3ILHA 3LCCA 4YWHA 1ZD2P 4DCNA 2DHDA 2HWUA 4ZVKA 3H65A 3EGXA 3M70A 3ZU3A 1JT2A 1ORTA 1T3TA 5LU9A 5JECA 5DKFA 1FYEA 1NRJB 2VNKA 4YA6A 2DTEA 1D4OA 3LK7A 2UZ3A 1H4VB 3G2NA 3WFJA 1LEHA 1LDGA 4HAIA 5ECGC 1ZHFA 1A2QA 1IN5A 2YASA 3QHPA 4G5RA 4S0ZA 3UV3A 4BVHA 2VQFB 1Z2OX 2VPWA 4E1VA 3BOSA 1U0EA 4ZA2A 1AQ6A 1WTCA 1YHYA 1XNJA 3M3PA 3DMTA 1JQ3A 3G0CA 4EWLA 5JTUA 5EE3A 4MYTA 2PH7A 2D2VA 3AT1A 1ZK0A 4JUBA 1IBSA 3ZKWB 3ZWMA 2JI8A 3IBYA 5CHEA 4M53A 2FX2A 5KTTA 4HBZA 2QLTA 4UUPA 4F92B 1YQEA 3JQ6A 1M2HA 4E7PA 3F7MA 5ER9A 2P67A 2QMYA 4MGHA 2WF6A 2NPFA 2F55A 2C9ZA 4DJJA 3CG0A 1IEQA 1RYDA 4NABA 4DW8A 3Q15C 2C58A 3FY4A 1I3CA 2YJNA 1AK1A 1U8ZA 5F7XA 5AW2A 2VUHB 1RWVA 3KEGA 2L69A 1OXXK 1UKZA 3FYDA 5BN4A 1MAWA 3MJCA 3T7SA 1HDXA 1QH0A 4X1KA 4BBZA 1PZXA 5ITSA 1JEQB 2ZWAA 3IEUA 4YRSA 3UMBA 4KGXA 1Q0QA 3D8SA 1G3UA 5BMOA 3UHAA 3RS5A 1JDBB 4MKZA 2IY8A 1GRRA 2E4UA 2FQWA 2W2PA 5KKNB 2P4QA 1ZGCA 1SBQA 4PC7A 2XOKD 4KCGA 4PGMA 4ETNA 2AF4C 1U6JA 3PNLA 4CM5A 4LCBA 2GJKA 3ORHA 3DAFA 2OCBA 4TN5A 3DBVO 4IO0A 2HLNA 5I9MA 5JSFA 4WCDA 1JDJA 1FP6A 1MB3A 3Q0TA 4EB6B 2HA0A 1HYEA 3EH1A 4C89A 4UXHA 4R40A 5EJ2A 4IX1A 2XJ4A 4FGLA 2OBLA 2WWVD 1G3MA 2EIXA 4QRDA 4NCAA 4JXJA 1GCGA 5T4EA 2J09A 5B3JA 1G4AE 3MTEA 5H8WA 3K7EA 3FWKA 1J49A 1Z0IA 3SC3A 1QUFA 2AYYA 3ORYA 1RYFA 3O4GA 3BCUA 5JS2A 1VRVA 1IUOA 3EULA 4NWIA 4ZU1X 5F21A 4D4IA 5M29A 3DMDA 5KOJB 3L7BA 3SQNA 2DUNA 4BTVA 1TDJA 1SG9A 3RC7A 2RK6A 3UMYA 3RUIA 2MR5A 4E1BA 1VG8A 3DMHA 5EVJA 4FYPA 1PWZA 3PI7A 1WU7A 5A9SA 3SVTA 2DHCA 1U1CA 5EMNA 4N8SA 2VK8A 1W5TA 3RVBA 3ZE6A 1BVHA 5L6MB 3SM9A 1XKLA 3K0EA 3X1DA 4EHAA 4E5DA 5DCWA 1YOBA 3OZ7A 5HZGA 3KDPA 3UUWA 4IUBS 1LDNA 4QLBA 3EZ9A 4HH4A 3HB7A 3JAMA 1F0NA 2X19A 3NT5A 3QX3A 5IZ4A 2W2XA 4S1WA 2ZE5A 4D6XA 1ZI6A 621PA 1J9ZA 1KYQA 2GAAA 1Y7PA 3B6ZA 3LUJA 4Q4HA 4E2WA 1FVXA 3CMMA 3JZMA 2OVFA 4JU9A 5AYVA 5FEUA 2D7CA 2FW1A 3RVKA 3HUUA 4UCXA 2BY4A 2HCBA 5BY2A 2IVFA 3HI6A 3QENA 4Y2TA 4IYRA 4CMJA 5JD3A 1LVHA 3B3JA 3KFXA 2CLOB 5DRTA 2BCJQ 5H16A 1L1FA 5B6IA 1MW8X 5FPQA 1ID1A 2YTZA 4OIMA 4NF2A 4UFOA 2FVXA 5GV8A 4AY4A 2WUVA 1P81A 3LU1A 3L4BC 4DDKA 3VVBA 5TY0A 3RYCB 5G0SA 4ENQA 3B1XA 2CXNA 5JXJA 1OLUA 1IOLA 1V41E 3M5CA 2W98A 4JROA 4KVZA 3C5HA 4NK4A 2X3FA 4WJLA 2G04A 2XMQA 1N6PA 3WJAA 1RC0A 3P20A 4GSLA 3VR1A 1SQ0A 3L0PA 3UWSA 4PSCA 1IBCA 1PWXA 2JAQA 4R1QA 2JBAB 1VZ2A 1PJAA 2Z56A 2ZI7A 2X1MA 4TT8A 4GLFA 3E9EA 2TMGA 4N7JA 5AVQA 2IOYA 3KU4A 3RR2A 4D9HA 4F5WA 3MJRA 1DC5A 3C15C 4Q4JB 5L3SA 3M89A 3ON5A 4Z3DA 4MJ7A 5KDLA 2I65A 1QYXA 3K73O 3EPJA 2CUKA 1W4ZA 2PX0A 3TUZC 1UCFA 2RE8A 5BVHB 4H1TA 1F8FA 3F67A 1FFDA 3QF4A 1THZA 1K08A 2MOKA 3CNBA 3HRKA 4RV9A 2PMFA 3ZN2A 5KTKA 3HNRA 3NORA 2HGZA 4FI3F 4OFZA 5JNRA 3REGA 4EECA 4YMHA 1AXEA 3BXHA 4KXFB 3HRHA 4L9RA 3FDJA 1XP8A 2EFHB 4YR9A 3W1EA 1UBKS 1D2GA 3QJYA 2NU6A 1XD9A 1CUYA 2AG6A 2QYOA 1CYDA 3QEBZ 2LD4A 3U62A 4Q4AA 5E8JA 4BCDA 1BMDA 2OOKA 3HCOA 2CJXA 2FPKA 3BHIA 1X9GA 5BR7A 1LBHA 2XQJA 3CTPA 5AKIA 1KHTA 5E6SA 4ENTA 5AXBA 3OFSA 4A23A 4BMZA 5KJCA 1U8FO 1USIA 2AOTB 4W8OA 3D2AA 2HR1A 2HHAA 5JI3E 4CT5A 1TAHA 3FPBA 4ZO8A 1FP4B 3PVCA 5HBRA 4B6JA 1LY1A 4GI3A 2W5UA 3K20A 4RPKA 3I12A 4GDMA 1RPNA 3CEHA 1JIIA 4OMDA 4TWIA 4WZBA 5FTJA 4CEJB 1DIHA 3OE7A 1QGZA 2P9BA 2XGOA 3MC1A 5LZ5A 1P3JA 3HNOA 5F2OA 3WP0A 5KS2A 2N0SA 5GONA 3D2LA 4GMFA 3V7UA 1HTBA 1Z6YA 2ZRIA 4WEQA 5FR2A 3MMZA 4M60A 2LP4Y 3KE9A 2Q2QA 5U9CA 4M8LA 1DAKA 1K2VN 4ID3A 2W2TA 1EDOA 3QEOA 4OBXA 2VDLB 4KSCA 5DGHA 3OT1B 3TR0A 3PC4A 4HSGA 1QVVA 1M2VA 1T9DA 2GCOB 2R1ZA 4BV8A 2Q4EA 3ES9A 2CL0X 2BE7A 3ZEIA 3PCTA 4CLXA 1C1DB 1HFJA 1RZ3A 5FBLB 1N6OA 1M76A 2A33A 2C78A 2OFOA 4MA4A 3ZVLA 2R6FA 4EL0A 3LOQA 1JU9A 2GHIA 3KHTA 3TVYA 2Y2UA 4EVRA 5IT0A 4E21A 1K27A 1U3GA 2GPWA 5HFNA 1XEFA 5I7UA 1M3SA 5AWFC 4MGKR 3HPRA 3OX2A 3P19A 5TMDA 3AHCA 1UBHS 4DLLA 1GIAA 4M76B 3IUPA 2B4RO 1PCXA 2H1HA 1NXQA 4UDOA 2PA3A 4B0PA 1VLLA 4O08A 1AVTA 1PYOA 1N34B 2ZDGA 3GMDA 3OCYA 4JX8A 4LEIA 1JNYA 3LKDA 1F4PA 4X6LA 3VOTA 4EI8A 3ZU6A 5TF4A 2AJCA 4QBIA 3WI7A 2V58A 1ISHA 3CJRA 4FHCA 4XDYA 1X3LA 4G5XA 3QYPA 4C03A 4JYZA 3F2IA 1FDUA 4RZ2A 1EWTA 5E8RA 3L7JA 3R1IA 4ZVTA 1NRIA 4OXKA 3T7RA 4GPIB 4KPEC 1RI5A 5DASA 5JPCA 5KJ6A 3GFBA 1PKXA 2GJ8A 2NU9B 5JFTA 5JH7A 3AEKB 4R9RA 5KCMA 3KSBC 1T1SA 4YCSA 4QO8A 3B9RA 1XMXA 1V8ZA 3DEZA 2ZR9A 3A6LA 3FNRA 2FDXA 1GL6A 1HUQA 2O1EA 1DRKA 3PX3A 1Z28A 1RABA 4AN0A 2NUBA 2O48X 3QVUA 3NTQA 5GPBA 2ZXUA 2BH2A 2WE8A 3RT1A 3Q3CA 3UHOA 4WMLA 1PFYA 2BFFB 4C3OB 2J6IA 4G0XA 3HVUA 3FVTA 1BMFD 1JG2A 1CUSA 1KMMA 1L7OA 1W5AA 1EE2A 3DWEX 1N6NA 3JPYA 3GC6A 5FTLA 3L6OO 5EKXA 1N2SA 4UOZA 1IBRA 2I8CA 3C70A 2FW9A 3PZRA 2IC5A 3W90A 1Z5GA 2CYAA 2JJMA 2HA2A 2QLNA 5FI1B 5BRAA 4R68A 2YR0A 2C03A 1GSAA 4AKSA 2B1RA 3PQCA 4W5QA 3LA6A 3ABZA 2J3IA 4OI2A 3AVYA 2V54A 3I9JA 3MWKA 3Q9SA 5DCLA 4FFMA 4FOOA 1VJ5A 3ZY2A 3KB8A 3R0IA 3E22B 5D1HA 5K3CA 3COSA 4DC9A 2BGWA 1J9GA 4TRRA 3TZLA 1PW7A 2P4HX 4FHDA 3A4MA 2G1PA 2ZIFA 1E77A 3HP1A 4L57A 1ZNWA 1EB9A 2FPMA 2LIPA 2ZT5A 5J2TF 4CLRB 1RWNA 3AVTA 1MAHA 1WQ1R 4RCZA 5I9LA 4INAA 1TEHA 3A06A 3N6VA 4WBNB 3QI7A 3QA3E 5B55A 5BWNA 4B71A 2ZKIA 1OJLA 5KINB 1RBQA 2BEKA 4EFNA 3C24A 1JLLA 1PK8A 4RC9A 2PFGA 4WKNA 3I5MA 5KBYA 3VH4A 3EEIA 4LHWA 4HVAA 2PGIA 2WK1A 4FZ5A 4H1UA 4Y1GA 4EB0A 1GGFA 3VPSA 3X2SA 3W1WA 2PYIA 3F3YA 3O94A 4H9GA 3QYAA 1JA9A 3NIWA 4II2A 2BR4A 3QQ5A 4GMKA 3KSZO 4LOKA 5T67A 3PU6A 5KNCA 2PL3A 1BMTA 1SCKA 2NXWA 1LNZA 1RLMA 3N58A 4F3NA 1M5TA 2B7CA 2R6ZA 2JIMA 1C7ZA 2QLFA 1EUQA 1OX6A 4RDIA 2C1ZA 3WKBA 2V97A 2QORA 3UH0A 2XAAA 1YUNA 3BT7A 4H3VA 2IIQA 1CEYA 1J42A 4DMRA 5JAPA 3FOFC 4ZI7F 3DZJA 3UG7A 4RL6A 2FFBA 3HWSA 4H4EA 5IDQA 1E1DA 3WKEA 1P1JA 2WA2A 3FF4A 5AVYA 5DMXA 1FY2A 1QGDA 1P60A 2JLQA 1CUXA 3J81k 2V7WA 4TL9A 5AMXA 2YWCA 2MYPA 2QDKA 1NSTA 1YDEA 3EBLA 1ZLXA 4EW2A 5JSHA 4RMHA 4P22A 3E9RA 4OJQA 1W88B 5FD8A 3ZJ5A 4DBZA 2WUGA 3SXJA 3AEZA 2V59A 2PV0A 5IDVA 5BMVF 3AGPA 5LKAA 1I3LA 4YFYA 3KM0A 1YOVA 4G5QA 2R751 4JI6B 1LVGA 4NBLA 3DUFB 1V1RA 1QG2A 1CHDA 4TX1A 3L1JA 3LZCA 3N76A 4WXHA 3KQYA 4OJYA 1H05A 2V7QA 3EZGA 4IDNA 3Q8LA 3ER8A 3ENVA 3V5NA 1L7BA 4GDFA 2GLTA 4PLVA 4NX2A 5IC4A 1AF7A 3VDNB 4ZI7A 2O3SA 2X40A 5DYIA 5MFPA 2IU3A 4FMCF 4FVTA 4JVNA 5CGQB 5E2IA 1ZSYA 2VXOA 4LDJA 3N3BC 5HE9A 1UMCA 1U9ZA 4MUEA 1KNQA 1NR7A 1Y3CE 3GUVA 3H7AA 4RTJA 4DR5B 4AMVA 2J0QA 2QQ5A 4XARA 3K71B 4HUQB 4Q7KA 1GOTA 3DWFA 1EFLA 3OZCA 3UMFA 2G83A 3ZE2B 2GEKA 2AMYA 3Q8MA 1EVJA 4TLAA 1G8MA 2FJUA 4QUEA 4CIWA 1FSZA 2W8ZA 4IGAA 4WL0A 1ZW1A 3PKIA 1JX6A 4IHKA 2DH5A 5HK8A 1XLWA 1WOYA 3T9BA 4BN0A 1M1XB 1K66A 2PGJA 3A1TA 4BKPA 5JT1A 4DSUA 5KVVA 1SCAA 3MJHA 4E5SA 5B4UA 1AJEA 3MWGA 4KBYA 5FLKA 3TLJA 1BXGA 4MAMA 5CLJA 1JFFB 4W9NA 1FRQA 3CRW1 1ANKA 2O8CA 4MHOA 3UVEA 3CVWA 1ENOA 1JALA 2VNIA 3ESBA 2XEDA 4BB9A 3G3EA 2I03A 1W0JA 2HUPA 3HKBA 3PHGA 4LF9B 3N8KA 4C0WA 3IODA 3NV7A 5IKMA 3OLZA 4Z9XA 4H0CA 5A03A 2VSFA 1XMIA 1QO0D 3FSGD 2R87A 4KO1S 2CNDA 1L7XA 4EZBA 5DP1A 1MH9A 2ZCUA 3DOEA 5HQ3B 2FU5C 2Z04A 2R2GA 1ZJ4A 4XXHA 1ONBA 4K9QA 3EOAI 1JMKC 3QNUA 5KYXA 4ZYXA 5JBQA 4KPGA 1FTSA 1QH1B 1ACJA 1YE5A 2FRDC 2EZ4A 2G4VA 2OE2A 1W0KD 4HYYA 2V7XA 2NX2A 3S2SA 1SBYA 5JSUA 5IKXA 2PT7A 3C5EA 4ASUA 2FOXA 3GYGA 1FFGA 4IJKA 4MQ5A 3DTVB 2R47A 4URWR 3USES 5BSHA 1DIGA 2FKNA 1AURA 4RDXA 1NJ2A 3DLBA 2UZAA 2N1MA 3M6FA 4B35A 3SZUA 1IXYA 1ISMA 2I55A 3L18A 4R81A 3LUPA 3AVPA 3T5AA 3SX4A 3NZEA 3F4KA 3D8RA 2ZM6B 4IWNA 2IS6A 2HIAA 4J9VA 2NZ2A 5KWEA 3SC4A 5KX5F 4I6JA 3G8DA 4E5PA 3N8HA 1GO2A 4JJFA 1SUBA 4PG7A 4U5QA 3T5GA 4A6DA 4YYZA 5E9QA 1OBFO 2SNIE 4JUDX 3QFCA 4LRWA 3P9KA 1NJ6A 3I62A 4P4TA 2YYSA 1GD1O 1WMDA 4HYEA 2EGUA 2R0QC 1WP4A 1XALA 1DAOA 2OBYA 4YDQA 2HA3A 5T4FA 1HZZA 2PX6A 3V4SA 1IU9A 4KK4A 3WL8A 4IMPA 1NJ1A 5ICEA 2V4MA 3MGBA 4RV4A 2WSMA 3K6KA 1NRWA 1QQTA 4OJNA 4DCUA 1ZKMA 3G0OA 1JR6A 1K7EB 2AUTA 3QBEA 3GT3A 3H4TA 2X6RA 3IO3A 4TV8B 1F0KA 2J3QA 2PSHA 3TRKA 3V2HA 3BICA 4A16A 9GPBA 1Z0DA 2G36A 4WOCA 2AZ4A 1ZGBA 2QB5A 3LC0A 2CXHA 5JCJD 1Z6PA 2G9UA 2WUFA 4C4PA 2J5XA 4C4XA 5L3RA 4JD5A 2X4LA 3C1UA 3N2KA 4MP3A 2H29A 3FYUB 2K5UA 4Y98A 4KAXA 1L4KA 1GVHA 1C7QA 1HEIA 1G2IA 5CGZA 5DCUA 3OUTA 2AK3A 4ND7A 4ARCA 4K1XA 3I76A 5FI0B 2ZJ0A 2EFYA 2NNLD 1FCJA 1US8A 1T4GA 1VPTA 3CW2A 1GKKA 2R1UA 3HUTA 5AH0A 5GY7A 1FDRA 1H8EA 2JD1A 3L04A 2C99A 3N2ZB 2IKSA 3TOZA 1FE8A 5H02A 1G9TA 1GT91 3LQFA 4KAFA 3M1LA 1N25A 4LNHA 1T13A 1AG9A 2P4SA 3C98A 4F3RA 1O95D 1HH4A 1JKMA 1E0DA 1EFHA 3MUNA 4P92A 3W5SA 4R2WA 1XA4A 2G0AA 3MGCA 5FFNA 5A2GA 5JDCA 5DM0A 1N1EA 1BG6A 1RYNA 1YR2A 3FNGA 3KSDO 2G5PA 1I14A 3BTOA 4YRAA 3BD7A 1ICIA 5LDGA 4U39A 4M1TA 1P80A 3X43A 1JIQA 4EG4A 2OFWA 4G0YA 4I55F 4DEXA 1QX3A 1DRJA 4JELA 5C7IO 1QGUA 4HF7A 4F2PA 1D03A 1L5MA 3GPLA 1T5BA 4N0EA 4CLDA 4B4WA 4B0OA 4HAYA 2WKWA 2X8LA 4IIXA 3GAMA 4NCJA 2NSDA 1EE1A 2C95A 4FWBA 5I9IA 4N82A 3PNKA 1E60A 2JJQA 5ULLA 4MS1A 3EPRA 3R76A 3SZGA 3WX0A 4LMBA 1X74A 2P1ZA 3BZBA 1EZ1A 3ZHUA 4CMEA 4PWYA 2HQOA 1G7SA 3ZGZA 2D3WA 1A8SA 1CBUA 2AN1A 2ECPA 3Q87B 3M6AA 1EP1B 4J6EA 1A9XB 3WRVA 3ZQUA 5TPWA 5A6VA 1CZHA 2D4AA 3KB6A 3O4HA 4KJZA 3IRVA 4R7TA 1MOSA 4PGGA 1HZJA 3CTMA 2ZK7A 3TLYA 1Y3FE 3R5SA 2VXYA 2AEEA 1MB9A 4RJLA 1R6TA 2OQIA 3HM2A 4NK5A 4HEJA 1DCMA 7ADHA 1ZBDA 2G67A 2REQB 3TR5A 4P6VF 2XMCA 2IYVA 2GDZA 1LLDA 1IQRA 2XJ9A 3DHWC 3IR5A 5IVHA 5MHTA 4QUIA 4MVJF 3PHCA 4RFSA 5K3AA 1K86A 5A7HA 4BFYA 1Z15A 4PC6A 1G3QA 1RQLA 3LCUA 3KLOA 4CIVA 1II8A 3FH0A 1RXSA 4UHKA 1I13A 1KJZA 3NXSA 1B2LA 4XX0B 4C06A 4R9NA 2AJDA 3T9EA 2F1KA 4L1KA 3T7IA 3U56A 2OK8A 1U7OA 3L2OB 4J16C 4LYFA 4B84A 2H4YA 4KN5A 3FSGA 2Q1UA 3FVQA 3PFNA 3RIEA 1PT5A 2PXHA 3MMNA 5F1PA 3T3IA 4D8UA 1WDKA 2CEAA 4TWAA 3OQMA 1L1QA 2AS0A 2H4HA 5DTJA 1NRXA 2NZJA 3Q9UA 5CYOA 3KQMA 3RJMA 3TVDA 2OBXA 1TK3A 4Z4GA 1VYVA 1J90A 2BHTA 4GKBA 1SU8A 1XCJA 1P3Y1 5AM0A 1T9KA 2O7RA 3JD4A 5M3BA 4MV9A 3RC2A 2CXSA 2C5LA 4JDPA 4MICA 3PL1A 1TF7A 2VOEA 3AP3A 2PA0A 1N57A 2B8NA 2HWKA 3OLVA 4I5IA 5CPBA 5I47A 1LD3A 2HOQA 3FMFA 4JYAB 1H3EA 4ZDKA 4I4NA 5FQOA 4CLOA 3CEJA 5BQPA 2PQ6A 2PZMA 4YYEA 1X92A 3EQ8A 4MV8A 3TNJA 1KIFA 2BOVA 2DVMA 4KN9S 4DQ0A 1SUIA 1R4MA 1FX0B 2R25B 3L8CA 3BHNA 4MS3A 3AMVA 1BKSB 1S4QA 3R9XA 1T4MA 1V37A 2GRJA 4L07A 1RRKA 5K3FB 5DEOA 3TQSA 4LF5B 1T0JB 5CPFA 2A9QA 1UBOS 1POWA 1T24A 1VL0A 5DSTA 3CF4G 2NO5A 4AZ3A 1LPSA 4KQHA 1YUMA 5NLLA 4MPPA 2XE7A 3PA6A 3H1TA 3M2PA 4TTQA 3VXKA 3G82C 3EMDA 4O4IF 2H9YA 5L4LA 1AKMA 3GFOA 1T1GA 4Y1RA 4C05A 5L95A 1W85B 2FSFA 4NICA 2E4ZA 4WLVA 4XQ0A 3SOPA 1MHTA 4NFHA 1GQRA 2GVZC 3G2KA 1XRLA 2VDWA 5G0VA 2IIVA 1XZCA 3N0VA 1XPJA 3R41A 3E5RA 4UZFA 2H3EA 5AI6A 5IAEA 4JVSB 2WVHA 3EIOA 1VDZA 2D2FA 4H6PA 1BMQA 1PV1A 5AKZA 4FYYA 1NJGA 1LDBA 1ZOSA 4Q9IA 4UUOA 1C8KA 1ONNA 1PWEA 2XE6A 3D5QA 3SHQA 3LF1A 3R5HA 4FYMA 4EHKA 5MDHA 3GRZA 3CE6A 1ECJA 4OQPA 3ZKAA 4AXBA 2I3ZA 4YV0A 1G21B 3LC7O 1QFJA 1F2TB 1YUBA 1FXSA 4WADA 3EGOA 4FMDF 1HNXB 4XGQA 5LQCA 5TS3A 1HMPA 2JEZA 2QZJA 2VIIA 4MGEA 4WW0A 1E32A 4A2CA 3A9CA 5J3JA 1R6UA 4PX5A 1LPNA 2MDTA 2QJOA 2ZBQA 3I5UA 3L02A 3PNYA 5D1NA 5HRAA 4UUQA 4X1IA 1QQ5A 2YWBA 3ICWA 1N8TA 3BA1A 3GUHA 1OIVA 1P17A 3V9AA 2JI4A 4FW8A 2J9ZB 3DE3X 4KHZA 2AVNA 4PLWA 3EGVA 3TPZA 1PG0A 2NLOA 5E1OA 4ZC1A 3B82A 3WL7A 1R0KA 2QLJA 4D8YA 2VA8A 4KBFA 4F21A 4NZOA 1H22A 2I62A 4S2UA 3EVFA 4GWGA 1T8WA 1EFDN 1C0IA 2DPYA 1K7SN 5KHAA 2YJ5A 2JFNA 3E7PA 2R4TA 2VTKA 4ZVVA 2WG0A 2DECA 2YYZA 1H94A 4R3UC 5A4DA 3ZV5A 4EW6A 3DJFA 1OHHA 2QTZA 3NTOA 2JVIA 2GS9A 3JWIA 5FUYA 2CHQA 2G9VA 4M1WA 5BSMA 3PPWA 3OETA 3I8SA 5BP7A 4MUNA 3WK9A 2UXCB 2YFKA 1P6XA 4Q66C 2BEUA 3GJ6A 4ZN6A 3ZCQA 1FFWA 1V3TA 3L0ZA 4QUDA 2IF2A 4FMDB 1IM2A 5IXJA 3G2LA 2YBEA 5E7IA 4HG2A 2VPYA 4CUZA 1AU9A 4QFDA 4DDTA 4LRSB 5BV7A 3AF6A 2FEMA 1G21E 4H4CA 1KMCA 2ET6A 1Z5NA 1APBA 2PUAA 1W8IA 221PA 2O23A 1XPUA 1GR0A 3N2EA 1L4EA 2IPOA 5FWXB 1HZZC 1OI4A 2GA9A 4QG7A 4JBLA 1NDUA 4YVFA 4C1NA 2QRHA 3ISVA 3QOFA 5EIAA 4LFAB 4ZOCA 4IIVA 5ICFA 1Z6ZA 4KW7A 2R7LA 3CRMA 5EIFA 5FNVB 4B3DA 3OE4A 4H35A 5HMLA 2Q3EA 2DSTA 5CVJA 3UTDA 1SOMA 2NUPA 2JG3A 4UBKA 2J7PA 2EZTA 4HFJA 4OKIA 2I2FA 4X63A 5EN4A 3V6LA 4DG8A 3HKEA 4FKBA 1RPZA 5LR6A 3IELA 1L8OA 5K4AA 3KXKA 2PV7A 5KYKA 3MVEA 1XD2A 2P3QA 2HUNA 4BO0A 2ZRHA 3F5QA 4CLEA 5KHLB 1L4BA 4WN9A 1K6JA 1TVCA 3SHTA 1Z5WA 2A5JA 3PQ4A 2VC2B 3W2HA 1FC0A 3T4PA 3HM9A 2QM8A 4QDJA 1FUIA 3G8BA 3L7OA 3ENWA 2H48A 5E1BA 1JFTA 3T3OA 2FSUA 4PZEA 3GLHB 4FFOA 5HBGA 5I8PA 1BRTA 2YV5A 4D7AA 3O8BA 1MC8A 5CX4A 5CDGA 1A2KC 1NI3A 2Q6VA 2Z0MA 3MT7A 4G0OA 3HU1A 4L4RA 2ORVA 3ZVRA 1YT5A 3USZA 1UKCA 3O1HB 4JR1A 4Q47A