4P32A

Crystal structure of e. coli lptb in complex with adp-magnesium
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
234
structure length
234
Chain Sequence
ATLTAKNLAKAYKGRRVVEDVSLTVNSGEIVGLLGPNGAGKTTTFYMVVGIVPRDAGNIIIDDDDISLLPLHARARRGIGYLPQEASIFRRLSVYDNLMAVLQIRDDLSAEQREDRANELMEEFHIEHLRDSMGQSLSGGERRRVEIARALAANPKFILLDEPFAGVDPISVIDIKRIIEHLRDSGLGVLITDHNVRETLAVCERAYIVSQGHLIAHGTPTEILQDEHVKRVYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Decoupling catalytic activity from biological function of the ATPase that powers lipopolysaccharide transport.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Lipopolysaccharide export system ATP-binding protein LptB
total genus 84
structure length 234
sequence length 234
chains with identical sequence B
ec nomenclature ec 3.6.3.-:
pdb deposition date 2014-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF12399 BCA_ABC_TP_C Branched-chain amino acid ATP-binding cassette transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4p32A00
4JSYA 1UM8A 4F7WA 2ZUDA 2CDNA 2QMUA 2RMKA 2BM1A 1G5RA 1Z8FA 1LV7A 3KKOA 5CJ2A 1X3SA 1KO5A 1P60A 5IK2D 2FN4A 4LX0A 2UZIR 3KFVA 4JYBA 1GSIA 4H1VA 4KLZA 4ASUA 1TPZA 3HU1A 1T3SA 3K0AB 4HATA 5C1BA 1QF9A 4U7DA 1NVXQ 2ZI9A 3GJ4A 4QL3A 4RSGA 4W9MC 1E1QD 1VHLA 2AN9A 2RB4A 1F3OA 2FU5C 2GETA 3CF0A 3RAPR 5JJIA 1GVNB 3U44B 4KITB 1U0JA 4CIDA 621PA 3OESA 4NCNA 4DLWA 1CEEA 5K8TA 4RD1A 4XJXA 221PA 4BE7B 3VHLB 1XD8A 2QP3A 4QRHA 3UG6A 3C7KA 4A8JB 4TT3D 3B8HA 2OBNA 3F8TA 4P31A 5TY0A 4URVR 1XBTA 5JCZA 4QGHA 1ZRHA 1JEEA 3E70C 1BS1A 2DFLA 3CR8A 4QKQA 1G18A 1Q3TA 3LO5A 1IONA 2WVJA 4KI0A 2GEUA 4L8GA 5DI3B 4IDPA 4W5HA 1PLJA 1II9A 2ZETA 1XEXB 4FI3C 1HT1E 3WYFA 2QT1A 3CNOA 4HUQB 4M4SA 2JLQA 3SYKA 1Z0DA 3AVYA 3CB4A 1KO7A 3CBQA 3QKSA 2ZI6A 1CF4A 5IK2A 3UKDA 3HP1A 1G1MA 2XTZA 4YMTA 1L7VC 3OZXA 2ORVA 1SVLA 2ZS9A 3VU9A 3U3JA 4Q9HA 2BM0A 4DLVA 1I2DA 2DB3A 2IYLD 1F60A 4K81B 3OEEA 4PX9A 3RS7A 1OH6A 2K5UA 2A5GA 3T35A 1WQ1R 4HB4A 3QG5A 4EPWA 4DHEA 2JLUA 1CJVC 2NTYC 2ZIAA 4DCVA 4PQRA 4P32A 1XPOA 4D0NA 2QRNA 4TLDA 3ICQB 1VG9B 2ZE6A 1R0XA 4XWOA 2IUUA 1OH8A 1ZIOA 1E0SA 3REFA 1YZQA 2VBCA 2R6DA 2X1VA 2PZEA 3AM1A 4CW7A 3L0IB 2P5SA 4LHZA 3G5UA 1WXQA 2ZRHA 4QBHA 4US0R 4JIMA 4XVRA 5E7IA 3A1TA 4XOIA 2D62A 2UVQA 3CNLA 4LHXA 2PBRA 3NKVA 4LYFA 2QENA 2QZ4A 2NOAA 3K0AA 5FPYA 4NYJR 2XGJA 4LPKA 1SXJA 5J4VA 1P75A 4RD6A 2EWWA 3C5HA 1XWIA 1TQ6A 3P20A 4M2LA 1EWQA 2FSGA 4MRNA 3QKSB 4NBSA 4TLCA 2B7CA 3PENA 5FUVA 4UXIA 2P6RA 1M7GA 4YDSA 4HLDA 2XTNA 2JA1A 1TQDA 1E2JA 2GEVA 2YWGA 2WAXA 5SZKB 1UKVY 4XH9B 3EC1A 5DI9A 2YC2C 1U98A 2BBOA 3K9NA 1WA5A 2REOA 4URWR 1ZM7A 4B35A 3GLGB 2FSFA 1UFQA 2I3BA 1CR4A 1Z83A 3NBYC 2GCNA 1W4CA 3LLUA 1KI6A 4H1UA 1KKLA 1RIFA 1YKSA 3CPHA 5HCIA 2CHVA 2ZSFA 2ZRLA 3MGCA 4LBYA 5H8WA 3AGQA 2GKSA 4QGGA 2AL7A 1G16A 3EWSA 4A9AA 4BZXA 3PQCA 4BFTA 4ESHA 1MO4A 4DCSA 1A1VA 3QXSA 1T5LA 3AUXA 1Q1QA 1M6NA 3T61A 2ERXA 5FTMA 1A2KC 1AZSC 4KVAA 1OFTA 3PITA 4TSFD 2HJGA 1CXZA 3V00A 1P7CA 1RPZA 3VU9B 4TMKA 1ZBDA 3IGFA 2JLXA 4HUQA 4KO8A 4BEJA 2W2XA 1DG3A 4EPRA 1SVKA 3GLHE 1XMIA 1GFIA 2ZRKA 3SNHA 4F92B 3R7WB 3NXSA 4YMVA 4JLNA 4DZZA 3K70C 4DT1A 1NBME 2BMDA 2ZYUX 4ZKDA 2YOGA 1W4BA 3WMGA 4RVCA 1KK3A 4TL8A 4TN1A 4MYCA 2TMKA 4Q1FA 3CF2A 2DY1A 3GJ0A 3QBVA 4LJ9A 2RAPA 1CLUA 4AYWA 2XSZA 4KSBA 4HLQB 4EKDA 4FD2A 3O8CA 3RWOA 3IEVA 3DMNA 2ANCA 2QP9X 5B2ZA 1ZD8A 4XTCS 1OF1A 4OYHA 2QAGC 3EWAA 4X8OA 1EK0A 1XJCA 2IXFA 5CM9C 1ZNZA 2OESA 5DISB 3ADCA 2WPDD 1CIPA 4V0NA 3THYA 1UBEA 3HU2A 3U3RA 2VPPA 1S3SA 2KBFA 1OH5A 4MRRA 2MMCA 4HB2A 2J41A 2QPTA 5DSZA 1N6OA 4MKHA 1T0HB 2GJKA 2QY9A 4I1OA 1CR0A 4DUGA 1JAIA 3ZIAD 4P3YA 1E2PA 4R7ZA 5FR2A 1DO2A 4EQ6B 4RKFA 2QPOA 2PL3A 2NGRA 2W6JD 3OEHA 2O8FB 1GNRA 1E2GA 5SZHB 4EJSC 4W5JA 2YHSA 2R9VA 2QA5A 1GL9B 3AEZA 4Q5IA 5GJBA 2MSEB 3AF3A 2WKRA 3A4LA 3ETLA 2H5EA 4AK9A 2ATVA 2NG1A 1DADA 1EGAA 3GLFB 2IYVA 4IDHA 4MUAA 4C0QC 3TSZA 1K6MA 3BS4A 2IBMA 4FWIB 3TH5A 3CX7A 3RRMA 1IOZA 4DT1B 5GVRA 521PA 1WB9A 2XZPA 2WJVA 4Q9IA 1KI4A 2ONKA 2ZRGA 1B0UA 2FJUA 3C41J 4BLPA 2WWYA 1NVWQ 1VCNA 2HCBA 2RGCA 5IDVA 1Z47A 4ZDWA 1XD2A 3H4MA 3M1IA 3AQ4A 5TDHA 1CS4C 4MYTA 4N3NA 3WRXC 5A0FA 2EVWX 3ZZUA 2NZJA 5EE3A 5EZ6B 4EPYA 3ZVNA 1F2UB 3AGPA 3QNUA 4MITA 3VKGA 4MKIA 4WA7A 2Z6VA 5FBWB 5L3VA 2KI5A 3BH6A 3CNNA 5FOTA 1YZLA 5L3QB 4B3GA 4V02A 4B34A 3D7MA 5KDDA 2DFTA 4G5OA 2NO1A 2W6ID 3MWKA 3IEUA 4BGDA 5G41A 4PAOA 2IEZA 1LB1B 4UNSA 2AKAB 2JLVA 3FKSD 4NMMA 2GXAA 4ZIRA 1DAMA 3HPQA 4XD7A 3PUYA 2OFXA 4WBSA 3LVRE 3PJRA 2GJAA 3MWJA 4NL4H 4TQ9A 1XXHE 2F9MA 3B6EA 2NO9A 2BWJA 4IVPA 4MRPA 1RFLA 2ZS8A 1E1RD 2B21A 3QEJA 2RGXA 3ZQJA 3A4MA 1NN5A 2ZJ2A 5FTNA 2O8CA 4QGAA 2BJWA 1JPNA 4TL7A 5DI3A 1P9WA 2ONJA 3ZVRA 5JEDA 1OKKD 1JNYA 3TVTA 3PG5A 4ZDKA 2V1UA 3EPHA 5BYJA 1XMSA 2J0UA 1L2TA 4KBGA 1G4UR 1R5NA 4GOKA 2H16A 1FOEB 1GITA 1JPJA 3FWYA 1ZCAA 3SQWA 5E7JA 1ZNXA 1U90A 4QOSA 3FMIA 4FW9A 3CH5A 2ZTSA 3KKQA 4PO1A 5GJCA 3O8RA 4UNRA 1DO0A 1JAHA 5J4YA 4PC2A 3ND9A 1X1SA 1D5CA 2PT7A 3ZQ6A 3K1JA 4BFXA 1WRBA 3EASA 3FFBA 1G5PA 2WJJA 2ERYA 4CEJA 4W7SA 4B3FX 1UF9A 1UJ2A 3SHFA 1N6PA 2W6IA 2HV8A 1GILA 3QF4A 2IYZA 2WJHA 4FMCF 4Z1MD 2JASA 4IXMA 4PC1A 4F4JA 4Q4HA 4CDGA 4P0TA 2ZRPA 2RGNC 1JEDA 1WF3A 4Q02A 4YDHB 1XPUA 4TYQA 121PA 5EQTA 2CJWB 3C15C 1TUIA 3THOA 3UANA 2PEYA 4ZI2A 1XF9A 4MDEA 3I61A 5FPSA 3GLIE 2G1JA 4KBFA 2CHGA 5CITA 5L3SB 3D31A 2VHTA 4OJKA 2H17A 4UNQA 3MRSA 2GF9A 1SGWA 1W4RA 3ND8A 2WAYA 4Q00A 2O52A 1P5ZB 3TR5A 3CRMA 2YZ2A 1R8QA 3RS3A 1BH2A 4EQ6A 4EPTA 2ZRMA 4MRSA 1US8A 2GRJA 1K5GA 4ZDJA 3GEEA 3THXB 3WP0A 4C7OB 3TVDA 4JLAA 1XEFA 4A2WA 2BEKA 3I5XA 1AJEA 2PX3A 2IYWA 1CTQA 1N3BA 2MSCB 3BD9A 5TV2A 5C46F 5JWHA 4CZ2A 4D81A 4K46A 3TK1A 4ZDIA 5JCPA 3K0SA 3VKHA 4MDFA 4IDQA 4JBYA 4XVQA 3B9QA 1P2UA 2OT3B 2V7QD 3MWLA 3LY5A 3SU8A 5HCNA 1SKQA 5L3RA 5F98A 1JR6A 2JGNA 2VP6A 3JVUA 5JI2E 4BLSA 2GA8A 3IPYA 3B60A 4BPBA 2LCFA 4PPQA 3V4FA 2IEYA 3AVPA 3WNBA 1U99A 4LHYA 1WMSA 4MKGA 5FUWA 2NPFA 4G5GA 3I1FA 2H8KA 1SVOA 3X1DA 2O8CB 2H18A 3FMOB 3MUFA 4DRZA 1N6KA 4GFDA 4OK6A 2FPLA 1TEXA 1IAQA 4Z51A 3GLFE 4DLUA 3IIMA 4KSCA 3IBYA 2JLYA 4RFSA 1BIFA 1W36B 4LV8B 1MKYA 4GOJA 1DAEA 1AM4D 4C7OA 4B2IA 4CVNA 3DKPA 2ZSEA 3F5FA 3W34A 2ZQ5A 4QG7A 1G3UA 4WZAE 1YRBA 1IXRC 1E6CA 3HJNA 2F3TA 1VG8A 1G3MA 3VHXA 4E09A 2W0MA 1QG4A 1ESNA 4KODA 5CDFE 2XNDA 2EW1A 1RRPA 2D2FA 2PCJA 1GRRA 3AF4A 2QTHA 1KY3A 1XTIA 5JHGB 3G82C 2CHQA 1DPFA 1UKZA 4JLDA 4ASUD 2G6BA 3K9GA 3SYLA 2VP9A 4Q7JB 1U94A 3A6PC 4N0EA 3WMFA 3RSLA 4BRWA 1HTWA 1BKDR 1YHNA 1ZD9A 1E79D 1ZM4A 1N2CE 1XRJA 2GK7A 1OV4A 4NCKA 1XZQA 3RLFA 2Q0HA 2IK8A 1JALA 2C95A 2IWRA 2OAP1 3T12A 2QTVB 3B7GA 3WXMA 4DSUA 2IF0A 5H68A 3OFNA 1JQLB 2DYKA 4OHYA 1AS3A 4DIDA 2DWQA 5SZJA 3N70A 2ZE7A 3EXAA 1VDZA 3W6NA 3ONWA 5FOVA 1PVOA 4AYXA 4L9SA 3WBKA 1T6NA 3SDZA 3LAWA 5C2JB 2XAUA 2WSMA 2CCGA 3PUZA 4G5SA 4KHZA 4R2IA 5CDFA 3AKYA 4ACAA 3Q5DA 1E4VA 2ASEA 2J7KA 3W5JA 1ZVQA 2IXGA 5TXGA 4RZ3A 2BKUA 2VYFA 5EXTA 1GL7A 2J46A 3IQXA 3KJEA 4Z54A 4D26A 3U3KA 2CJWA 1N5KA 2QEQA 1IY1A 1K8RA 1UPTA 3RWMB 2I1QA 4EFMA 1HURA 1T8UA 2ODEA 4LV5B 4BZPA 3L0OA 4DSOA 4YMWA 5DE3A 4A36A 4TMTA 3FHCB 1E69A 4B44A 1QHIA 4DKXA 4TQAA 3FYHA 5F9FA 3SFZA 1E1RA 5KNCA 3RS2A 3GJ7A 3A8TA 2ZXUA 2XOKA 1T5IA 3GJ8A 2Q3MA 3CO5A 2WICA 1S2MA 4C4PA 4B75A 2R6FA 3V4RA 2F9LA 2RGAA 3PEWA 2V6JA 3CPJB 1E32A 2VP2A 3PUVA 2Y8EA 5AUPB 1PLKA 4TL9A 2AR7A 2V9PA 2V4ZA 3WP1B 5G3YA 4AI6A 3B9PA 2A5JA 2VRWA 4BFZA 1YR8A 1J8YF 4ZI3A 1N5IA 3IIJA 3LQQA 4HB3A 4Q4JB 3KUDA 2HXSA 2HF8A 1DELA 4BQSA 2QBYA 4BFVA 5JSZA 4DBLC 3DM5A 1SXJE 1W5TA 3MCAA 2AXPA 2ZS7A 3X1WA 4LJ5A 2OFWA 1Q12A 4F93B 3AVXA 1II8A 2NQ2C 3DPUA 1GOTA 2CE7A 2GVZC 1PZNA 1IBRA 3ZS9A 4F38A 1E1QA 1KMQA 1IXSB 1G6OA 3OIVA 2ODNA 4M9SA 5CB6A 3OAAA 3QUSA 3BIFA 2JIZA 3QPVA 2JJ2D 2I4IA 3KB1A 3GFTA 3R8CA 421PA 3O8BA 4JVSB 2GXUA 3A1VA 1M7BA 1Z3IX 5AWFC 3IPXA 1NLZA 3EZ9A 2PLFA 1Z06A 5AR1A 2YINC 2FH5B 3OE7A 4JVLA 1XTQA 4GMDA 3TAUA 1XEWX 4QBIA 3U7GA 1R0ZA 4KV9A 1Z0IA 1YVDA 1T3HA 3E5HA 4OQXA 5JI3E 2FZ4A 1BMFD 3QE0A 4TMVA 4EDHA 2JEOA 1OHHA 2B6HA 3HPRA 4Q1EA 2R6AA 1XTKA 1ZCBA 4I4LA 1QHYA 4P33A 3T06B 2D3WA 4ZCLA 4B71A 2VQSA 3CW2A 1XJQA 1E9FA 1QVAA 4HLCA 4R71A 5KDLA 4ARZB 3CLVA 1WDTA 3MAAC 4IVQA 2QBYB 1B23P 4O0MA 4OQMA 3FKQA 3TJZA 4S2EA 2JJ8A 2AWNA 1NIJA 4QNMA 3SN6A 1OXVA 5TVKA 4TYPA 1GP2A 4Q1AA 3D8BA 1XEWY 1OKKA 5FI1B 1OE0A 1OSNA 3ZD7A 1N0UA 4YQFA 1R7RA 2CVHA 5LBIA 1M74A 1IXZA 4RKEA 3LFUA 1HYQA 2WOJA 3T5DA 1J2JA 3SJBA 2VTKA 2VEDA 2R65A 4BLQA 1N6LA 1LS6A 2RGEA 1RKBA 2XXAB 3P4XA 4ZO4A 4Q48A 4DB2A 2JJ2A 3QVUA 2V55B 3LBNA 1UKEA 4D6PA 1FTNA 3LV8A 3WBJA 3W6OA 2OILA 3K0FB 1P73A 1G8GA 1P72A 2IYUA 3TQCA 2IC5A 2XSZD 4N1AA 4Q7LA 1W46A 3W90A 1Q22A 1ZD1A 4TTQA 2OG2A 2Q9BA 3QVVA 3R9XA 5J4LA 1NRJB 4DIEA 1S8FA 1IN8A 2D2EA 4Q01A 1L4UA 1XNJA 3LD9A 4TMZA 3DVLA 2ZRIA 2NZ8A 5A5GA 2ZAOA 2A5FA 3KQLA 2WPDA 1DG1G 1VIYA 4C0BA 2QGNA 5D3QA 1LW7A 1TX4B 4HDQB 4KFTA 4GNKA 5CK5A 3BFKA 1E2HA 3KJIA 1DARA 2PZFA 4CT4B 3PEYA 2GAOA 2REBA 3VFDA 4B47A 5CB8A 5K8LA 2ZRJA 2OEPA 1SULA 2BC9A 3SBDA 1Q0UA 3RNLA 2JDID 5KSOA 2HT1A 3ZVMA 1RYFA 4QJ4A 1KK1A 3K0CA 3LBIA 3R7WA 2E9SA 5KPDA 4Y0VA 4AYTA 1YR6A 5BQ5A 1OW3B 1CRQA 4RFSB 5JRZA 5A4JA 1MOZA 1P61B 1W0KA 5DO9A 1FUUA 2IXEA 5CYOA 4ARZA 2LWIA 1EFRD 3THWA 3R9WA 2XEXA 5TARA 4CRWB 1Q20A 4H9GA 2GXSA 3U44A 3L2OB 5IRCD 1ZIPA 1GKUB 2QAJA 2GXQA 2ZSDA 1HUQA 3PR1A 1R4AA 1KO1A 5IF9A 3M6AA 2A5YB 1KDTA 3VR4A 3KXIA 4DLRA 1N6RA 1H8HD 1S1CA 3F3YA 4PFSA 2CNWA 3A4NA 3VMFA 4B32A 3DDCA 2JIZD 3HU3A 4TT3A 2ZJ5A 1KSGA 2IHYA 1R6BX 3U6KA 3GFPA 2HF9A 1J8MF 1Z6TA 4A0RA 2W58A 1TF7A 3KUCA 4DDTA 1ZINA 4JL6A 3DEFA 4PHGA 4XD7D 1ZP6A 1Z0FA 1T4GA 1KAOA 1W44A 3LW7A 5J47A 3PVSA 2ZJ8A 3JZAA 2Z5FA 4UNNA 3I5YA 2C77A 1J7KA 2XTMA 2ZM5A 3SOPA 4AG6A 2VSOA 1GZSA 2PX0A 1KDOA 2E87A 4D80A 1XPRA 2RHDA 5TMPA 4UQOA 5JZVA 3TGPA 2OV2A 1WP9A 3KQNA 3WRYC 1KSHA 3WNCA 4BLOA 3RC3A 4R9UC 2IYYA 1E4YA 1OT3A 2P65A 4LOAA 4AKGA 4C0AC 4HAWA 2QORA 2FFBA 4A6PA 4JLVA 5KDOA 2VHQA 2PLRA 4A8JC 5JWRA 1HEIA 2P6UA 2O8BB 3KZ1E 4CT5A 1M34E 1K5DA 1ZMXA 4L4UA 1NJGA 1R2QA 3SFVA 4GI7A 1SHZA 1TQ4A 1OYWA 1ODFA 4NPHA 3SE0A 4PAQA 4OI4A 1GNPA 3N2EA 4BFSA 4FMBB 1AZTA 4JL5A 1UDXA 3D6TB 3CWZA 5CM8B 2OZEA 2PEZA 2C9OA 1C4OA 2EU8A 5FL7A 1XD2B 2VF8A 2CK3A 1KMHA 1Z6XA 4PO9A 3RRZA 5JEEA 4A0GA 3VX4A 4B2LA 1D9XA 3UK6A 4XTRA 1A5TA 4IOJA 4YC7A 5KHOC 2P5TB 1Z07A 3GLFA 4JT2A 4GT1A 1DAGA 1Q3HA 4HB0A 4LJYA 1E9DA 1MO3A 4CEJB 1VHTA 4U02A 4LPSA 5TB5A 4BWYA 1E9AA 2ZRNA 2F43B 5LD2C 4JS0A 3Q9LA 2YWHA 2VH5R 4QNRA 4ABYA 2ZRAA 2MMGA 5GJWC 4RD4A 3E2IA 4BEBA 3IIKA 2DPXA 1JR3D 5L3SA 3NDPA 4ON9A 4A1FA 1F5NA 1AS0A 1UKYA 2F7SA 1TL7C 2YV5A 2ODBA 1E99A 1FX0B 4OQFA 4HYYA 3T1QA 2JAQA 1NLFA 1GWNA 3BRWD 4M1YA 5EUMA 4M1KA 2YJTD 1HQYE 2EQBA 4Q7MB 3CKLA 1E94E 3FKSA 4WIAA 1JI0A 2JJ1A 1G8HA 5JFGA 1G3RA 1G7CA 1AQUA 1JXOA 2IL1A 5LD2B 5CIWA 1E96A 1GUAA 1KI9A 3QENA 1MRNA 3CX8A 3CRVA 3PUWA 4JBXA 4KFSA 5G53C 4YONB 3GLHB 3NIBA 3NH9A 4GP7A 4Q4LA 4GDFA 2ZI4A 4LC0A 3BB1A 1FUKA 3CRW1 3W3AA 4KLNA 3VNVA 3M4YA 3NVAA 1LY1A 2WBLC 3NEYA 4BFWA 1Z0AA 3KTAB 5JJKA 5JJLA 2G77B 2N42A 2FE4A 1VG0B 3FDIA 2VP4A 1W0JA 4B73A 2GWHA 3IHLA 3QI2A 4JLMA 1UEJA 2CLCX 1W2GA 1YE8A 4NYJQ 5K8UA 3D3QA 2OXCA 2QT0A 5KNDA 2CXXA 3DL0A 4OKSA 4URZR 1DBSA 1UADA 1Q57A 4NH0A 4ESVA 1S9DA 3OIUA 4E22A 3A58B 3A1UA 3RVBA 4Z8XA 2GAAA 3X1XA 1U8ZA 3B82A 3OE7D 2BBWA 1NKTA 4NKRA 2OCAA 3KXLA 4TYNA 5DN6A 1AKEA 1R8SA 1OHHD 4WXRA 1OIVA 3I8SA 4PZZA 4PPNA 4DB4A 2P2LA 2YNMA 1LF5A 1IY0A 5FTLA 3GLIB 2I1VB 3EPKA 2PH1A 4L15A 1G9XA 2DHRA 3KKPA 1VCOA 4K8OA 4CYMA 4KFRA 4M53A 1FX0A 2IS4A 3T15A 5DHAA 1H8EA 2C78A 2IHBA 4QJ3A 4AG5A 2O8FA 2DCUA 1U9IC 1C1YA 2FG5A 1Q1EA 1QVRA 1GG2A 3CZQA 4OK5A 2FSHA 1HQCA 1FL9A 1UAAA 4F91B 1P6XA 1GTVA 2X77A 4RCYA 1KO8A 4IRUB 4PQFA 2JATA 5D3MB 4B3BA 2HXYA 1N6IA 5FTKA 3TRFA 4FINA 2XX3A 1OXXK 1G3QA 1OFHA 1XXHA 2SHKA 3QKTA 2J7PD 3KFXA 4DCNA 2ZYWX 4V0ME 4QHTA 3SR0A 1XX6A 2J5XA 2GZAA 1NN3A 2CLDX 3R8FA 2VP5A 3SYNA 1AIPA 3QSYA 1ZAKA 3PXGA 2AKYA 4HLUA 1G3IA 1OFIA 1P2TA 3LA6A 2PJRA 1YZUA 1BYIA 5DN6D 3ASYA 3EIEA 1I4LD 5LPNA 2IYTA 4PXAA 2XOKD 2AD5A 4QBFA 4O2RA 4PSAA 3GLIA 3P27A 1RC8A 2FPKA 2RCNA 3O8DA 4WAUA 3PEUA 3M0EA 1HY3A 2GVDC 5DYIA 5AJWA 1KDPA 2OSBA 1DTSA 4QJ5A 4OHVA 4I99A 4LRWA 1XB2A 4NHOA 4RCZA 1KNXA 2QSZA 4KU4A 4POAA 4DLXA 5KNBA 2O8EA 3LW8A 4QHYA 1H8ED 2GK6A 3GP8A 2FA9A 4P4SA 2VSXA 4ERNA 1ZUHA 3GEHA 4QXAA 4US1R 3L8ZA 4MA4A 3QPUA 1ZYUA 4IFEA 3W6PA 3THWB 1WE2A 4NONA 3OHMA 1A2BA 3GMTA 4LBWA 4JMPA 1N0WA 2JCSA 5CLQA 4NCJA 1TEVA 1Z0JA 1OXTA 2FFAA 3KJHA 1IJFA 1YU9A 2CLSA 4C0HA 1IN4A 1QHXA 1OLOA 2C96A 1GKYA 2Z0MA 1N6HA 2KJQA 2IUSA 2CE2X 3DKVA 3MWYW 4LJAA 2FFQA 1II0A 1TF5A 1CP2A 1Z29A 2BJVA 4Q18A 5AJYA 3K9LA 3TR0A 4NYIQ 3L8YA 2DWPA 4AWXA 5FBQB 3MFYA 4Q9JA 4F4CA 1W0JD 4PQYA 2E1RA 3NTUA 1G8PA 2RGGA 4GRAA 3DOFA 4MYHA 2WM9B 5HE8A 4PZYA 4HSEA 3LLMA 4Q1CA 2BMFA 5J40A 3QXJA 2IA5A 4LYJA 4P4TA 1NMZA 3GJ6A 4M1WA 1ZM2A 1WBBA 2P0EA 2MSDB 2QE7A 2G9NA 1P3JA 2J0VA 5EXXA 1X8JA 1R5BA 2WWWA 1OJLA 3I72A 3AKEA 1BOFA 4GOXA 1FPMA 1ZJ6A 1Q21A 3B78A 4LY6A 1QHNA 3EZFA 1GDDA 1EX6A 3R20A 1BO6A 3H86A 1ANKA 1S1MA 1ZU5A 2AD1A 2G3YA 4UJ3A 5EE9A 1LF0A 1QRAA 1VTKA 1R10A 1W5SA 1Y63A 4TLBA 4AURA 2IS1A 1S3GA 1V5WA 5SZIA 3L0PA 4CEHA 2XB4A 3Q72A 2O0JA 3U3MA 4B6FA 2BVNA 4DEXA 2ZYVX 4Q4JA 5EJEA 1XDBA 3FPAA 1E2NA 2A30A 5FPTA 4I1SA 3RRNA 4FXPA 4M22A 5KO2A 2CBZA 1SVSA 3K53A 3AVOA 4OHXA 2W0SA 3QPWA 2L0XA 3KKMA 3V9PA 1KMHB 3TUJC 1D9ZA 5HKKD 1DE0A 2IYSA 3NBZC 2VP0A 3WHLA 3BFXA 4R98A 2O8EB 4D4JA 3T1TA 721PA 3K70B 1SQ5A 1NLYA 3EIQA 3BC1A 3EW9A 1E2FA 2A78A 2ZU0C 2H7VA 1RE0A 2A3RA 2NIPA 3VQTA 4GBMA 4B3XA 4EFNA 2QE7D 4U00A 1XMJA 2VHJA 4LHWA 1Q1BA 3I4LA 4JYCA 5AJVB 3NEJA 3R9IA 2OUKA 3MSXA 2IYXA 5FBRB 6Q21A 3ZVLA 4L16A 2ZRCA 4NCIA 3P4YA 5LB2A 4DLYA 4HZUB 2FPMA 4JKIA 2QI9C 3BH0A 4XVUA 3LQRA 2QRZA 3DHWC 5AK0A 2BBTA 3CWQA 1ZUNB 4C0SA 5GADl 4LI0A 1W48A 4MYUA 4OK3A 1F6BA 2F3RA 1KI8A 2ZITA 2YWEA 2AK3A 5JRJA 1YQTA 2RHMA 1U81A 1X86B 2YVUA 2JLRA 4JJKA 4BECA 1SKYB 2D7DA 4EUNA 4MH0R 2QNRA 4IOLA 1Z2AA 5E3HA 1JR3E 4JLKA 4OHWA 1SZPA 1I4DD 2Z4RA 2B7BA 3FFAA 4AIIA 1E0JA 5F3WB 4MGYR 4YMSA 1TUEA 2WWFA 2V6IA 3OIYA 4ILEA 4ZCMA 4BFYA 1FQJA 3RSOA 1DAIA 4V0MA 3K0CC 5HE9A 1T91A 2WMNB 2IX3A 4I81A 1SXJB 2FOLA 3SJZA 3WNDA 2FEOA 4JKYA 2C04A 3BOSA 4R2HA 1N5LA 1NSFA 1HT2E 2QUZA 4AD8A 4E5UA 4HZUA 2OBMA 5CYPA 3LBHA 1TAGA 2FV8A 1R5OA 3EIHA 3IO5A 4JLPA 1P62B 2H1LA 1Z5ZA 3VKWA 3B1YA 3IQWA 3QKRA 2BMJA 2YYZA 3IHWA 3B1WA 1G41A 3BFVA 3CR7A 5IT5A 2ZRDA 3BWDD 1S9HA 3PV0A 4E07A 4DCTA 2WWXA 5KUTA 2CCJA 3J81k 2WV9A 2H92A 5JS7A 1T3LA 4HAZA 4UXJA 5L3QA 3SI7A 4AKIA 3SC3A 4IEEA 2XZOA 3EC2A 4IVRA 1DAKA 2KE5A 1JB1A 1OYYA 4HZIA 4M9QA 4TLAA 4NYMQ 2AFHE 3EPLA 4YXWA 3TNFA 2KB0A 1JJ7A 3FVQA 2C9CA 1VECA 2IS2A 4NYIR 2WHXA 3BORA 3SZRA 2A2ZA 3GLHA 3BXZA 1COWD 4O2LA 1G21E 4G01B 4JVNA 5EUQB 4JL8A 5E95A 3UIEA 2VHUA 5EP3A 4C9BA 2ZRFA 3T1OA 2CL6X 2CMKA 4LUCA 4PANA 4OI2A 1SKYE 2J0SA 3GJXC 3PUXA 5EP1A 2Q21A 2BIFA 1G7RA 2B92A 2VSFA 3QKRB 4MGKR 4G0NA 2FNAA 4TMXA 2NMVA 1EFTA 1NY6A 4MUBA 4AKEA 4D0GA 5J5CA 1Z6GA 1KK0A 3GJ5A 3U6BA 1H65A 2O8DB 5FFMA 1KJZA 3ZGXA 2C99A 1E2MA 3QXHA 4I1VA 1ETUA 1E0KA 1E3MA 3RC8A 4D2IA 3W8RA 4TWZA 4JLBA 1AGPA 2ATXA 1II8B 2D06A 3PEVA 5BN5A 2UKDA 4ACBA 1OPXA 1D2EA 3EAQA 3ADKA 3ADDA 4AKHA 1XP8A 1IY2A 1AK2A 5AJZA 4NTZA 2CNWD 3RABA 2C9YA 2RGDA 3AUYA 5EE0A 1OIWA 4Q66C 3UATA 1CKEA 1QHHA 4DLSA 1XCGB 2ZE5A 1QDEA 5KSZA 1US8B 3MD0A 3HDTA 5FBVB 4Q7KA 1XTRA 4RFVA 4A6XA 3ZDQA 4C0LA 1D8TA 5JMTA 4M1MA 2N46A 4UKDA 1AGRA 4C30A 1KZ7B 1VYVA 5FOSA 1XD9A 1W0KD 5KPJA 1JQJC 2GBLC 3H2YA 4O25A 4WZ6A 3IO3A 2F55A 2GF0A 5FUXA 5H70A 2EFEB 1RYHA 4IXNA 1QHGA 1EFRA 1DEKA 4LYAA 3QEOA 5FOUA 2OHFA 1E2QA 1E79A 2B8TA 4Q21A 4U5XA 1MABB 2QG6A 4NCHA 4OHZA 5BWMA 1U2RA 2WWGA 3FTQA 1NVVR 4LGMA 4OQNA 1SVIA 3UMRA 2D74A 2IS6A 2WKPA 2G88A 3QBTA 2W2VA 4WVFA 4JBWA 4WW0A 5FH9A 3LWNA 3C8UA 5FI0B 2DR3A 3U7HB 2GJ8A 3TBKA 1MR3F 1EG7A 4TLEA 3AH8A 4KXFB 1YZTA 4Z8YA 4TL6A 1CRPA 5DH9A 4DWJA 2J0QA 1RZ3A 2QROA 1IN7A 3K0FA 1OXSC 3W3ZB 4RD2A 1KHTA 1UDWA 2VO1A 3ICEA 4FCVA 5M04A 1GAJA 1KDRA 2EFCB 1CR1A 1NY5A 5G3ZA 3U4QA 3CIOA 2OLKA 3EARA 4IKEA 4PHHA 4Q9KA 1MRSA 4QFMA 3QJYA 2BCJQ 2PT5A 3KTAA 3T1VA 3G0HA 2OXRA 4JT4A 2GCPA 1YR9A 4QGFA 1X6VA 3QF7A 2A5DA 5JHHB 2IYRA 3TW8B 1QHHB 2EWVA 1NG9A 5HZKA 2D7CA 3UWOA 4B76A 2EYUA 1SVMA 2IYQA 4Q47A 5C4GB 3ECCA 2J3EA 1COWA 4DC9A 5KSYA 1O3YA 2G83A 3RANA 3UXMA 3AVUA 4NU0A 1TMKA 4TTPA 3TE6A 1KOFA 3DMDA 1NMYA 4JZKA 3IBGA 2RGBA 3RHFA 3AVTA 2WJIA 4RZUA 3TUZC 2EFHB 5FUYA 1XTJA 4ZCIA 1IN6A 2WJGA 4PAMA 3AKCA 1TTTA 3B5JA 1U8YA 1GRQA 1UBCA 2RKOA 3ZIAA 1XEXA 4PHTA 2YWFA 2WWIA 4EFLA 3L0SA 4BRUA 2HLDA 1ESMA 4GL2A 1DAHA 3X1YA 1G4AE 4M9XA 2FGKA 3QQ5A 2ZJZA 2WKQA 3EA0A 3W9YA 1M1YE 1TU3A 4F4IA 1ELOA 1X8LA 4E03A 2WIBA 4JJZA 1P2VA 3TLXA 4S35A 4IEIA 1NNEA 2R2AA 1DOAA 1KSJA 3X2SA 4M1TA 1FFHA 1FP6A 1QZXA 1W36C 1ZC3A 5B57C 2W00A 1MV5A 2Z43A 2GZHA 1AA9A 1E2DA 5DGXA 3NC0C 2GCOA 3OFND 1F48A 2H57A 2C8VA 2CEAA 3VR2A 5JSZB 3W8NA 2NO0A 1D2NA 2OCPA 1C9KA 3AP2A 3Q3JB 4GZMA 1E9RA 3P1JA 2OFOA 4MQBA 5FL3A 3C16C 4IOKA 4D82A 4TZ6A 4P4SB 1SXJC 1H8HA 5D3MA 4FN5A 2ZJBA 4Q1BA 3SJAA 4Q9LA 4KYIB 4DJTA 1D2MA 2J87A 2ZROA 3AKDA 3P26A 4FCTA 3MJHA 1HA3A 2N1BA 1WBDA 5KTYA 2WMOB 3QXXA 2C98A 4QHSA 2QN6A 4OL0A 5HPYB 3CX6A 3I8XA 3CZPA 2IUTA 1J90A 5P21A 4FWTA 4TYYA 4LJ6A 3FHTA 1PLLA 2J59A 1N25A 3K9HA 1N6NA 4Q19A 2QMOA 2F1JA 3EPJA 1KJYA 4GPTA 4RD0A 5EP2A 1W2HA 3MJRA 5KYKA 3TKLA 2BCGY 1S96A 2WSSA 5UKDA 2Q9AA 5AUOB 1ZUIA 5GVSA 3GLGE 2CCKA 4XIGS 2P67A 3CF6R 1J99A 2Q9CA 2ECKA 3HYRA 5KSPA 1FTSA 2ZUBA 1R0WA 4PR0A 2ZR9A 1Z22A 3A36A 1YRAA 3NC1C 2HEIA 3Q7QA 1RVDA 3GCGA 1OB5A 1AQYA 3BE4A 3BK7A 4TSFA 4C0JA 1XTSA 1N5JA 2ZANA 4G5QA 3UWKA 3WYAA 2OM2A 4BZQA 5DLQC 4LHVA 4KVGA 1P2SA 3OEED 2BBSA 2C2HA 3F0TA 1Z6YA 4US2R 3NWJA 4HI0E 1KJWA 2OCYC 2VA8A 4PC6A 2Q6TA 1BYUA 3KB2A 3C5CA 4B3DA 3U4QB 5FBLB 4Q4AA 1XU4A 3QIAA 2C03A 3DZ8A 3MLEA 1M8PA 4TZ0A 2EYQA 4B74A 1OIXA 5JS8A 4QC2A 2DFKB 4PSKA 1KSFX 3NBFA 1NVVQ 4L5BA 4W5WA 2ZSBA 5HR5A 5J4KA 1U0HC 4PC3A 4CEHB 4ZV4A 4IDOA 1OH7A 3K0EA 1VIAA 1OB2A 1I4TD 2PMKA 2WSSD 5FTJA 1L4YA 2ZPTX 4D0LB 2YC4C 3PIRA 1AS2A 1NJFA 3FE2A 3KKNA 4C2UA 5B64A 5EP4A 1VKJA 1J70A 1NSTA 2F1HA 1G291 2OAQ1 4RJLA 1XXHB 3CUEF 1MH1A 1I2MA 3K8YA 4I1UA 2AHOA 3GEIA 3EX7C 4G1UC 4EPXA 4RZ2A 1SHKA 3ZJYA 1Z28A 3OF5A 3NDBB 4HAYA 1A4RA 1U9IA 4L9WA 2EFGA 2BV3A 2OCBA 1M2OB 3UMFA 5FPKA 3RDPA 1NBMA 2QTFA 4NP6A 1G8YA 3LDAA 5C4MA 4M1OA 2OBLA 1NN0A 1JJVA 3LRPA 1EXMA 4WXPA 3RRYA 2ZR0A 4NDZA 5JLJA 4PHFA 1OFUX 2AK2A 4OJQA 5HKKA 5J4HA 5G40A 1UBFA 4ZKEA 2LKCA 1D6JA 3S1AB 2V7QA 4M21A 3BERA 2J1LA 2OO7A 1VPLA 3FB4A 1FW6A 3SQXA 1ZNWA 2HT6A 2JLWA 5HTKA 1XMVA 3AB3A 3ZH9B 3DOEA 3EZ2A 2YKGA 3Q7PA 1RRGA 2XNSA 3AF0A 1KI7A 4PC7A 5EXPA 3VR6A 2XJ9A 3RYTC 1KGDA 3AF2A 3BJIC 4CGZA 2BDTA 2GILA 1HH4A 3SS8A 1Q44A 2CVFA 2GBLA 1IQPA 2QMEA 4HDOB 1ZU4A 4Q4AB 1FP7A 3QG1A 4PPFA 2FDCA 1XCMA 1GKIA 2W83A 1W49A 2WJYA 3WHKA 1NF3A 1E9EA 1G17A 4EJSB 3I92A 2FZLA 3AP3A 3BBPA 2O0KA 2CL7X 1G64A 1E9SA 1NMXA 4PSVA 3KQUA 4KFUA 5BYKA 1XCPA 1R0YA 1WCV1 3ZLJA 3IUYA 4GSYA 1EFHA 5CJPA 5E4FA 4EAQA 1KKMA 2CL0X 1X1RA 3C4JA 2AFIE 4PTLA 5K8IA 3RS0A 4RY2A 3U2QA 1GIAA 1MABA 3AV0B 3SBEA 2X2EA 3UPUA 3ASZA 1DVRA 1YZKA 2ZI3A 2KWIA 3AVVA 4TQUS 2AWOA 2V8OA 3I32A 1AN0A 4DSTA 1ZW6A 4NE2A 1KK2A 2GEDA 2F6RA 1IM2A 3KJGA 4JLOA 4V0KA 1KO4A 3X1ZA 5FPHA 4B6EA 3I62A 4MKFA 4CEIB 1G5TA 2JLSA 4D25A 1FZQA 3B13B 3MMPA 3LX5A 3AVQA 3RS4A 1CULC 4G5RA 3TSOA 1XFAA 4RZXA 4II7A 1X8KA 3U60B 2O8BA 5BN4A 1QG2A 4P4UA 5AUQA 3LXXA 4IFBA 1G19A 4DDVA 5E7MA 2W6JA 3OEHD 3LVQE 3W5IA 4A0HA 1KI2A 2KSQA 3HR7A 1G7TA 2JJ1D 3H0KA 4RD3A 4B33A 4D4KA 2ZSAA 3GPLA 4XWAA 1T8TA 2J0UB 4XSHA 4HAXA 1SXJD 3H84A 1F2TB 1E9BA 4HUTA 1RJ9B 5FL7D 1UEIA 2IT1A 1W7AA 4M9ZA 4UXHA 2CK3D 3GLGA 5AJXA 3B1VA 4B43A 5DYGA 4LDJA 3LX8A 2FGJA 1KZGB 4A2PA 5KOYA 2OE2A 1BMFA 2GESA 4DDUA 1TNDA 4Q4HB 5HZHA 3JVVA 4J0QA 2ZVPX 3AP1A 4KJZA 3CPEA 3BAFA 3SEAA 2VF7A 1S0UA 4LSGA 4TYWA 4FCWA 2V3CC 3KX2A 1QBKC 4N0DA 5DHFA 1RRCA 4EJSA 1ZM3A 2XZLA 2ANBA 2B8WA 3O47A 5CK4A 3ZYCA 4LCBA 1RW4A 4QM6A 4BLTA 3EZ7A 2ZR7A 3N2IA 2XITA 2V54A 2HYDA 2IW3A 5LB4A 1T0JB 2REXB 2AXNA 1CJUC 1JR3A 2BHRA 2DFNA 5CLLA 4DCUA 3KQKA 3U7EB 3THXA 1KTVA 5BN3A 4LJ8A 1VG1A 2G1KA 1NVUQ 4ZPXA 2QQ0A 3IKJA 1AKYA 2ZU6A 2BEJA 3CRQA 2R44A 4HAVA 2QSYA 4A2QA 3KQHA 2VL7A 1MO5A 2FEMA 5CIQA 3AVWA 3A1SA 4BUJA 1E2LA 1U0LA 3JZMA 3UMSA 1DS6A 5AUNB 1N0VC 2DBYA 4IJMA 1W47A 2O5VA 4KCGA 2IWHA 1G7SA 1M7HA 1Z6AA 2ZI5A 3Q8XB 3BB3A 4DDWA 4WZBE 2VLIA 1GM5A 4A82A 1VYTA 3QOFA 3DZDA 3FHOA 4A15A 1EWRA 3SJCA 3NHAA 3PFIA 4PZLA 2F1RA 2VIIA 2O0HA 4URXR 3NBXX 4Q1DA 2HCJB 2Q3FA 1FNMA 3KXKA 4A92A 1T9HA 3DM9B 4IW3B 1CJTC 1NP6A 1E9CA 1W1WA 5B58C 1VCIA 2J7PA 5F2EA 2WZQA 4UJ5A 3ZD6A 4GZLA 2ODWA 1MO6A 1W36D 4NZYA 3NG1A 3HYTA 1RRFA 3LH5A 3K09C 4CF7A 4V0LA 2PJZA 2R62A 2XNDD 4Z1MA 5F9HA 2Q3HA 2J9RA 5LDDC 1YR7A 2ZYTX 1KAGA 2ZRBA 3L43A 3P32A 4MGZR 4C3ZA 4YXWD 2PCLA 4URUR 2W2TA 2RGNA 5ANRB 1YJ5A 2ZJYA 4D4LA 4EPVA 4BFUA 2HDNB 2ZJOA 2FMXA 2QP4A 3ZZ0A 2NO6A 2J45A 1JECA 3EZ6A 4JVMA 3QKUA 3UG7A 1Z2CA 2ZREA 4Q03A 2ZUCA 2GJSA 3U5ZB 1JXMA 2GNOA 4PPGA 1G20E 3VNUA 2XXAA 3EA5A 2QL6A 4FMCB 1FMJA 4YMUA 3H1TA 1TF2A 1IN5A 1KI6B 2WTUA 2BOVA 4BASA 1IJEA 1TADA 3AF1A 2GDJA 3L82B 3IDQA 2ZVQX 4A0FA 3B1ZA 2BKEA 1P9NA 3FMFA 1DAFA 1KY2A 1P9RA 5FR1A 3Q85A 4B2PA 3FMPB 1ZC4A 1CJMA 4IHQA 2QM7A 5JECA 4OQLA 4JSTA 4DEYA 5BXQC 3TQFA 2R8RA 4OI0A 1EFCA 3BGWA 3PCRB 4ITRC 4LC1A 2RH5A 5JBQA 3WMEA 3VR1A 4ZIRB 3C14C 3BB4A 1KI1A 1ZM9A 4B3CA 821PA 3TAHA 5ELXA 4C0KA 4JLJA 3VTKA 4LYHA 2Z83A 1OXUA 1U8AA 4TMWA 3FGNA 2HYIC 1NI3A 2JLZA 4BLRA 3B1XA 2QGZA 3OIWA 2Z4SA 2QPAA 1KYIA 4C2TA 1EESA 3U3OA 1FNNA 4HLUC 3K70D 1KIMA 2QU8A 3TW4A 2R6CA 1W4AA 3VR5A 2UZ3A 4B48A 1V43A 4M1SA 1G8FA 1FMLA 1PUJA 2YOFA 3QXCA 1IHUA 4LWZA 2NO7A 1A82A 4DSNA 4GMXA 2ORWA 2NPIA 4HDCA 2HLDD 1CJKC 1QHSA 3TUIC 3U61B 2ORIA 3NHBA 4HEJA 1EFUA 1Y3AA 2GZDA 4KYUA 4M0LA 4X8HA 2C5LA 2BMEA 2QAGB 5DNYB 1TU4A 3TIFA 4LJ4A 4PO8A 4NYMR 3ADBA 1GL6A 2HJVA 2ZJAA 5EE5B 4URYR 4DVGA 1Q1ZA 1NG1A 1LTQA 2ZEJA 1E98A 1CR2A 3REGA 1LNZA 2G0NA 4O3MA 3VR3A 3FOZA 1NN1A 3S1AA 2QMHA 1LFDB 1LVGA 3LNCA 3QF4B 3KL4A 4DXAA 1NL3A 5BW8A 2GHIA 3T34A 4V0OA 5KU1A 3CONA 2ZAMA 4X8LA 2F1IA 4AY2A 4X8MA 3B85A 4UNPA 4AC9A 1YZNA 4CEIA 1Z63A 2EFDB 3B2EA 4FMDB 1Z0KA 2FSIA 2JDIA 4DLTA 2GTPA 4GP6A 4KAXA 2G0TA 3HWSA 3GFOA 3K09A 3I73A 4A4DA 4OBEA 3I3SR 3THYB 3A37A 3LXRA 2X8AA 5B30A 2F43A 5EE1A 1PUIA 3VX3A 3ZZTA 1A7JA 5FOXA 2FF7A 4QBGB 2FWRA 4MGIR 4OI1A 5EXSA 3HR8A 2A7QA 4DLZA 3KDSE 1L8QA 3SHWA 2PZGA 3CH4B 1TQ2A 5C18A 1KI3A 3GD7A 3U7FB 2QAGA 2X2FA 4LBVA 5JWOA 2ZI7A 3TSWA 1JBKA 3VAAA 4DUGD 4WOPA 1VCMA 1O87A 2QM8A 4MRVA 1UBGA 2QQEA 2O8DA 2XJ4A 5DIFA 4XWKA 8OHMA 3GQBA 5EZ5A 1RJ9A 5L8VA 3RS5A 3ZS8A 2VHCA 4HAUA 2P6NA 5H1YA 1E2KA 1F2UA 1HE8B 3Q5EA 4LBZA 1CU1A 4LJ7A 4Y0AA 1KNQA 3BH7A 1NKSA 2KBEA 3GJ3A 1E0AA 2FX3A 3QY0A 5FOWA 2P3SA 3A1WA 1S4QA 2FFHA 2A9KA 2GJ9A 2WWHA 4M8NE 4V03A 1GRNA 2X19A 2R6GA 1ONBA 1P4SA 3WY9A 3IILA 1MT0A 3WYGA 2IF2A 4LV6A 4EIWA 2V1XA 4TTRA 2DWOA 4YLGA 3CM0A 3T5GA 1XJ0A 4IDNA 1EX7A 1E2EA 1YZGA 2ZE8A 4LZZA 3MG9A 1Z08A 3DO6A 4D4MA 2D4HA 1NIPA 4QM7A 1E2IA 1ZNYA 2AX4A 3N5CA 4FIDA 2WIAA 1FQKA 1GNQA 2OLJA 4XSGA 5GJVC 3TMKA 1PJRA 1HE1C 1F2TA 1NBMD 4LK2A 2GCOB 1VMAA 2PMDA 3OAAD 1VYUA 1HV8A 1LS1A 4G3XA 1PV4A 2HUPA 2XB2A 2YOHA 2LKDA 3E1SA 5IHPA 1CBUA 4IOMA 3NH6A 1G6HA 2WOOA 3EG5A 1XZPA 4A8JA 1SVWA 4FMDF 3CRRA
chains in the Genus database with same CATH superfamily
2QTNA 3U4IA 5A4AA 1OFGA 2CDNA 2CXOA 2RMKA 3O3OB 3PYLA 4LZAA 4DUZB 3NZEA 3ITKA 1K6EA 2QUJA 3KQWA 4TZKA 3QLTA 5CJ2A 1B8OA 2FN4A 5AM4A 4TMFA 4D45A 1TJNA 3UUWA 1UBRS 4QQKA 2BGLA 4DV4B 5FNZA 1YONA 1ENZA 2JIQA 4H3HB 3F96A 4KXXA 3UEOA 1IPFA 5G02A 3GFRA 4U7DA 3GQVA 2BZ0A 4Q3CA 1UZLA 3OF2A 4W9MC 1IY9A 2LXNA 2B83A 2ONYA 2OZVA 4QL3A 4ER0A 2GETA 6YASA 3BL5A 5LU9A 3IUPA 1JHPA 3E9YA 2WRZA 1HLDA 4ZT4A 1NVGA 1YAJA 4MR7B 2UUBB 1AH2A 1SCNE 1AE1A 2Z3ZA 3U9LA 5HRAA 1JVNA 4IX1A 1MIOA 4MV4A 2DG2A 1CEEA 5K8TA 1Y3HA 2YJGA 3IIEA 2H08A 4J1SA 2JW5A 4MMZB 4EZIA 1LDMA 3DS8A 4NS4A 2PUJA 3OMLA 4KWEA 3VSAA 4BE7B 1RRKA 3KDPA 4LCJA 1XD8A 2R5WA 3GPCA 4QELA 1YXMA 3UG6A 1Y0BA 2AXEA 3V2GA 5BV0A 2OBNA 3EEFA 4URVR 1ICIA 4OSEA 5IARA 3HCPA 1OGIA 1CEQA 1UMBB 1BS1A 1QLHA 4X0EA 1I1HA 1KOJA 4YCNA 1J5PA 1Y8RB 3NATA 4L9AA 3GLRA 3EGEA 4OH7A 4HN9A 3HJCA 1II9A 3I9FA 2XVXA 2CB9A 1M0TA 5T3YA 1Z0ZA 1V3UA 3CNOA 2F64A 1AK9A 1V3QE 1Z0DA 2OV8A 3L9XA 3P52A 5DEOA 5IC4A 1LX6A 3CBQA 3QKSA 3LP8A 5MN6A 1E5XA 1XRMA 4JROA 3HP1A 5BMVB 1G1MA 1C50A 1F8FA 2B7LA 3E5MA 2Y1GA 1SVLA 4ZHQF 1CUZA 3Q9UA 4FT4A 1WKBA 1S2LA 2NZVG 4DLVA 3IVAA 1UZAA 2FB9A 1BWSA 2BL4A 2DB3A 4FEYA 4K81B 3RFFA 3AM3A 4FOLA 2FLWA 4ROSA 1DINA 2A5GA 3HCBA 3MWDA 3N0XA 3SY8A 1ABEA 3Q9NA 8ADHA 2C5BA 4HNVA 4M1EA 1HOXA 4WH0A 5J5VA 1CJVC 2O3RA 4OP3A 1OD6A 3Q3HA 4UTRA 5AW9A 1O94A 4ER7A 4D0NA 2QRNA 1A9XB 4YRGA 1FFGA 1VG9B 1R0XA 3H9CA 4I9HA 4AJ2A 4XWOA 3LUDA 4GSLA 4KO2S 4RIHA 4I0WB 5CLJA 4ZCQA 3AM1A 3ZHXA 4CW7A 2YICA 3JU3A 2FKNA 4DSOA 1XJ5A 5E7IA 2QJTA 2XOXA 3EXIB 3GD5A 4I4CA 4MW7A 3BSWA 4LHXA 4YRQA 3CNLA 3RODA 1M8FA 4IPTA 1FFBA 5AKXA 3WK4A 5JNRA 2QENA 2WE7A 3O82A 5ALGA 1L5VA 1JE0A 2NOAA 2ZJ1A 4AL4A 5H3HA 2QXUA 3SXUA 2XUIA 2FDRA 1M83A 3U7QA 2GFQA 1YS6A 2DH6A 3HSKA 1QV9A 2NTJA 1GA4A 5KWVA 3DA8A 3SKYA 1J1UA 2C7OA 3E4CA 1V39A 1YS1X 1BEUB 1MLDA 2B5VA 4IIGA 1YZVA 4NFYA 4ZMRA 1IBMB 4L76A 1NHGA 1X9IA 2JA1A 3AUFA 1TQDA 1UXHA 4B6JA 2NZXA 4XH9B 5LZ7A 3WO1A 3I37X 2ZB4A 2BBOA 2E89A 2VJMA 2REOA 1AF4A 2GTIA 3K9NA 3L7AA 1ZM7A 4IUBS 2HHJA 2I3BA 1UFQA 4G89A 4JEHA 4X61A 1QQ5A 3TRIA 1JQ3A 5KYYB 2FDXA 1WLYA 1Z39A 2VUSA 1HDCA 2G07A 3T0FA 1RIFA 4YT8A 2CHVA 4OTZA 1XYVA 3BPSA 4LBYA 4ND3A 3V33A 5H8WA 4GWKA 4NPCA 4QGGA 2AL7A 1G16A 3ZU2A 4UEJA 3W0LB 4ESHA 1WAMA 4DCSA 2H52A 3Q0EA 5GONA 3ZCXA 3PNSA 1MQSA 3RT7A 3WB1A 1T5LA 1I80A 3T61A 4P7BA 1T1GA 5FTMA 3RIEA 3ZHCA 4L07A 1N7IA 3A4TA 1K2WA 3H19A 1MOQA 4J0DA 5AOVA 3PITA 3SC2A 3W4KA 1CXZA 3UOAB 1LUAA 1FSZA 3H9BA 4KXWA 4WINA 1J23A 2HQRA 3SICE 3SJUA 4E0BA 4K40A 3JR3A 3A7DA 2W2XA 1DG3A 3CH6A 4C14A 4YRKA 6CHYA 4E3WA 1SVKA 5KYGA 5H16A 3RC1A 4R16A 2FP4B 2AVDA 1P8JA 3CMCO 1KP3A 2JI7A 2AUTA 1Z15A 4QU9A 1ZR4A 4YMVA 4LI3X 3GPDG 5MN5A 2BKLA 1FF9A 1RR6A 4GPIB 2MYTA 4DABA 4M76B 1W4BA 1SC6A 3DBLB 1T4MA 3T9FA 3IMFA 4TN1A 2MSNA 4YRMA 3CY6A 5ILQA 4R1PA 4UHJA 4CCYB 3ROQA 3CF2A 5LKRA 2WB4A 3VJMA 4K6KA 2G6TA 5HIAA 2EBUA 2X6QA 4M0MA 1PGQA 2UYCA 2ONZA 1QPZA 4E1BA 1JG7A 3RWOA 2QZSA 3DMNA 4G56A 4CBVA 1HC7A 2YVAA 1Y1SA 4ZCRA 2YR0A 4YVFA 1OF1A 2I66A 2XKAA 3EWAA 4OYHA 3R7BA 4E5MA 2ZUFA 2IXFA 1JHYA 3B6IA 5AOBA 1TMOA 2VRNA 3OI7A 4ZODA 4IV5A 4RF4A 4YCCA 2ZULA 3IMGA 2B20A 4JQYA 2RK3A 3PYXA 3QNMA 3FGPA 5AI8A 2ISSD 5DISB 4Y2XA 2ZM6B 5J2UA 2QR3A 1QOQB 4RXUA 3DXXA 1CIPA 4V0NA 2PSSA 1DJPA 3AY7A 2CZCA 4Z3OA 4A1OA 3W78A 1V95A 1Z74A 3WGKA 2VPPA 2Z9DA 2I8CA 1OH5A 1NLMA 4IIXA 4GH5A 4XM0A 2MMCA 2WU4A 3GDHA 1BCRB 4HB2A 4UREA 2OGZA 2QPTA 3X2FA 2XMGA 1DC7A 2GJKA 3DR3A 1HO3A 3EG9A 4ZAGA 1D4AA 1GQQA 3NIGB 4DR5B 3IURA 1X1QA 3N5KA 1F0PA 1N2SA 1T1JA 4I4TF 2NNWB 3FLMA 2AQHA 1JAIA 4RH3A 3IXMA 1E2PA 2X2OA 1JQEA 4CLOA 4R1TA 4ZP1A 4E5KA 1QR2A 1V1RB 2W6JD 3JATB 1AHIA 5EWMB 2O8FB 1KAMA 3R3JA 3T7SA 5GJBA 2QA5A 4N3AA 1MN6A 3TZQA 1LI7A 1NJ2A 1ZIXA 3AF3A 5I5EA 3AFIA 3CEMA 4YP5A 2X7XA 2P9JA 1EGAA 2VWGA 3PDJA 3GLFB 3VPHA 3CW8X 3BS4A 1CUEA 3DWGA 1Z2OX 2ZLBA 4FWIB 3CX7A 3RRMA 1QFMA 1IOZA 2ZUWA 4MKXA 3SQDA 4DT1B 3TQQA 1W96A 1YBAA 1S8AA 3GRUA 5EXEA 5GVRA 5CA1A 3PT9A 4QTYA 2WJVA 1AQNA 2ONKA 2ZRGA 4EECA 1UBKS 3VMMA 3I9MA 4KW7A 4RIIA 1DCFA 1XCJA 3C41J 4UEQA 2ZUTA 1NWHA 4HWTA 2GNPA 1VCNA 3CF4A 5ESRA 4ME6A 3GVCA 2RGCA 3SS7X 4ZOLB 1IAVA 5EZQA 3H4MA 4BN5A 4F5ZA 1CS4C 3EMDA 4MYTA 1QYDA 2PH5A 2IPMA 2AOVA 4N3NA 5K8JB 1I4WA 1YRHA 3B6JA 4PM4A 4X45A 4QDJA 3ZZUA 3JQBC 4DMKA 3AEQB 4MITA 3VKGA 2IZ0A 2Z6VA 4WA7A 2PFSA 4F2PA 3WTBA 3WYCA 2YQ4A 2DLCX 4C20A 5ITZB 1KRXA 3ETEA 4A2CA 2WIGA 4B34A 2R87A 1JB9A 4DM7A 5KVCA 2IH2A 1SC9A 1TYAE 3D7MA 4EY8A 3H1FA 5T6MA 2B8JA 2EZ4A 1Q0QA 2NO1A 3IAS6 3IEUA 3K1TA 3MWKA 1EHCA 1XUOA 2A5LA 4OM8A 4OXYA 4PAOA 2V6GA 4UNSA 2HSWA 2AKAB 4A6EA 2WUFA 3FKSD 2FPUA 1NMSA 1QOPB 3DE6X 3HPQA 2C1XA 2CXSA 1TM3E 2V7WA 4JWTA 1BGXT 3BQ9A 1OU4A 3PUYA 4F71A 1TCUA 4RSRA 4TQ9A 3IR7A 3JCZA 2CSUA 2ZR8A 4DMRA 1CFJA 1TT5A 3OWXA 4FEEA 3G6WA 1LDBA 3NM5A 4BV8A 5JC1A 1C1XB 5FORA 3F6PA 3CUTA 5LXTF 2YJ6A 2ZJ2A 3MTQA 4PG7A 4QGAA 4EJ0A 2UZAA 5DI3A 1P9WA 1XVLA 3LC7O 4MW9A 3W3AH 2H63A 1JLHA 2WHYA 4BZWA 4EKYA 1WHTB 1LSUA 1JNYA 3TVTA 4ZDKA 1WXGA 3L0YA 4W82A 1XMSA 2Y4NA 1IBCA 2YS7A 3PNLA 2A67A 3OEWA 3S68A 4KBGA 4ETWA 1FOEB 1GITA 5JZBA 1K5PA 3ZHQA 1QC5B 3IUMA 3L1HA 5ALTA 3RVDA 4YAWA 1XO1A 3U19A 2FPXA 2H5JA 4TVBA 3FMIA 1XTPA 1ZISA 3CH5A 2Y71A 3FPGA 3HNPA 3KKQA 3PD7A 2XECA 1O8BA 1NQOA 2EATA 3EN0A 1X1SA 1Y7IA 3AJEA 4WRRA 2KS6A 4WJZA 3HCRA 3ZQ6A 1K97A 1WRBA 3KYCB 2JGFA 3FFBA 2PD6A 1U4SA 1SM4A 4FHZA 1I6WA 2F3QA 4BZZA 4C4RA 1N6PA 1J8DA 2V9ZA 2XYGA 2Z2IA 4RGQA 5A6SB 1BHSA 1ECFA 2CXRA 1FVXA 2P90A 2QMYA 3LC2O 4CDGA 4LYDA 5C1IA 1UBSB 2ACKA 1N7JA 2JD1A 1VXOA 5E6UA 3I61A 1D09A 4H0CA 4JJGA 3L4BC 1K89A 4QT0A 4X66B 1VIDA 1L7XA 3KU1A 5CITA 5IKPA 1M2VA 1W88A 2AOUB 2HFKA 3NT5A 3D31A 5L3SB 1TYBE 3AINA 5LQMA 2DHEA 4OM7A 3L7LA 4ND6A 3L0CA 3ZW9A 1UBOS 4IM7A 5B53A 4BMOB 3F6YA 3FUXA 5EEHA 3GMIA 2EJBA 4MW2A 5KYTA 1R8QA 1BH2A 4CUZA 4EPTA 5SICE 3ZBTA 1TZBA 3JARB 3PXEA 4MRSA 1K5GA 3C4QA 2ZUVA 3L7IA 1JQKA 1KMIY 4JLAA 1XEFA 1XKLA 4YECA 1QBGA 2BEKA 3LNTA 4J2OA 5F51A 1NRXA 2BFBB 1AJEA 1YBMA 2A0WA 1CTQA 3C8HA 1N3BA 5K6AC 5JU6A 1RWQA 2B0CA 5GQSA 5AP9A 3TK1A 4MDFA 4IDQA 4TOIA 3B9QA 1P2UA 5FQOA 1Z7YA 2ZB8A 2QN2A 4HR7A 4XXHA 3OQ6A 2XADA 3EGWA 1R0LA 4NG4A 2A92A 2JGNA 2VP6A 2EF1A 4BC1A 4P0PB 5KJ6A 3S99A 1ZJ4A 1SD1A 2C31A 3PJFA 3R41A 4CLEA 4PLTA 1R18A 2GZMA 4ZQGA 5JV5A 1D3AA 3LF1A 3D8HA 2IEYA 4ZOEA 2IFTA 2QUKA 2PVPA 3OPMA 5FKJA 3L49A 1PJ2A 4LHYA 1QUEA 4BNFA 1FBNA 4KREA 4G5GA 2ONCA 4K1XA 1R8YA 1UXKA 1FTYA 1N5DA 3MINB 4GFDA 5HSGA 1TEXA 4UBIA 3WKDA 3AESB 4KSCA 4I1PA 1J9ZA 2OXEA 2C4UA 2GM5A 2O05A 1P77A 1W36B 4GOJA 4YGYA 3IA7A 2WZBA 3INNA 1H93A 4M0EA 2LDXA 5D6OA 2ZQ5A 3UH0A 3I1IA 4JASB 1UXIA 1KOGA 1EZZA 1TJ5A 4AIRA 1T3ZA 2PZLA 3B70A 1ZH8A 1XLUA 2XQJA 4GQAA 3IVMA 1QU3A 5CDFE 2WINI 2XNDA 3F97A 4BNGA 1I0LA 3O2JA 2PGJA 2EW1A 2OG1A 1WDMA 2PH7A 3CF4G 3KKEA 4MQUA 1GRRA 1SG6A 4CT0A 4PZPA 2CHQA 3N7TA 1C5KA 4MCIA 1DPFA 3K9GA 2FMIA 4RVUA 1GSHA 4N0EA 3I2FA 3WMFA 2PG3A 1ZD9A 1E79D 3U40A 6PFKA 1CVLA 1UJ5A 1JW9B 4NCKA 3NX4A 1KZ9A 3OBBA 1ZONA 2HYIC 4UMDA 2FW6A 2RJ3A 3B7GA 3M4NA 1T5DX 5H68A 3OFNA 1E1LA 4RMIA 4C0XA 5BSGA 4AJOA 5AM2A 3AEUA 4Z4IA 1I7PA 4IO0A 1S6YA 1B6TA 2BZSA 4QTZA 2FX5A 1NJ6A 2VUHB 5AD1A 2DWQA 4OIMA 3WSWA 1R3DA 4DGSA 4ECAA 5J2UF 1T4CB 3ONWA 3EVCA 5CGZA 1WPGA 1PVOA 2C3MA 1QF7A 3IXLA 3IESA 4BKUA 2EIXA 3D0KA 4E2FA 3WBKA 4MUFA 4ZEMA 5BSFA 5HF6A 2FHPA 3N8NA 2UYYA 2VT3A 3LAWA 5H82A 5IBQA 1QRUA 1TW2A 1POWA 3PUZA 4HLNA 3M6XA 4R2IA 4EH1A 4ACAA 1VGRA 1E4VA 1BWRA 3CNQS 3RASA 1L5LA 2P0AA 1OFUA 1RXCA 1NI4B 4RZ3A 5TXGA 8MHTA 2HXGA 3L0DA 5DV9A 5EXTA 1GL7A 2X0DA 4EI9A 5LNK6 2J46A 5JFTA 3KJEA 1NW4A 2C5EA 2CJWA 3FYDA 3RLIA 1HMPA 4U7WA 1K8RA 1ODTC 2IYAA 3C7TA 4ZN6A 1P0MA 3NNNA 3P5SA 2OK8A 3QVSA 4LV5B 4EFMA 5JQGA 2V6BA 4J43A 1RWNA 4IXDA 3ZNOA 5DE3A 1HR0B 4A36A 1L7BA 3FHCB 5TMEA 4CKCA 3S4YA 4KE7A 1Z6PA 4XQCA 3RKSA 4XI9A 2FI1A 1I5OA 4DKXA 1G55A 1MNQA 3NJRA 5F9FA 4ISCA 4FU0A 4PRZA 2P1DA 1E7SA 1E3WA 5J63A 2XOKA 1T5IA 1L5KA 4F84A 3T3NA 3FI0A 1PQPA 3GJ8A 2Q3MA 3WLJA 1SEPA 4EUHA 5BN4B 4EYGA 1U1IA 2H0AA 4Z9BA 4DV6B 1KRHA 3H7IA 3V4RA 4JQOA 1Z88A 1H5QA 2CKMA 4RQTA 1BDBA 1QKIA 1R12A 1RWKA 4LE0A 3UFXA 5AUPB 3OOEA 2FUEA 1WABA 3FZEA 2AR7A 5JAUA 1U3FA 1LC3A 4KQKA 4W63A 1NJSA 2G1PA 4C7BA 2GWRA 4FX5A 4GPEA 4MV5A 5HZGA 2VRWA 4PNZA 4O1HA 1V25A 2FPGA 3MRXA 3BAZA 1UCFA 3LQQA 4OHOA 4UUQA 2ZIXB 3KUDA 4EGFA 3PFFA 4WKOA 5AW4A 2HSGA 4O2AF 1PJBA 2H3HA 5EY5B 5LZ8A 3EC7A 5HHTA 2JC3A 3ESBA 3EGDA 2EG9A 3SLRA 3NP9A 4RS4A 4V1CB 2E85A 2HA6A 4J16C 3DM5A 5ECGC 1SXJE 3S2GA 1GA1A 3ESDA 2AXPA 2ZS7A 3HEMA 2Z3WA 3AB8A 4ALKA 5LQNA 2HAEA 2AFIA 2UV8A 3ZGZA 3DPUA 1RXVA 3FLEA 1IBRA 3RUAA 1XK6A 3PNBA 5T4BA 4WNAA 3DBRB 2EOAA 3EQ7A 3OIVA 3S2FA 2ODNA 3OIGA 3ZCVA 1T1SA 2WLSA 5CB6A 4DV1B 1GR1A 3FTFA 1JQAA 2CMGA 1ZH0A 3I9V6 1XZAA 2P7HA 3WLQA 2JIZA 2P9HA 2EZ8A 2XCQA 2HCFA 4PYLA 2HU7A 2JJ2D 5BPHA 3U80A 421PA 3FSRA 3K94A 4MKRA 3G8BA 3M9LA 2YVQA 3H05A 4R9VA 1LEHA 1IL0A 2IEDA 4RU1A 2R47A 4KQIA 1NLZA 2WJAA 5AR1A 1BH6A 1SIBE 5CTJA 1XTQA 1JDUA 4IIJA 3TAUA 3B9RA 4AWBA 1JFTA 1C9JA 2X7JA 4M1QA 1Z0IA 1T3HA 2X86A 4M98A 4URFA 4E32A 2CHUA 3COWA 1Z0SA 1XQYA 4K8RB 2G72A 2I6UA 2YDYA 3LYUA 1B0AA 1EX1A 1XTKA 2D00A 3UZUA 2AV6A 5FHRA 2INGX 1NT4A 3VH1A 3PIDA 2J3KA 4E12A 2WQ6A 4R4JA 1EDZA 4XARA 4R71A 1P1RA 1WDTA 3FSEA 3DZGA 2NAPA 3KD3A 2QBYB 2DKFA 1DQYA 4OQMA 1NXQA 1YRYE 1XOIA 2BFAA 4W1PA 5CYGA 4MW1A 5KQRA 3DOUA 3K2EA 1NIJA 4QNMA 1UFKA 1W34A 3SN6A 4TRMA 1OXVA 4R2JA 3PJDA 3OT1A 1RBZA 4F4JA 3RRJA 4J16A 3GELA 4CU2A 2B5OA 3D8BA 3WWDA 1E9VA 1ULZA 3D1LA 4COKA 5LVAA 4UBKA 1W4ZA 5I7EA 4M8KA 5K3OA 4GS5A 4ENUA 1N0UA 4IGEA 2CVHA 2FW9A 1XDGA 2ROQA 4OAQA 1M74A 3GFFA 4Q4CA 1NYTA 1EK1A 1MFZA 3H1GA 3LFUA 1EINA 2Q5FA 7REQA 4ND2A 3QHPA 2Q3JA 3SMQA 2VJAA 2QRLA 1TKCA 4QEDA 3FTCA 3PF9A 1LRKA 1RKBA 4MP6A 3P4XA 2Q3DA 1EP2B 3SMVA 3B1JA 4KC0A 1T9GR 1UKEA 3LV8A 3TSAA 3KJXA 1K98A 2OILA 4BGVA 1IWOA 1P73A 2IZOA 2CNDA 3CLRC 2VK2A 1P72A 1GVHA 3Q7TA 2IC5A 4ER6A 5EJ8A 1T5SA 1RJFA 1SKUA 3D6NB 1J25A 1UMCB 1GU1A 2I2FA 4H2DA 4QG3A 1SUPA 3BCHA 1B41A 2Q9BA 1SKBA 1ZI6A 2VKTA 3BJZA 5J4LA 2JFZA 3N3AC 3K05A 4FZRA 5AQEA 3UA4A 1L4UA 4KYVA 2AA3A 1DUVG 1YHZA 2OYSA 3IUSA 4ZI7A 3R7DA 2BFEB 2ZRIA 4HPXB 2HWXA 5A5GA 1Z82A 3M1LA 1ZIYA 3NAQA 2WPDA 4RF3A 4HNAA 4EHIA 4DQUA 2ERCA 5D3QA 4BNMA 4KFTA 5CK5A 3BFKA 2YQ5A 1Q11A 3ACDA 3VFDA 4B47A 2R1TA 4XM1A 2PX6A 3V97A 2BC9A 3PQ3A 3HG7A 3ANXA 4XUCA 1JTVA 1U8CB 4PTZA 3GLQA 1KMMA 3A6ZA 5JOQA 3PA6A 3WTCA 3P0IA 4JITA 4ZEWA 5F1PA 3HDYA 1CRQA 3KAKA 4RFSB 4UDNA 5A7GA 1MOZA 1O0CA 3KT0A 1OTHA 5BQPA 2VH2A 1C30B 1EB9A 3PHHA 4M8LA 4OYRA 2Q3EA 3KCQA 1GPUA 4E3ZA 3DKIA 2ZZMA 5IMSA 2C7GA 3LMKA 4WXHA 4QYIB 3QE9Y 3BCRA 3JWJA 4FR5A 4PYQA 1FIUA 1KFCB 2OO3A 1D2AA 1F14A 1E3LA 2A3NA 4RPKA 3Q7EA 1K5HA 4FYHA 4RJIA 4C89A 4HDNB 4CV3A 4H9GA 4Z49A 3D6UA 2GXSA 2R79A 3SYRA 3U44A 1AGXA 3ONDA 1ZIPA 4ZOBA 3GUUA 5B2FA 1ZXLA 5AHRA 2QLNA 1R4AA 4FFWA 3EVZA 5K45A 1ORHA 2Z3VA 1KDTA 2CUZA 3VR4A 5CLHA 4TVSA 2RBKA 3JQDA 1GADO 5DGIA 4MW5A 1CLEA 1S1CA 5EHGA 5DM60 3I53A 2CNWA 3A4NA 1TM4E 4AY6A 2JIZD 5GP1A 5KJ1A 2O20A 4HTFB 1U0OC 3U6KA 5I47A 5BRNA 3U39A 4YMLA 2X41A 1F06A 1UFVA 2R00C 3BULA 5DDIP 5BN3B 4MS3B 1L5RA 5AKZA 3TZLA 1USUA 1SCUB 5LL6P 1TF7A 1GHTA 3JYQA 3O95A 3S5JA 4UM9D 4PHGA 1ZP6A 1T4GA 2LBPA 2AG0A 5J47A 4OJMX 1A8UA 2OWEA 1HDEA 1KXJA 1Q0PA 2ZJ8A 1RCTE 4MS1A 3VOSA 1CZNA 2C77A 1NI5A 4MUIA 5ADWA 2H7XA 5B6IA 2MOKA 4TKVA 4ZQIA 3SOPA 2NQ8A 3OQPA 1E1MA 3T94A 3OF3A 4ODIA 1NPDA 2C5GA 2PX0A 1O4VA 4F0JA 3LA8A 3UJCA 1XPRA 3UGKA 1EVKA 4UQOA 4DLKA 1CX9B 1WR8A 3TGPA 2OV2A 2IHKA 3O03A 2WNIA 4N18A 3KQNA 1G8JA 1J00A 1HBJA 1KSHA 2IU3A 1JSLA 4MTCA 1QPBA 4JDPA 4KE9A 1ZGBA 2KLHA 4RSMA 3WNCA 4R9UC 2XYPA 3X1MA 4BLOA 3CVUA 1GSAA 5B2EA 5DCUA 3H2GA 4L0MA 4UHHA 5EIFA 2EKPA 4HAWA 5EIBD 2Y3IA 4K26A 3VKFA 1R6TA 3P71T 2QJFA 3R3WA 1WOMA 4GICA 2PL9A 2VDNB 4OSPA 3TTUA 4OVKA 5FEUA 3AXTA 1B2LA 1K5DA 3KV3O 2HHCA 3BJRA 4MR9B 1ZMXA 2HDOA 2DU8A 3DFUA 5BSUA 1UFOA 2RDMA 1EFVA 3HYNA 1DI0A 2JH3A 3O0DA 1JRLA 4H6WA 4MS4A 4IIVA 1V2HE 2WJ6A 2WVHA 4L3WA 4NNPA 4FJ0A 1YQXA 4LQCA 4CF5A 2J5BA 3MS4A 1FFCA 3MERA 4XWYA 2C9OA 4DMGA 2EU8A 4FWBA 4AECA 3MIIA 4KQFA 3D7SA 5FL7A 4W8GA 1XD2B 4UOZA 3WRXA 3SBXA 3WLOA 3X44A 3TZ6A 2G40A 4B1FA 3KEGA 4A0GA 1XVIA 2P3LA 1GLGA 4N5MA 3VX4A 2ENWA 4B2LA 1RP1A 5FWNA 3WL4A 4XTRA 5E7QA 4ZT5A 3G9XA 1OVGA 4IF4A 4IOJA 4YC7A 4MJ7A 4CFYA 1XP5A 4XFJA 5KHOC 1OA1A 1Z07A 2WVGA 2H11A 4S1TA 1KAHA 1KR2A 1J6UA 1QAMA 4OJNA 1TO2E 3MQ4A 1CSEE 1Y98A 1MO3A 1F9EA 5H9VA 3Q2KA 3T5AA 1HFJA 3GNLA 3ERCA 2FVXA 4CEJB 5TB5A 4OUKX 4G0MA 3PF8A 3GIWA 1XZHA 2F43B 2ZJ6A 2GCEA 3PPIA 4JS0A 2FRXA 5ETJA 3Q9LA 2IHZA 4RORA 3RJ5A 16PKA 2E4UA 4YP6A 4AICA 3QUAA 2KLBA 2FJPA 1SU6A 3IDSA 1FJXA 3QFHA 2FPSA 4REQB 4UE3S 3IBTA 4DIFA 2FW7A 1FYXA 5LYYA 1P8AA 3NDPA 2WHRA 1ZGHA 2NO4A 3A2LA 4BATA 2PBLA 5AHXA 1YULA 3QU4A 3AFMA 3HDHA 3H6HA 1QIKA 3IDAA 3BRWD 2C3PA 3CXUA 5BQOA 3HYLA 1HQYE 2EQBA 4Q7MB 3CKLA 1HT3A 1EBBA 1S2GA 1J5XA 3FKSA 5EMNA 3BKXA 3SQOA 3QP9A 3VUEA 9GPBA 5JFGA 4UBNA 3G8YA 4JXKA 1KTIA 4IYRA 1JU4A 1YSCA 3UMJA 1U2DA 2IL1A 1HEYA 5K9ZA 3KTOA 5F3RA 4LJRA 4JT9A 1J24A 3QBEA 3PUWA 4JBXA 3U7RA 4KFSA 5JXHA 4GP7A 1RKQA 3MGGA 4U2KA 2A86A 4BU1A 4CDNA 5DWVA 3KAJA 4DR1B 3K2IA 1KQGA 2WBLC 2EJVA 1Z0AA 3KTAB 1QYVA 5JVDF 5JJLA 2G77B 2VRCD 2FE4A 3PXXA 4LFCB 3K6SA 1DQRA 2VP4A 1W76A 3R77A 4BCCA 3P2MA 2H1CA 3PQ7A 3QI2A 4JDUA 1Z13A 1NSYA 1KY5A 4N9QA 4P3NA 3G2KA 3D3QA 2O1WA 3W5UA 2OXCA 2QT0A 5KNDA 3SKXA 1RI5A 2CXXA 3AWDA 2PZJA 4OD0A 1R9GA 4DZTA 1EUZA 4URZR 4D4IA 1U3TA 3OLZA 3MHTA 1PK9A 4Y9SA 4ZVRA 5EJ2A 1DBSA 2G9UA 2ZBQA 3FIJA 4IH9A 2RGUA 3QKWA 3QWAA 1TD9A 3A9WA 1WVIA 4E22A 3A58B 3W34A 3H9EO 4HPJB 3GVHA 1RABA 4EX6A 5KU7A 1Y6QA 3OE7D 2BBWA 1O89A 3RRBA 5L45A 3EG9B 3QV1A 3C1OA 2LCIA 1R8SA 5B3JC 1OHHD 5DFAA 4MV7A 2AFIB 2XI4A 4R8VA 3ZI7A 4P2BA 4PPNA 4PZZA 4DB4A 2P2LA 5DSTA 1LF5A 1IY0A 3QLVC 2GPJA 1MVLA 4HFNA 3JQAA 1VI2A 3IT3A 2Z5GA 4YFYA 4EZEA 4UDXX 4NI5A 5JNUA 2OYCA 2DHRA 3O94A 1RI3A 4K8OA 4BQOA 4QWWA 3PNYA 4M53A 1FX0A 3RTGA 1YDEA 4HEQA 4ER5A 5I7UA 5DHAA 3OA0A 1N75A 1E6MA 2WIFA 1F8XA 2FRVA 1EVJA 3JZFA 4AG5A 4QJ3A 5JSHA 5IMBA 1TIKA 2FG5A 2H2HA 4PYMA 1V7QA 4UQLA 1ZRMA 1UPUA 2NV0A 3E4DA 4OK5A 3N53A 1P6XA 4RCYA 3RGWS 1KO8A 4FFSA 4LRXA 4PQFA 5D3MB 1N6IA 2HNKA 3OIFA 2EQ5A 1LC0A 1J21A 3P9ZA 4I3FA 1H4TA 2F8LA 2LV8A 1ECGA 4ZAXA 4CLHA 1BKYA 1H2XA 3B3JA 5ALLA 1XXHA 4EABA 2EV9A 2J7PD 3VC2A 3IELA 4UQPA 4DCNA 4F85A 2F3SA 4QFCA 5C37A 4LVCA 2GZAA 4MO9A 1RHMA 2HRRA 1AN9A 2QD4A 2WUDA 3D7NA 1AIPA 5FHQA 5LOVA 5IBRA 1ZAKA 1G3IA 1LSSA 2E82A 1UOPA 3PGA1 3QTLA 1YZUA 3ASYA 1WHSB 3AJAA 4L5YA 4MI9A 1U2EA 2EIHA 4IZIA 4LVNA 5JZOA 2IYTA 2AD5A 2PLAA 2C92A 4GEKA 3ZU4A 1JIQA 1KJ8A 3O8DA 5CB4A 2WB2A 4AU1A 3AYXB 3RU2A 3V9AA 5BV2P 4OHVA 3OM1A 3FDZB 4LRWA 2GYUA 3M6IA 4GWGA 4QXMA 1KU6A 4RCZA 5KNBA 4POAA 5DTRA 5IDYA 4OBBA 3UV7A 4RTQA 1U7UA 3IMKA 3N9IA 3S55A 1TEZA 3MZ0A 1TRHA 2VSXA 1B6GA 1ZUHA 1DEHA 4P7GA 4UD2A 2QR5A 4D74A 1CE8B 2UXCB 5TMBA 4US1R 2QDXA 2P69A 3PNQA 1ZYUA 3QPUA 5T5QA 1EXNA 1HTBA 4HMQA 4ND5A 4K9MA 3I42A 1UPFA 1WE2A 2C4WA 2I34A 3FCSB 3THWB 3CINA 1GFZA 5JASA 5F1OA 4WFJA 2WJ4A 2ZWMA 2IHJA 5KVQA 2JJYA 2JCSA 2H3EA 3QITA 1JXQA 1LJLA 1QAOA 4AJPA 1RYYA 3JS5A 3TBHA 3UVEA 5C8DA 4G1MB 3JQ9A 2KJQA 2IUSA 2PGDA 4LJAA 4XRRA 3ZX4A 1IZ0A 1FDVA 2PUHA 2BJVA 4Q18A 3BICA 3FFWA 4LWPA 3R5HA 3U4CA 4YAGA 4ZFNA 2VYQA 4MR8B 1U3GA 2RFLA 5C1PA 3FROA 2M6LA 2C2KA 3MFYA 4N5HX 1QZTA 5FI5A 3USES 4FZ5A 2RGGA 4UARA 5EQJB 5ESDA 4MYHA 4FE3A 3H1PA 4V38A 2WAMA 3T4EA 2WM9B 4U3JA 4K6CA 1YA8A 2IGTA 4D3ZA 1X1CA 5J40A 4P4TA 3TLGA 4DAOA 3GJ6A 2XR1A 4XCQA 1WBBA 1R4MA 4RSHA 1HDIA 4R1NA 2QE7A 1UJ6A 5AVZA 2XGMA 4HADA 2O3SA 4QNNA 3BMQA 1TVEA 2XQFA 5DXFA 1XRQA 1HRKA 5K3EA 2EHDA 2NW6A 3GT3A 3KR9A 3MD9A 5YASA 1F6DA 3VXKA 5AIAA 4GYJA 4DG5A 1FP4B 2PJDA 3HL4A 1MRZA 2DUJA 4HN2A 1ZJ6A 1L7RA 2X9LA 3JQGA 1UWVA 5I4IA 1BO6A 4Z4GA 1S1MA 1ZU5A 4R8RA 3E9QA 1WUKS 1QRAA 1SVUA 1LW6E 1L6IA 3H65A 3DF9A 1W5SA 4GKBA 4AURA 2IS1A 2Q62A 5SZIA 4ID3A 4TUYB 3Q72A 3GRRA 4FE7A 3U3MA 4DRXA 1N9GB 5EJEA 3V4LA 3C7AA 1N2OA 1X1BA 2IYNA 2NTNA 1LLCA 5FPTA 1T9ZA 3RRNA 1PVVA 4M22A 3BHMA 3NTRA 3ETHA 3RJ9A 2R85A 5CXQA 1JWLA 2I3AA 1SVSA 1RWBA 4V2UA 4F4HA 1YUNA 2ORED 3I5UA 3KKMA 4H7KA 4MB6A 1JEAA 1KMHB 2A0FA 1D9ZA 1DP4A 1ZD4A 5HKKD 3C85A 4M46A 3BJEA 2IYSA 1ZWKA 3NBZC 5GZ6A 4EF4A 4R98A 1THTA 2MCFA 3JATA 1ML3A 3EW9A 1Z3CA 3L1KA 4BWFB 4LDPA 3I9JA 1JVBA 2YV4A 5L53A 1PZXA 2GBFA 1KQPA 3G9QA 3SQLA 2HK6A 2VHJA 4UC0A 1HWYA 3JSXA 2XMDA 4ZVMA 5A4KA 1CJSA 1KAEA 4JYCA 5AJVB 5KTRA 2JCBA 1G8SA 2VDWA 3DPSA 3RK4A 1RI2A 3BA1A 1VJ1A 1RQ7A 1N2IA 3FRIA 3GCXA 2J48A 4L16A 4S1PA 1UC5B 2RI0A 1I1OA 4YWJA 5LB2A 4HZUB 4MI1A 4JKIA 4C07A 1B74A 3BH0A 1C41A 2EX0A 2JGRA 3NR2A 4Z99A 3E7FA 3KEQA 5AK0A 4AW9A 3CSUA 2BBTA 4ARUA 3CWQA 3MJ4A 5GADl 1H2FA 3HZZA 4LI0A 5AO9A 1F6BA 2F3RA 3IBFA 2C9ZA 1KI8A 3C1TA 4O4IB 2A9VA 1BCSA 2VN8A 2ZITA 4L8WB 4MW4A 1JKJA 5BSKA 3RFXA 4AUMA 2GUGA 2I80A 4HWKA 2RHMA 3DOOA 3ELBA 1X86B 1YCDA 4YY3B 2JLRA 3V1LA 4MWOA 1DX9A 1MB0A 1EKXA 1SKYB 2PA3A 3EXHC 4FSDA 4PXYA 3N7AA 3WB0A 3A27A 2YYAA 2ZSIA 3TD2A 4C04A 5E3HA 1K9SA 4JLKA 2RC6A 3H5LA 1I4DD 4N6GA 4XR9A 2AJDA 6NULA 4YIKA 3DMTA 2Z4RA 3H97A 3KZXA 3AC0A 3B9BA 3BZBA 3FFAA 1E0JA 2Q5LA 1NPYA 1QV6A 5JMWA 3A26A 2WWFA 3OIYA 5HJ5A 4ZCMA 1E89A 3V8MA 3CSDA 1FQJA 1XR3A 3OQJA 3NTXA 5ITSA 4FYPA 2C5FA 5IDQA 1I3LA 3PS9A 1YCGA 5HE9A 1IHOA 2AMYA 1DTWB 2P2ZA 2WMNB 3ZGYA 1JSCA 3K8ZA 4NNOA 3WNDA 4JKYA 2C04A 4WL0A 4BV3A 1W29A 3HXKA 1K68A 3PPWA 3SJ7A 4AD8A 2AS0A 3G0GA 4E5UA 4F86A 4LEIA 5CYPA 3WGIA 5E6SA 1TFUA 1R5OA 1VLJA 3EIHA 3IO5A 2O2SA 2H1LA 5A4FS 3EBLA 3B1YA 3ACBA 4AUNA 2F90A 4BMCA 1SPXA 3IQWA 3OM9A 4ANFA 1G20A 2X7HA 2YYZA 3T9EA 3UN1A 4ZJZA 1RAEA 2H4JA 1G41A 3RBAA 5IT5A 5LP6B 3BWDD 3N0TA 4KL8S 1EZ1A 2WIJA 4OQEA 4DCTA 1QC5A 2EBHX 1XDWA 5LQKA 2OCLA 4HAZA 2WZDA 3CTMA 5IBCA 3