4P33A

Crystal structure of e. coli lptb-e163q in complex with atp-sodium
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
235
structure length
235
Chain Sequence
b'ATLTAKNLAKAYKGRRVVEDVSLTVNSGEIVGLLGPNGAGKTTTFYMVVGIVPRDAGNIIIDDDDISLLPLHARARRGIGYLPQEASIFRRLSVYDNLMAVLQIRDDLSAEQREDRANELMEEFHIEHLRDSMGQSLSGGERRRVEIARALAANPKFILLDQPFAGVDPISVIDIKRIIEHLRDSGLGVLITDHNVRETLAVCERAYIVSQGHLIAHGTPTEILQDEHVKRVYLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lipopolysaccharide export system ATP-binding protein LptB
publication title Decoupling catalytic activity from biological function of the ATPase that powers lipopolysaccharide transport.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 80
structure length 235
sequence length 235
chains with identical sequence B
ec nomenclature ec 3.6.3.-:
pdb deposition date 2014-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF12399 BCA_ABC_TP_C Branched-chain amino acid ATP-binding cassette transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4p33A00
4NCJA 4L5BA 2OLJA 1E0SA 1TEVA 2Z83A 1NNEA 5AUOB 4YQFA 4I1OA 1SKQA 1E9AA 1ZBDA 1RZ3A 2ZRHA 3GJ6A 5DNYB 4HB3A 3QNUA 4TL6A 4JT2A 5TMPA 1CJMA 3HYTA 1F5NA 1T5LA 1XMJA 4RFSB 1NN5A 4ZO4A 1KIMA 1NVXQ 4BPBA 3AKYA 3W6PA 2Z4SA 1P61B 4A9AA 3AVXA 3KTAA 1N6IA 1KO8A 4TMKA 3K1JA 4YLGA 5AJZA 3NC1C 1G5RA 3QXJA 2OSBA 3ADCA 3W5JA 4CGZA 3NHAA 1I2DA 4JIMA 1BS1A 2VP4A 4IEEA 4TLCA 4BLOA 4MGIR 3TAHA 1P9NA 2B8WA 2A9KA 4A0HA 4B3BA 1GDDA 2REXB 2KI5A 5EE5B 3GPLA 4C0LA 4EFNA 1NMZA 1HUQA 4A92A 4ZI2A 3HU3A 1VHLA 3TW4A 3R9WA 2L0XA 1NJGA 4AYTA 1ODFA 2ZAOA 3OEED 5GJWC 3DDCA 4KODA 5DYIA 4OHVA 3SBDA 3SE0A 2ZS7A 1KJWA 3W6OA 5L3QA 3U4QB 4DLRA 1XB2A 3UWOA 2EWWA 2A5FA 3QKSA 1NMYA 3TQFA 3R9IA 1UKYA 2QT0A 1YZGA 3ZS9A 2QROA 2WJIA 3D8BA 2XOKD 3F3YA 1XTIA 3MSXA 2BC9A 3L0SA 4YONB 5FTLA 4E5UA 4DLWA 1E4VA 3C5CA 3KQKA 3U44B 4WA7A 1GFIA 1W4CA 3HU1A 3EPHA 1KI2A 1NY6A 3KXKA 4M53A 3I4LA 3WBKA 3U7FB 4RJLA 3SHFA 5J4YA 1UKVY 2X1VA 4KBGA 1JAHA 2FPKA 3K0AB 3EIEA 1EFCA 5DIFA 4RD6A 4DLVA 1XP8A 3IUYA 2V1UA 2G0TA 3DPUA 1R5BA 2ZSDA 1J99A 4TQAA 1TU3A 3ZH9B 1DTSA 5JHHB 1XRJA 5BWMA 4LJ5A 2WBLC 3ZZUA 3FE2A 4LJ4A 4IDOA 4Q1DA 1KSGA 3NG1A 4RD1A 3MJHA 1KDRA 1KY3A 3WHLA 5JRJA 3M6AA 3VNUA 3R7WA 5FPKA 4IOMA 1RYHA 2RGBA 1DE0A 3A1WA 3DVLA 3B1XA 1EFTA 2PZFA 2RGEA 3KFVA 2UZ3A 3K0EA 5EP2A 4RZUA 1TQ2A 2YINC 4W5HA 5IDVA 4A2QA 4G5GA 4LBYA 5HE8A 5UKDA 4C0BA 4BGDA 3BC1A 4BECA 4DSOA 5FUWA 2C98A 2QTFA 5KYKA 2OG2A 2ZANA 3T61A 4NYJR 3VMFA 3NKVA 1P62B 3Q72A 4HAXA 5G40A 1TQDA 2GCNA 3G0HA 3AF0A 1UBGA 3KFXA 1V43A 1NVVQ 2GRJA 4XD7D 1U0HC 2WJVA 4EPXA 3IPYA 4MRSA 3W9YA 3ADBA 3G82C 1YHNA 2JASA 1XPRA 1E9BA 2PX3A 4B48A 2BKEA 4DT1A 2F55A 4A2WA 1G6HA 2R44A 3LH5A 4A15A 4DUGD 2BKUA 3BBPA 5DHAA 1NN1A 1QVAA 1XEFA 2IYQA 1XFAA 3GFOA 2IXFA 2NOAA 4DSNA 2JLXA 5HZHA 3I1FA 3WNDA 1ZNXA 1QHYA 1R8QA 3A4NA 3B9QA 4LYJA 4RY2A 1SVKA 2CL7X 4BLTA 3KZ1E 1JJVA 2V8OA 3GLHB 5CDFE 3OAAD 1WMSA 1VYVA 2CCJA 1FP6A 1US8B 2ZS8A 4U5XA 3VU9A 1Z6YA 4HB0A 1BMFA 1RRPA 2OT3B 4LRWA 3RRMA 2GJKA 5BW8A 3T1TA 3IQXA 1BIFA 4HUQB 1A1VA 1XCMA 2JJ1D 2YV5A 3GLFB 3PR1A 1FOEB 1HA3A 3IO3A 2ATXA 1E2MA 2JIZA 3LQQA 5FUXA 2IWRA 4UNRA 1OJLA 4PANA 3L43A 4YC7A 2ZE5A 4ERNA 5A5GA 3GLHE 2W6JA 2WWGA 4LJ7A 5TV2A 4ZV4A 4FINA 2G3YA 2WIBA 2AFHE 5G3YA 4PSAA 3TJZA 1OYYA 2R62A 2AKYA 4LYHA 1PZNA 4Q4JA 3U7HB 1VHTA 1KMHA 1KI1A 1AS2A 2PX0A 2RH5A 1ZNYA 2WJHA 2WMOB 1WXQA 1P2VA 1QG2A 2R8RA 2ZI6A 4G01B 1JXOA 3T1VA 2Q9CA 2LKCA 1NIJA 4NDZA 1D8TA 3TIFA 3T06B 5B58C 1KYIA 2Q21A 2ZVPX 3QPWA 3BH6A 1OIWA 3KQUA 3AP1A 1TF5A 3QKTA 1CS4C 2PBRA 2GF0A 3O8DA 4Q19A 1GUAA 4QRHA 4QJ3A 4L8GA 3DO6A 1PLLA 2WVJA 1R8SA 4PPGA 3BFXA 3EW9A 3SC3A 4LBWA 4CEHA 1QHNA 3PJRA 3W90A 3IPXA 1Z29A 1F2TB 4M4SA 4Q9KA 3W3ZB 3IGFA 4Z8YA 2HUPA 2GF9A 1E1QA 3OFND 3E1SA 5F98A 1U0JA 1NN3A 4JLJA 4PQRA 2HEIA 2NO7A 4IW3B 1VIAA 1WF3A 2XB4A 2WHXA 3WMFA 2IF2A 2IWHA 1YQTA 4JL6A 3R8CA 4EJSC 3MCAA 4V0NA 4BRWA 1DELA 1QRAA 1V5WA 2CXXA 2WSSD 4C0KA 5H68A 1G41A 3IIKA 1ANKA 3L82B 5ANRB 1M2OB 3G5UA 5CYPA 3MD0A 3U60B 2OCAA 2ZSFA 4B43A 1N6NA 4MRNA 5CB6A 1HE8B 5KU1A 3AF3A 2WWXA 3K9LA 4D6PA 1ZM9A 4DC9A 3FGNA 5BYKA 1SVSA 4E07A 2VP0A 3AF2A 3LD9A 4I4LA 2ZXUA 4FMDB 3EA5A 3H4MA 3V4RA 4GOXA 1OH6A 2N46A 4RD2A 3VKGA 1JI0A 1EFUA 1SVOA 1LVGA 3B2EA 3RS4A 3Q7QA 2OLKA 4JZKA 2G0NA 3T12A 2O8EA 5JRZA 2BCJQ 3K9GA 1NKTA 2E87A 4RD4A 2VHTA 5FBLB 5EP3A 2IYLD 5DHFA 4KI0A 2P65A 2QP4A 3QBVA 1GTVA 4Q21A 3QF4B 2WSMA 1EGAA 2ZI4A 3CW2A 3LA6A 2O8DB 3NBXX 3CLVA 4OI2A 4BEBA 4DRZA 1OXXK 2JEOA 5EXTA 1OSNA 1XXHB 3MJRA 2Q3MA 4DXAA 4Q7MB 3PEWA 2ONKA 3EIQA 5E4FA 5HTKA 1W7AA 2ZRPA 1O3YA 1QG4A 1SHKA 4BLSA 3GJ8A 1II8B 2PH1A 1KDTA 1Z0DA 3U3MA 2WKRA 4TSFA 5L3SB 3GFPA 4DLUA 3EWAA 2ZJOA 1FTNA 4PO8A 5J5CA 2G1KA 4KVGA 2LWIA 4Z1MA 2O5VA 1E98A 2AWNA 2D7CA 2GK6A 4J0QA 4K8OA 4ARZA 3SOPA 3UMRA 3R20A 2FJUA 3GLGA 3D7MA 4TT3A 2F1HA 1P60A 4Q4AA 1N5JA 3JZAA 5AJVB 4ZPXA 1JAIA 3I61A 5FI1B 3MGCA 2QPAA 3PUYA 4NCNA 2RCNA 3PENA 2I4IA 5JJKA 4HZIA 4PHTA 5CM8B 1R6BX 2QMUA 1KOFA 3PG5A 2F3TA 5JI3E 1YU9A 2F1RA 2P5TB 1VKJA 5LDDC 4TYNA 4BZXA 2VP2A 2ZETA 3CIOA 4CF7A 5DLQC 2F9LA 4H1VA 3IHWA 3U3OA 5FH9A 4DEYA 2VA8A 1HQCA 4MYTA 2QM7A 4DCTA 5F9FA 1KNXA 1SGWA 1IJEA 1OIVA 2BM1A 1Q20A 2ZI7A 2AXPA 1FMJA 3VHLB 2J7PD 4ZCMA 4IRUB 1XD2B 3PUXA 3LBIA 3QBTA 4OK5A 2DFLA 2EU8A 4FCWA 3WYAA 3P4XA 2O0HA 2XXAA 1R0YA 4XD7A 3TR5A 3F8TA 4LV6A 4GRAA 4L16A 5BN3A 5FFMA 1W0JA 4MYHA 1YRBA 1IQPA 2CCKA 5TDHA 3NVAA 4F4JA 1KI6A 2WM9B 4BUJA 2GCPA 2Z4RA 4IDPA 1AM4D 1SVMA 4HLCA 3K53A 4OI4A 3T5DA 2J0UB 1I4LD 4LV5B 3UG6A 2QN6A 4A8JB 4DUGA 1JB1A 2KE5A 4HZUB 4YMVA 4DB4A 5FOUA 4AC9A 1II0A 1W48A 1KK0A 1GSIA 1NF3A 5KO2A 2HDNB 3JVUA 4V03A 5DI3B 1OFUX 3FMOB 2F1JA 2C77A 2PLRA 2REBA 1NG9A 4UNSA 3CUEF 4MH0R 1VCIA 1LW7A 3QOFA 2BBTA 5J4HA 1T8TA 4GZLA 3B1YA 2Z5FA 2DWQA 1A2BA 2BM0A 1DG3A 1NY5A 1OXUA 1J8YF 1LS1A 4O2LA 4EJSA 1FP7A 2AX4A 1ZVQA 1AA9A 4Q03A 3TSWA 1JECA 2A3RA 1JEDA 2JJ1A 2WJJA 4ZIRA 2F43B 2YVUA 2CLDX 4IOJA 3NBYC 3OEHD 1YE8A 2R6GA 2GJ8A 4QM6A 3LXXA 4BEJA 1S0UA 2H7VA 3B78A 3RC3A 2N1BA 1L8QA 4R2HA 3QSYA 5JHGB 2MSCB 3GEHA 3EZ9A 4JSTA 2ZYTX 1RYFA 1U81A 1VG8A 4H9GA 2ECKA 1KJYA 2FSFA 2GILA 2WPDA 2HJGA 1W2HA 3MUFA 1G21E 1E2LA 4OYHA 1NBME 1S3SA 2GESA 4GSYA 2OAP1 1JQLB 1YZQA 4MITA 1JPJA 4Q18A 1G7TA 2CK3A 2OM2A 1KMQA 3GLGE 2W58A 1YR9A 3KJHA 4JBWA 2ZRFA 3CBQA 1DOAA 5HCNA 1E9FA 2H18A 2GVZC 2GTPA 3P20A 3U7EB 3K0SA 3I8SA 3WY9A 2AFIE 1ETUA 4FN5A 3AVUA 5CLLA 2BMJA 2QSZA 3A4LA 3B7GA 1MT0A 4HAWA 4PC6A 1OB5A 3A37A 4FCTA 1M7GA 4KHZA 1VYTA 1QHSA 3K8YA 5FOTA 5EP1A 3MWYW 3OFNA 4MUBA 4LHZA 3V4FA 1E32A 5DSZA 2PCLA 4NKRA 2H8KA 4LYAA 4LHYA 2FEOA 1XCGB 1TF2A 3VR4A 4LZZA 1T8UA 2G77B 4EPRA 3ZD6A 3EWSA 2FMXA 3NTUA 1KK2A 2WSSA 3TE6A 4I81A 2GXQA 1F60A 3FTQA 3LBHA 3PUWA 4P4SB 4LGMA 2ZJ8A 2ZJZA 1Z0FA 3REGA 3KJIA 4Q01A 3THWA 3I73A 3ZVMA 1IJFA 5EZ5A 3S1AB 2OZEA 5JWOA 1MABA 2NZ8A 2QRZA 3X2SA 1SVLA 4WOPA 5SZHB 1OV4A 4NP6A 1G5PA 1SZPA 1XTRA 4UXHA 2JDID 1ZIOA 1W4AA 4FI3C 2QAJA 2NPFA 2IYSA 4ZDJA 1MRSA 5F3WB 2QORA 1E2PA 1T0JB 1Z5ZA 1FNMA 4MUAA 2Q0HA 2HXSA 2J0QA 4KBFA 2CHQA 4YDSA 4ABYA 4G3XA 1Q3HA 1NRJB 3W5IA 4LC0A 4XWAA 1DO0A 3NBFA 1KAOA 2QM8A 4NZYA 1JNYA 1X8KA 821PA 4IVQA 4LUCA 1P5ZB 1UAAA 5JJIA 1NKSA 1G8HA 1HE1C 2NG1A 2QAGB 4FXPA 2EW1A 2W2TA 2XZLA 2B8TA 1RC8A 1GKUB 1C4OA 5TY0A 2C5LA 2BOVA 2GAOA 4ON9A 4TTQA 4A0RA 4OJKA 5FTJA 5GJVC 4B44A 3SR0A 1FL9A 1II9A 3UPUA 2EFGA 1FX0A 4DDUA 2LKDA 3KB2A 5JMTA 4PSKA 3E2IA 5BYJA 4JJZA 4C2UA 1Z07A 2D74A 3K70B 4MRRA 2OXRA 1ZCAA 4KO8A 4OJQA 4QBHA 4RD0A 1YKSA 3Q85A 3THYA 4LJ8A 3X1DA 1UKZA 4MDFA 4OQFA 3DZDA 5CYOA 2O8BB 3UIEA 2VP9A 1I2MA 5KDLA 1FQJA 4WIAA 2V6IA 1LF5A 5TXGA 1PLJA 5BN4A 3SJZA 1ESMA 4WZBE 3AKDA 1H8HD 3UG7A 3CM0A 4BZQA 3PFIA 4DVGA 4CT4B 1ZJ6A 3TUZC 2CNWD 1H65A 1VDZA 5K8LA 3QEOA 1GWNA 1A7JA 3UANA 1UBFA 2IS1A 3CR7A 1KNQA 1SULA 3LLUA 4V0OA 4GL2A 4WXPA 2J7PA 4IXNA 2YZ2A 2AK3A 1OKKD 2ZJYA 2VIIA 1OFHA 4URWR 3NEYA 1IXRC 4JLMA 5FBVB 1EX7A 1LS6A 1SXJB 5C2JB 4I1VA 3DEFA 3K0CC 3O8RA 1DAIA 2V1XA 4TL7A 4P4UA 1CJVC 1TF7A 4F93B 1Q22A 4EPTA 3KUDA 3BFKA 5D3MB 2AR7A 3WYGA 5FTMA 1CRPA 3BH7A 1XEXB 2OCPA 4P4TA 1U94A 2P5SA 2IYWA 3VR1A 2VH5R 2GJ9A 5JWRA 1U99A 2IYXA 4B71A 1KDOA 2I3BA 1IM2A 1SXJE 2BIFA 3AVTA 4LHXA 3OE7D 1UDWA 1ZC3A 2VBCA 5EUQB 3RS5A 5JLJA 5GADl 3SEAA 3TSOA 1YVDA 4XJXA 1TAGA 1TADA 1Z08A 1E2NA 2J45A 4DJTA 2OEPA 4TMXA 1E4YA 4R7ZA 4C7OB 3A6PC 1E3MA 5FOVA 1E79D 1W49A 1QHIA 4HAVA 4QGFA 4ZKDA 1Q1QA 2XGJA 1OYWA 3HR7A 1CTQA 1ZNZA 1EWQA 2FFAA 4URVR 1W1WA 4B32A 3AUYA 3GCGA 5FOSA 4DWJA 1M74A 5JCPA 2BBSA 3JZMA 3RSLA 1Z2CA 2ODBA 1IN7A 4ZI3A 2A78A 2JLRA 6Q21A 1FQKA 2H92A 3VKWA 1TQ4A 1W0KA 2OE2A 2VSFA 4FMCB 3AGPA 4TQUS 3EARA 2G9NA 4JSYA 2AWOA 2IYRA 4Q9JA 5CITA 3ECCA 2FA9A 1S4QA 4DB2A 2R6FA 3K0AA 4QGHA 4O2RA 4M9XA 2ZREA 3E70C 2WJYA 1XZQA 1Z28A 3T1QA 3UATA 2RKOA 1ZUIA 2VHJA 1E96A 2RGCA 3AGQA 1Z06A 5TARA 3THXB 1VMAA 4PQYA 1D9ZA 3ZD7A 4PQFA 1E9SA 3SYKA 4DBLC 3A1SA 1IN4A 4KAXA 3VR3A 2VP6A 3PITA 4DDWA 2YHSA 4JLDA 2ZR0A 1ZAKA 4Q4HB 4BFYA 2NO0A 1UBEA 3KQNA 2VLIA 2ZPTX 1ZD1A 3U6KA 4JVSB 1D2EA 1W44A 5EE9A 4AI6A 1L2TA 1FMLA 4KFTA 3EIHA 1XEWY 2QZ4A 2C8VA 4DLXA 2HT1A 4B3GA 3QXCA 5KSYA 4R98A 2ZI3A 1Z47A 3FHOA 5KTYA 1PLKA 2NTYC 3BS4A 3SI7A 3GEIA 4L9SA 1F48A 1NSFA 4NYIR 1KZGB 1N6LA 4DEXA 4FW9A 2REOA 4XSGA 4AKEA 3DMNA 3DL0A 1OXTA 1OB2A 2GEDA 5CIQA 5CB8A 2IA5A 1WCV1 4HDCA 5HPYB 3HJNA 3AEZA 5F2EA 2P2LA 1P9RA 4M1KA 2GHIA 4I1UA 4NTZA 4HDQB 1U2RA 2HLDD 4LI0A 3UMFA 3WRXC 5CJ2A 1L4UA 4A6XA 2XTZA 2NPIA 4NONA 2RGNC 3EC1A 1UKEA 1N6RA 4E03A 4TZ6A 4LC1A 4ZDWA 4HAYA 3B1ZA 3LNCA 5LD2B 3DZ8A 2RB4A 3BB1A 5HR5A 3A1VA 4PPFA 4JLKA 5FPYA 3KX2A 1W2GA 5FL7D 2PJZA 5HE9A 1FPMA 1R0ZA 1YR8A 2JCSA 1RRFA 1E69A 1G8GA 2XB2A 3AKEA 3AVPA 3CWQA 2XSZD 2ANBA 2G83A 2GA8A 2F7SA 4NU0A 3EG5A 3VFDA 2VEDA 4HUQA 4A36A 1Z83A 4LJ6A 2GKSA 2NIPA 2Z6VA 1A2KC 1S2MA 4Q00A 4C0AC 2R6AA 3D6TB 1NN0A 4ILEA 1EK0A 5KSPA 3C15C 3K0CA 2ZVQX 1EG7A 2P6RA 1QHHB 2FFBA 1K5GA 3AVOA 2DY1A 1Q44A 5GJCA 2QRNA 1LB1B 3GLIA 4PX9A 3ZS8A 3W6NA 2GCOA 5KUTA 3EPJA 3FPAA 4HAUA 4EIWA 2IUUA 4D82A 4N3NA 4AIIA 2F3RA 5G41A 4Y0AA 4R2IA 3EASA 3NHBA 4II7A 4CDGA 4JLVA 2Q6TA 4URXR 3I92A 4IJMA 2JA1A 2PCJA 1OH7A 3FB4A 4LJYA 5JFGA 1UADA 2QMHA 5EXSA 2EVWX 2IUTA 5GJBA 3CPJB 3KB1A 3M4YA 4A8JC 1RJ9A 1VG9B 1G9XA 1XJCA 1XWIA 2A5GA 4Q7LA 3B5JA 3BGWA 3PEVA 3BJIC 1ZIPA 4QBGB 3TVTA 1H8HA 4LHVA 4QBIA 1P9WA 1YZUA 3EXAA 2KSQA 2FU5C 2ODNA 3EA0A 3BOSA 4YXWD 5JEDA 2QSYA 2FSIA 5LB2A 3SYNA 1GRQA 1E9DA 1VECA 2VHCA 4DDVA 5IF9A 3RS0A 4B6EA 5L3QB 4M9SA 2GAAA 4C9BA 1GNQA 1M6NA 1TMKA 3QKSB 2VTKA 1FUKA 4QBFA 4UQOA 4JJKA 5G3ZA 1WA5A 4PPQA 2RGGA 1GNRA 4DCNA 1W4RA 2ZYVX 1S8FA 1R5OA 4TLBA 4PFSA 4TWZA 4TL8A 4MRPA 2ZIAA 3H1TA 4BASA 1KO5A 3VQTA 1NLZA 2W83A 2XTNA 1G3UA 1G3IA 1VIYA 1AS0A 3X1XA 4NYMQ 1L7VC 3RSOA 3VR6A 1R10A 2RGDA 3VR2A 3CR8A 3UKDA 1M7BA 2B21A 1E2GA 4LK2A 4MKFA 1Y63A 2RGAA 3ZQ6A 1DEKA 4HLQB 3CO5A 2NO1A 3RVBA 4XVQA 2SHKA 4R9UC 4C2TA 3QUSA 2IS2A 4D4LA 1J8MF 3OE7A 4ZKEA 1ZINA 1WE2A 3TAUA 1ZM2A 5BN5A 4LJAA 3U7GA 2QBYA 2QA5A 1HH4A 4OQMA 1P6XA 1VCMA 2GBLC 3BAFA 4KV9A 2ZEJA 1IBRA 2E9SA 3QF4A 3EX7C 5J4VA 2O8DA 1TQ6A 2FX3A 3MAAC 3K09C 2ZUDA 3B13B 1E79A 3HDTA 4EPYA 1XXHA 2C03A 3LX8A 4KLNA 2ZRCA 5SZIA 2Q3HA 1PVOA 4S35A 2AK2A 4GMDA 2AN9A 2IYZA 1VTKA 1CEEA 3SYLA 5FPTA 4N0DA 3TQCA 3LDAA 1N25A 2P6NA 2ZR9A 1DS6A 3VX4A 1NIPA 5L3SA 1B0UA 4HSEA 3RC8A 2R2AA 1JBKA 3IILA 5JSZA 1MO3A 1CR0A 2RGNA 1KY2A 2W00A 4TL9A 4B47A 3KDSE 1GITA 1VCOA 1N5LA 2HYDA 4FIDA 3ZGXA 1G64A 2CBZA 1G17A 1T3LA 1Z3IX 3K70D 221PA 1RW4A 2QL6A 4UNQA 1G18A 1S96A 2CE2X 3NC0C 2FE4A 1P2SA 4OK3A 4D4MA 2R6CA 5IK2D 2GZAA 3KXIA 4QHYA 4DT1B 3ZDQA 2Z0MA 5E95A 3VR5A 4HUTA 3LRPA 1AK2A 1N5IA 4CYMA 4XOIA 1S9DA 4PAQA 2W6ID 3KQLA 2WAYA 1AS3A 3LLMA 3TRFA 4C0HA 2BV3A 2QTHA 1G16A 3VU9B 3I3SR 4CVNA 4Q1FA 1NMXA 3IBGA 2OBMA 2PZEA 2OAQ1 1G4AE 2RHMA 4JL5A 4ESVA 1XBTA 1NG1A 2VO1A 3MFYA 4XIGS 3WP0A 4G1UC 4D0NA 2CVFA 3GFTA 2D06A 4JLBA 3QG1A 3OEEA 2F1IA 1JR3D 2JLUA 4OKSA 2CMKA 1SXJD 1QF9A 5CK5A 2B7CA 2QAGC 1W5SA 2JLZA 2C9CA 2WAXA 3HYRA 4EPWA 5L8VA 2ZSEA 4CEIB 1D6JA 1MOZA 1E2IA 3MLEA 4Q9LA 3ZJYA 4FMBB 2HLDA 2XOKA 4TMVA 3U5ZB 2X77A 3BERA 1KMHB 3L2OB 4DIDA 2O8FB 1TNDA 5B64A 2GETA 2CJWA 4Z8XA 4MKIA 4A8JA 2O8FA 3EPLA 2V6JA 1KAGA 4PPNA 3AP3A 3EC2A 3LW7A 4HZUA 2YOGA 2ORVA 3K70C 1OXVA 2E1RA 3GJ7A 3CF0A 1YZKA 4KCGA 3A1TA 5DI3A 3QENA 1E2HA 1U98A 4ACBA 2DCUA 1DG1G 2C78A 2TMKA 5C4GB 2IC5A 3NEJA 5KNBA 3R9XA 1UPTA 2A5JA 2XSZA 3CH4B 4W5JA 3C8UA 1P3JA 1XD9A 2GNOA 5GVSA 4CEHB 2OILA 3NDPA 2O8CA 1HYQA 1GRRA 3LAWA 3V00A 1WQ1R 2HT6A 2NGRA 1OLOA 3BXZA 1MO6A 3CX6A 4IDQA 4IXMA 4QNRA 5EE3A 4IFEA 2WJGA 4U00A 1K8RA 1BKDR 1E2FA 1Q21A 1QDEA 3IO5A 4JLAA 4A82A 3AF4A 3TSZA 2WICA 2V54A 2XJ4A 4TMZA 3TUJC 1FW6A 3TGPA 1F2UB 1TUEA 3RRYA 4M1YA 1GG2A 1I4DD 3ZVLA 3V9PA 2BBOA 4L4UA 2XITA 3PEYA 1BYUA 1GAJA 1C9KA 2AXNA 2IT1A 4JVNA 1SXJC 1F3OA 2ONJA 5DI9A 4F38A 2VP5A 4NBSA 3WMGA 5TVKA 3QVUA 4LDJA 4BFZA 2CDNA 3TKLA 1DPFA 4B2PA 2J46A 2GBLA 3KKOA 1AZTA 1MV5A 1LFDB 2C9YA 4Q7KA 2NO6A 2KBFA 1T9HA 3K09A 4V0KA 2WZQA 1ZNWA 4PSVA 4BLRA 2EFDB 1E94E 2O8EB 3CPHA 1KTVA 4UXJA 3GLFE 1VG0B 1DAHA 4Q9HA 5FBRB 2IYYA 2GDJA 2ZU6A 5CIWA 4H1UA 2GXUA 4IEIA 4FWTA 4IVPA 2OCBA 4YXWA 5FUYA 5KPDA 2BMEA 4WZ6A 4E09A 1XD8A 1JR6A 3QKRB 4BLQA 2BMFA 3EZ2A 4PXAA 4K46A 1BYIA 3OAAA 4JT4A 4LJ9A 4BE7B 3BORA 2OBNA 3RNLA 4ZDKA 3K9HA 2OFOA 2V7QD 4RSGA 2ZM5A 4US2R 3KKMA 3L0OA 4FD2A 4F92B 4P4SA 2GK7A 1XEWX 3WXMA 4BWYA 4AURA 1A4RA 3S1AA 3X1ZA 1DARA 1E2EA 5J40A 5HZKA 4ARZB 4DLTA 2OO7A 3DKPA 1HY3A 3GLGB 4ZCIA 1LY1A 2QMEA 2CVHA 1X8JA 3FFBA 3HP1A 2ZRGA 2JLQA 4Q4AB 4FWIB 2MSDB 1YR7A 2FV8A 1DAFA 1IY0A 3QY0A 4KXFB 4I1SA 1MH1A 1T4GA 3SDZA 2CHVA 2JJ2D 3ADDA 5D3QA 3MWJA 4Q47A 3NIBA 4GPTA 3VAAA 4LY6A 2FZ4A 3J81k 4P31A 3K0FA 4BFXA 3Q5DA 3CF6R 5L3RA 2P3SA 3RRZA 1XTQA 4ESHA 4TYYA 4UJ5A 2FF7A 3TLXA 2QAGA 3KKNA 4MA4A 2JGNA 1ZCBA 3IQWA 4BFUA 2XZOA 1CR4A 4YMSA 4OHWA 3Q5EA 4N1AA 4JVMA 2B6HA 3SQXA 4D4JA 4TMWA 1WP9A 1DO2A 3I5XA 2ZS9A 1E9CA 2DYKA 3AM1A 1E1RD 1MO5A 2CLCX 1E2QA 2XXAB 4JYCA 4IDNA 4P0TA 4WW0A 4M9ZA 1X6VA 3VNVA 1N6KA 5JS7A 4JLPA 4RVCA 3F0TA 4MRVA 4LPSA 2O8BA 1K6MA 2UVQA 1XPUA 3CH5A 2YOFA 5JS8A 2C99A 4XVRA 3HR8A 3RLFA 4NH0A 3T35A 1Y3AA 2A5YB 3CX8A 5FBQB 4F4CA 3HPRA 3WRYC 2QMOA 2F6RA 2ZUCA 4US1R 4TLEA 5JECA 4DLYA 4U7DA 5LD2C 3AUXA 3PV0A 3CRQA 4D80A 5JBQA 4TZ0A 1KJZA 1Z6XA 3CX7A 4AKGA 3KXLA 1SKYE 2J0SA 2H17A 1ZMXA 2G6BA 5E3HA 3FOZA 4ZCLA 4KYUA 1KO1A 1G8YA 4M9QA 2FEMA 1XZPA 3SFVA 1W5TA 2B7BA 4JYBA 3CZQA 1M8PA 1XMIA 2X8AA 3KUCA 3W3AA 4PC2A 4XWKA 4ZIRB 3ZVRA 3IEVA 2IEYA 3QG5A 2VL7A 3QPUA 3RS7A 1JR3A 1E99A 2EFEB 3FFAA 4UNPA 1E9RA 1E0AA 1OPXA 4Q9IA 1VYUA 4F4IA 1XU4A 2DBYA 1GOTA 2IYVA 2WOJA 1LF0A 4CEJB 3UXMA 4PTLA 2VHQA 2D3WA 3D3QA 4UXIA 5J4LA 1TTTA 5EJEA 5E7JA 5JJLA 2P67A 1QHXA 1VG1A 4GNKA 4O0MA 2J5XA 1CR1A 1GL6A 3NH9A 2QUZA 4MGYR 1QZXA 2YOHA 2EFHB 4PZZA 1N3BA 1X8LA 4JMPA 4DCUA 4FMDF 3U3KA 1NI3A 3SN6A 1KK3A 4B6FA 4ITRC 4Q1EA 1OH8A 4L9WA 1CJTC 4EKDA 2ZRJA 4P33A 3KL4A 4V0MA 4B35A 1HTWA 2VSXA 3PVSA 1E9EA 4B33A 1IN5A 3L0PA 3N5CA 5H8WA 2LCFA 5KSZA 3QQ5A 4TN1A 3FHTA 4C7OA 1RRCA 1EXMA 2ZJ5A 3QEJA 4TMTA 4OQLA 2WIAA 4C4PA 2P6UA 3FKSD 3T15A 1LNZA 1TUIA 2K5UA 5HCIA 5DO9A 5LPNA 4KSCA 3FKQA 1AKEA 1QBKC 3GP8A 4Z51A 3I72A 1G8PA 3I5YA 2GZDA 2FH5B 4IKEA 2BEJA 3QXSA 4KFUA 4ACAA 1DAKA 5JI2E 1SVWA 3BIFA 1GM5A 1OF1A 5DE3A 3RRNA 1ZRHA 4M0LA 4POAA 4YMTA 4M1TA 4RFSA 2IS4A 3GMTA 4DCVA 3THXA 521PA 2XTMA 1PJRA 1MABB 1TEXA 1ELOA 5FI0B 4PZYA 4QGGA 3VKHA 3VHXA 3C41J 1J90A 1AJEA 1Q1EA 1YZLA 1KSJA 1T91A 4AK9A 3QPVA 2A30A 3CNNA 4MQBA 1HURA 4OHYA 1Q0UA 1Z0AA 5DGXA 4O25A 5CJPA 1U9IC 1N2CE 3TK1A 1U8AA 4CZ2A 3CNOA 3ETLA 1F6BA 5CLQA 1OFTA 5P21A 1T3HA 1ZU5A 2HCBA 2AL7A 2IBMA 4KYIB 1G291 2JIZD 2BDTA 2PZGA 1HEIA 3L8ZA 4KLZA 1MR3F 4URYR 5JEEA 1PV4A 1GVNB 3U4QA 2ERYA 3B82A 2FGKA 1Z8FA 1NVVR 2V7QA 2GZHA 1WBBA 1YRAA 4B3DA 5C1BA 5HKKD 4GOKA 1FX0B 2Q9BA 2B92A 2BHRA 3H0KA 2FOLA 3QVVA 2WKPA 2FSGA 2WMNB 2YWGA 3OEHA 4WAUA 3U44A 3R8FA 2ERXA 3B60A 5M04A 3K9NA 4IDHA 4MYUA 4QC2A 1A82A 2ZSBA 5AJYA 1Q57A 1XPOA 4QJ5A 1AQYA 4XVUA 2GXSA 3B9PA 4RCYA 2XAUA 2RHDA 2WWFA 1UEIA 4DIEA 1GL7A 1DAMA 2EYQA 1M1YE 3B1VA 3FMIA 3RANA 2PL3A 2KWIA 2JJ2A 5E7IA 1N0VC 2J9RA 5FOWA 3FWYA 5FR1A 4JBXA 1W46A 2CEAA 8OHMA 4OQNA 1KKMA 4EAQA 1CIPA 5E7MA 5IHPA 5AJXA 3KQHA 3SHWA 1E1QD 1VCNA 2J7KA 3ADKA 4NYMR 4EUNA 4TLDA 3A36A 2AKAB 3NBZC 2IHBA 2O0KA 4EQ6B 1QHHA 2VHUA 1YZTA 4HLDA 5EE0A 4HYYA 5EXXA 1KZ7B 2J41A 1CRQA 1MO4A 1NVUQ 4UJ3A 4A4DA 4X8OA 1WBDA 3OIWA 3MWLA 1KK1A 2X2EA 2ZITA 5DYGA 3MMPA 1IXSB 4GBMA 4B34A 4B3XA 621PA 2YKGA 1IN6A 1X1SA 1COWD 3KJEA 1E1RA 1PUJA 1Z6TA 4BQSA 4G5RA 2DWPA 5SZKB 2GXAA 1LTQA 1JALA 1BH2A 3PUZA 4JKYA 2R9VA 3H84A 1XX6A 4LPKA 2JLSA 3SJCA 1AKYA 5H70A 5CDFA 1S1CA 4JLOA 3OHMA 2UKDA 1T0HB 2G1JA 2VSOA 4D0LB 3Q7PA 3OIYA 4GOJA 4FCVA 2QNRA 1B23P 2DFTA 1ZU4A 5TB5A 2JAQA 1TX4B 1KDPA 1DAGA 3ASYA 3WNCA 4AKHA 2HF9A 2JLYA 1Q12A 2JDIA 3L8YA 4F7WA 1ZYUA 1W47A 3PEUA 2FFQA 2BJVA 5F9HA 3GLHA 1JXMA 3X1YA 4B73A 1US8A 4IVRA 4EPVA 4PZLA 5LB4A 3B85A 1ZM7A 4QGAA 5AUNB 4TLAA 5FBWB 4TSFD 1N6OA 4IHQA 3CRVA 2IX3A 2IHYA 3GLFA 5A4JA 4IOLA 3RYTC 3DHWC 1N6PA 2VRWA 4E22A 3KJGA 4MYCA 1NBMD 4NHOA 5AUPB 2HJVA 5KDDA 2IK8A 3LBNA 5DISB 4Z1MD 4G5OA 1XTKA 2ZUBA 3U3JA 3VX3A 4RD3A 4TT3D 2FSHA 1CKEA 5CM9C 2ZRLA 2FPLA 4PAMA 3U6BA 1U9IA 3B1WA 3SU8A 3EZFA 2W2XA 1K5DA 3BWDD 4PO9A 1T5IA 3KTAB 3AQ4A 4WZAE 4OBEA 1G3MA 2X2FA 2HF8A 721PA 3WP1B 2DB3A 4PHFA 3LY5A 3NWJA 3IIMA 4PC3A 4WXRA 2QPTA 4KJZA 4JVLA 2Y8EA 2DFNA 3FKSA 4BZPA 1D2MA 5AR1A 2R65A 4Q7JB 4MGZR 4PR0A 2GVDC 4YMWA 1L4YA 2QP9X 3WBJA 4AY2A 5DN6D 4B2IA 5IRCD 4Q1BA 2ODWA 4AG5A 4B3CA 5K8TA 1A5TA 1EFRD 1SHZA 2ZR7A 4Y0VA 4A2PA 1KO7A 1F2TA 1AGPA 2CNWA 4AYWA 2C04A 1R0XA 3BD9A 1HT1E 1IY2A 4XTCS 3UMSA 3ND9A 4M1SA 4NE2A 3P26A 4DSTA 1CLUA 2ZI9A 4KVAA 2MMGA 1BOFA 3IDQA 1W0JD 3CWZA 1GKIA 1AQUA 1DADA 2FNAA 2D62A 4MKGA 4QNMA 3C14C 4QHTA 4Q66C 4XWOA 4LHWA 2WV9A 5LBIA 1OKKA 2ZE8A 1OHHD 1KO4A 3RDPA 3B6EA 1P4SA 2VF8A 3MG9A 4JS0A 4ZDIA 2J59A 2BWJA 1IN8A 4DDTA 3IKJA 2FG5A 4Q1CA 1P73A 3EAQA 5IT5A 1O87A 1XMSA 3O8BA 2C2HA 3N2IA 3Q3JB 5KSOA 1P72A 1G8FA 1AN0A 2EWVA 2PMKA 5AK0A 5JCZA 4R71A 3P27A 1X3SA 4W7SA 2ZRNA 1CJUC 4PO1A 2OBLA 3QXHA 4Q4LA 2VQSA 4WVFA 4OI0A 1S1MA 4A6PA 1TL7C 5GVRA 4C3ZA 2KJQA 5EUMA 2ZRBA 1OFIA 5CK4A 3LXRA 5FUVA 4OHZA 1OT3A 5AUQA 3R7WB 421PA 3GQBA 4BRUA 3QIAA 2CLSA 2FN4A 3GLIB 3ND8A 4LBZA 1N6HA 2DR3A 4CEIA 4HI0E 3CRW1 3DOFA 4GZMA 5HKKA 2JJ8A 1YZNA 1UM8A 2GCOB 4JLNA 3BB3A 2WPDD 5B2ZA 3IBYA 2J87A 3DMDA 1II8A 2BCGY 4NYIQ 3SJAA 1N0WA 2WWWA 2WWYA 3TW8B 4HLUC 2CK3D 2IL1A 1CJKC 2QE7D 1OXSC 2ZU0C 2OXCA 4W5WA 1W36B 2ODEA 4NPHA 2Q3FA 3GLIE 1RKBA 1XF9A 4GMXA 5EQTA 2QQ0A 3BFVA 3P32A 3AVYA 1WB9A 3ONWA 1OH5A 1Z22A 4TQ9A 1HV8A 1Z2AA 1RIFA 1RJ9B 3C5HA 2QPOA 5FTKA 1G6OA 1U8ZA 5K8IA 1RPZA 2YC2C 3TNFA 3LQRA 2WWIA 1NJFA 4D0GA 2IW3A 2ZRIA 1S3GA 1GRNA 1NP6A 5FPHA 1KI8A 2HV8A 4AG6A 1FTSA 4ASUD 3ASZA 5C4MA 1UBCA 2OCYC 4US0R 5BQ5A 2ZI5A 1E0KA 2OFWA 3GJ4A 5FOXA 3BB4A 4FMCF 1M7HA 1XTSA 3SJBA 5KDOA 4JBYA 1F2UA 2VF7A 4F91B 4G5SA 1R5NA 1WDTA 1X1RA 2D2FA 1RFLA 5EP4A 5KHOC 4X8LA 3ZVNA 1Z0JA 4M1MA 1XD2A 4QG7A 3CPEA 1COWA 1D2NA 3D31A 2IYTA 1GILA 3HPQA 1FNNA 1U0LA 4KITB 2O0JA 1NVWQ 1ZC4A 2GJSA 2PT7A 4LYFA 4M1OA 2MSEB 3FMPB 2DWOA 1R0WA 2H16A 4BFVA 3FHCB 2FPMA 5FL3A 2ZJ2A 1Q1BA 3I32A 1XJ0A 4Q4JB 4DKXA 3B8HA 5K8UA 4HATA 2FWRA 1J7KA 2KBEA 3O47A 4G5QA 1ZUNB 4MDEA 2J0UA 2QTVB 3RWMB 1DBSA 2IXGA 4PC1A 2QBYB 2NO9A 1G3RA 2VYFA 3LWNA 4NYJQ 2CL0X 1G4UR 2CCGA 4RFVA 2QI9C 3TBKA 1FFHA 3IHLA 3ZIAD 5FL7A 1OIXA 1CBUA 2IF0A 3QKRA 4GP6A 3NDBB 3SNHA 4Z54A 1EX6A 1XMVA 1Q3TA 2J1LA 2QQEA 2W0SA 3AH8A 3CZPA 1OE0A 4UKDA 5A0FA 4C0JA 3AV0B 2ZSAA 2WWHA 1G1MA 1N5KA 3TH5A 4XSHA 2BEKA 2GJAA 5B30A 2F43A 5JSZB 2OV2A 5BXQC 4HAZA 4RZXA 1IAQA 3F5FA 2PT5A 1NBMA 5EE1A 2HYIC 2H5EA 1XXHE 3C16C 4C30A 5ELXA 1WRBA 3W34A 1E2JA 1MKYA 2NMVA 4S2EA 1H8ED 3SZRA 1ZM3A 4EFMA 1OW3B 1S9HA 3T34A 3A1UA 1JPNA 4XTRA 4Q1AA 4M22A 2CL6X 3CF2A 4Q48A 4URZR 3TMKA 1QHGA 3LV8A 4QJ4A 1QVRA 2XEXA 2R6DA 4EFLA 1GNPA 2BVNA 4RZ2A 3CB4A 1RE0A 1P75A 3KKPA 4DSUA 4MKHA 1DVRA 1PUIA 2CHGA 2ZROA 3TUIC 4D26A 1RRGA 2PEYA 1SQ5A 1KSHA 3GEEA 1Z0KA 3BRWD 3UWKA 4M1WA 5DN6A 3PIRA 3QF7A 4NCIA 3A8TA 1EFRA 1P2TA 3Q9LA 3NXSA 5KNDA 2VPPA 1Q1ZA 2EYUA 3QJYA 3UK6A 2W0MA 2QGZA 2HXYA 3PUVA 4HLUA 4V02A 5KPJA 1DAEA 1SVIA 121PA 4TTRA 2PJRA 4TYWA 3P1JA 2KB0A 4G0NA 2ZE6A 3T1OA 3ZLJA 2AD1A 3AP2A 4OI1A 5C46F 4X8HA 2CJWB 1GZSA 4OQXA 1OHHA 1GP2A 2A5DA 1R7RA 4L15A 1W4BA 2XNDD 3MWKA 4B3FX 4BLPA 2DHRA 1GL9B 2RMKA 2ASEA 4KFSA 4V0LA 4TYPA 1J2JA 1XTJA 2C95A 3QXXA 3A4MA 2ORIA 3M0EA 4NMMA 3LFUA 4PHHA 2RGXA 1P7CA 3U61B 1IONA 2AHOA 3DM5A 2BJWA 1ONBA 1R4AA 2DFKB 4Q02A 2BBWA 4URUR 3EPKA 4RKFA 4M8NE 2FZLA 1KGDA 3RS2A 4B75A 2AD5A 4IOKA 2A7QA 2O8CB 3AVWA 5EZ6B 1IHUA 3O8CA 1IOZA 1G5TA 1HT2E 3BH0A 2ZRMA 4CRWB 1NL3A 1W0KD 3N70A 3X1WA 1ESNA 2QT1A 2JLVA 2ATVA 4B76A 4CEJA 1XDBA 3C4JA 4YDHB 4DLSA 4LSGA 2OFXA 1KSFX 2WKQA 5FR2A 1MRNA 2FDCA 1M34E 4X8MA 3AKCA 1GIAA 4M2LA 3QI2A 2F9MA 3ICEA 4HDOB 5KOYA 4P32A 4TYQA 2YYZA 3CRMA 3LX5A 3BK7A 5DH9A 2QE7A 3DM9B 2OUKA 5FTNA 1U8YA 2FFHA 4GT1A 2Z43A 1HQYE 2ZJBA 2ZE7A 1UJ2A 1XJQA 1AZSC 3FVQA 4NCKA 2YC4C 1SKYB 3CKLA 4YMUA 1Z6GA 5H1YA 2ZTSA 2GWHA 3SBEA 3LVQE 1TU4A 4OK6A 1YR6A 4CIDA 5IK2A 4DHEA 1KI6B 3WYFA 3GJXC 3THOA 2NQ2C 2ZYUX 2WOOA 5L3VA 1KI7A 2GEUA 1AIPA 4OL0A 3GJ3A 1LV7A 2ORWA 2XZPA 2ZJAA 1E6CA 4ASUA 2C9OA 2W6IA 4I99A 3U2QA 1Z6AA 4D81A 4EDHA 1Z63A 2D7DA 2ANCA 2G88A 4A0GA 4AWXA 1E2KA 3OZXA 1U90A 1CXZA 5J4KA 1ZW6A 4QHSA 1G19A 3I62A 1CP2A 4HB2A 1RVDA 4RZ3A 4BFWA 3WHKA 3RWOA 4EJSB 2QG6A 1N0UA 3C7KA 3SQWA 2JATA 1VPLA 1JJ7A 4W9MC 4DCSA 2C96A 1SXJA 2ZRKA 2EFCB 3CRRA 1XNJA 3TR0A 2H1LA 5AJWA 1UEJA 2CE7A 1T3SA 4LV8B 3ZYCA 2V3CC 2YJTD 2A2ZA 2ZYWX 3EZ7A 2FGJA 3HWSA 4LWZA 2YWEA 4U02A 4LBVA 3ZQJA 3QE0A 1EWRA 5D3MA 3AF1A 4DZZA 4QL3A 3AB3A 1G7RA 1CU1A 4CT5A 3SFZA 4DLZA 1XEXA 5JWHA 2BMDA 1G7CA 4JKIA 2NZJA 1KI3A 3OIVA 5C18A 4GDFA 2D4HA 3JVVA 3DKVA 3GJ0A 4LOAA 1D5CA 4PAOA 3WMEA 3FDIA 3PCRB 2DPXA 5G53C 1NSTA 2ZRAA 1KKLA 3K0FB 2YNMA 4C0QC 3W8RA 3RAPR 4QFMA 2IUSA 3ZIAA 3TVDA 3IEUA 4A1FA 4HEJA 2PEZA 3SS8A 3FMFA 3M1IA 3A58B 1NLFA 2HCJB 4MGKR 4OHXA 3LVRE 4D2IA 4NCHA 1XCPA 3PXGA 3CNLA 5AWFC 3WNBA 2P0EA 2V9PA 4QXAA 1YJ5A 4RKEA 5J47A 1JEEA 4GFDA 4CW7A 1CULC 1I4TD 5KNCA 1ZUHA 3AVQA 3H2YA 4B74A 1EFHA 2UZIR 3RS3A 5SZJA 5FPSA 2QENA 1KI9A 3LO5A 4BFTA 1CF4A 2V55B 4LX0A 1W36D 3CONA 3PQCA 1H8EA 4GP7A 2GEVA 3GD7A 3VTKA 3RABA 2I1VB 1EESA 3ZZ0A 2I1QA 4AYXA 2QEQA 4M21A 4XH9B 1NLYA 1ZD9A 2ZQ5A 1J70A 1G7SA 2ZAMA 3E5HA 1ZM4A 3THWB 2H57A 4UNNA 1FZQA 1UFQA 1G20E 4TTPA 4K81B 3H86A 3OIUA 4A0FA 4C0SA 3BE4A 1AGRA 4Q4HA 2XJ9A 4EQ6A 4N0EA 3HU2A 1Z0IA 1IY1A 2QGNA 3KKQA 4HB4A 1IXZA 1KI4A 1JQJC 3Q8XB 3FYHA 4JL8A 4KU4A 3T5GA 4BFSA 4IFBA 2J0VA 2OESA 3ZZTA 1C1YA 1BMFD 2JLWA 1E2DA 2O52A 3N2EA 1P2UA 3DOEA 3P4YA 4AKIA 2IXEA 4LCBA 2WTUA 2XX3A 3MRSA 4KSBA 3RHFA 1CR2A 2IEZA 1UDXA 1R2QA 2W2VA 2YWHA 3L0IB 1FUUA 4B2LA 2W6JD 3OF5A 5JZVA 3OESA 1X86B 4D25A 2IS6A 1ZD8A 4QM7A 2J3EA 1T6NA 5EXPA 1BO6A 1D9XA 1JR3E 2EQBA 3AVVA 4QKQA 2XNDA 2D2EA 4D4KA 3U3RA 2RAPA 2YWFA 1G3QA 2PLFA 1E0JA 4O3MA 3LW8A 1W36C 2QP3A 3REFA 4KFRA 3GJ5A 3IIJA 2IYUA 1ZP6A 3THYB 3NH6A 2QU8A 4Q5IA 2XNSA 4P3YA 3ICQB 2N42A 2X19A 2V4ZA 4PC7A 4RCZA 2QY9A 4AD8A 3EZ6A 1GKYA 2MMCA 1KHTA 2OHFA 1UF9A 4WBSA 3W8NA 4QOSA 3QKUA 1TPZA 2ZRDA 2Q9AA 3I8XA 2PMDA 4GI7A 4NL4H 4PHGA 4V0ME 5B57C
chains in the Genus database with same CATH superfamily
3G2LA 3CX3A 4NCJA 3O4FA 4XWTA 1PFVA 2OLJA 1E0SA 3EN0A 4BMDA 1NWCA 1NP7A 1A77A 4YQFA 3HI4A 3ILHA 3PDIB 4ND6A 1OLSB 2Q2WA 2WA2A 3OQPA 2DQ4A 4O02B 4OQDA 3TLBA 1E9AA 1GFZA 1Z4PX 3AFNA 1DC3A 1L8LA 4UUOA 4XIYA 1YA6A 3O3NB 2I9KA 3G2JA 3QNUA 3W4IA 1C3OA 3NEPX 3P9IA 3S28A 2FSSA 2QZZA 1GPNA 4BPBA 4AMBA 1NVXQ 1F9EA 2XXBA 4J4TA 4XEHA 3W6PA 4EW2A 3HBFA 4A9AA 5HXAA 3I0MA 2HQBA 1MJ5A 1JWLA 1HYBA 3KTAA 3LC7O 3CLSC 3DA8A 3JYPA 3GXBA 1BA3A 3VR5D 3NC1C 2CLFB 4AZ0B 2BGUA 3EUWA 1CY7A 5KOJB 1SCUA 4IS2A 4X1YA 3FWHA 4RETA 4O2AB 3I01M 4TLCA 2QTWB 4MGIR 1DL5A 4KFCA 1QPGA 3GELA 1O6BA 4CTOA 5BWOA 1FEZA 5L7WA 1FFBA 4B3BA 2CMHA 5DSXA 1AB5A 2REXB 2XWPA 3G6KA 1BGVA 1W59A 4RK0A 4EFNA 4KYTA 1HUQA 3HU3A 4IFIA 2I9PA 2BJHA 2L0XA 5J5VA 1JKMA 4R2LA 3AEQB 3OEED 4HQFA 5GJWC 4AYTA 1GZDA 3NTXA 3FTCA 2P69A 2PANA 2DE0X 1EFPA 3U1TA 3SBDA 2DETA 2DJIA 3A6FA 2BGIA 3QU5A 5JDCC 4BS9A 5ICMA 4JUFA 1WKBA 3NJ8A 5LZ7A 4K1LA 3R9IA 1WR8A 2IITA 2QT0A 3F5MA 5AJHA 3I1IA 3DMGA 5TEWA 3W3ZB 2WJIA 1T9GS 2W6ZA 4IGAA 2NUAA 2BFOA 1E89A 3PHBE 3RKRA 2LR0A 1FJ2A 3D2BA 3TAXA 4B4VA 3RBVA 5FTLA 1B93A 1NW8A 1VGQA 1YGYA 4OHMA 4WA7A 4FB5A 4YUAA 1ONNA 3ST7A 1VHJA 3KXKA 1DQRA 1NJ8A 2J3KA 3UFBA 4EYEA 2XE8A 3PQ3A 3QHPA 2GM5A 1UKVY 3ASVA 4QPZA 1I0ZA 5CVCA 1T25A 2FPKA 3K0AB 4BLVA 4IDCA 4IUCS 5DIFA 4OD0A 1K4YA 3TIXB 2G0TA 1O94C 4GH5A 3DPUA 3L4KA 2DPGA 1J99A 2ZSHA 4MVJE 2W2KA 1TU3A 3NAQA 1QLJA 3F8SA 3N0WA 4QE3A 4PBTA 4BE4A 3II6X 3RVKA 1K5PA 4WZZA 1DRWA 2GM9A 3ZHCA 2XNJA 1OBFO 2EERA 4IDOA 4Q1DA 3AU9A 3MJHA 4D3ZA 3JARB 1KY3A 2M2IA 4YPOA 1H1LA 5CW1A 3HNPA 3M6AA 2C20A 2GUGA 3TOXA 3OPMA 3K9CA 5FPKA 1DE0A 3A1WA 3DVLA 5JZMA 5K4HA 3B1XA 4H3HB 1WPGA 2I8CA 3UH0A 3KFVA 1PT6A 5BNIA 1R3UA 2O1SA 2OV8A 3HCOA 1GPH1 2UZ3A 4PZ0A 3K0EA 5EP2A 5CB4A 1FBTA 1WV1A 4W5HA 4A2QA 5UKDA 3GAFA 4FKBA 3BC1A 2QJFA 4M1ZA 5BO5A 1UBOS 3TQRA 1XTUA 3WIBA 5C81A 5KVCA 2BM9A 2QX8A 2C98A 2F62A 2IV2X 1PKEA 1YZHA 2QTFA 5KYKA 1GPJA 2CUTA 2QW8A 4JC4A 5DMXA 1RWKA 2OG2A 3T61A 2HIHA 3GWGA 1QYWA 3QGMA 4XUCA 2ZW9A 1FYFA 2WSLA 3TPCA 5KCZA 3G0HA 3AF0A 1MAVA 1VZ2A 2J67A 1UC5B 3AKZA 2LRHA 1UBGA 3JSAA 1V43A 3NYIA 5JSQA 4EPXA 4CIXA 3KDAA 1MC5A 3MUEA 1JX6A 1AKNA 1MTZA 3CUWA 3FPJA 2FWJA 2BKEA 2OCDA 1GYQA 2F55A 4A2WA 3N28A 2R44A 3G7UA 1C9NA 1NULA 2IYPA 4UBJA 1YIOA 3BBPA 5GOTA 2DXIA 2HWWA 1QVAA 2GBIA 4ZEVA 3VO8A 1N0IA 1XEFA 4HQ6A 3RW9A 2IXFA 4UMDA 2QR3A 3OM9A 4IJKA 2VJYA 4DSNA 3MLBA 2RD2A 5FADA 1WCXA 1OZFA 2A1TS 1TJ3A 4LYJA 4Y9TA 2CL7X 3KVOA 4FHCA 3NBMA 4UOEA 1RZRA 3V8VA 2B4QA 2FR8C 3OQ6A 5CDFE 1FA9A 1RD4A 2CCJA 1FP6A 1US8B 5BV0A 3PJGA 1ZRSA 2FPRA 1BMFA 4HB0A 1QFMA 3DMHA 3ZDZB 5BW8A 5A4FS 3T1TA 3IQXA 3IPCA 2P6PA 3INNA 4B7ZA 5T8KC 3D6HA 3GFGA 3PWSA 4MDHA 4LJRA 3D8SA 1OBCA 2XXJA 1FOEB 4YJ3A 3LS2A 2B4RO 2GI4A 1GNTA 4UMVA 1E2MA 1R9GA 3GMIA 5FUXA 3BN3A 3L8GA 1WY7A 4UNRA 1XQXA 4D9GA 1X92A 1UC9A 1BDHA 3MHTA 4LJ7A 2XKAA 1Y6RA 1BVYF 3ECAA 1JMYA 3Q7RA 4WNAB 2WIBA 4CQMB 4I9FA 4PSAA 1ATZA 1OYYA 2R62A 1JMVA 5HUJA 2WIGA 2FUG1 5AKGA 2WD7A 4ZI7F 1FRVA 5I7FA 1RWPA 2YRFA 1KI1A 4NBNA 4ND5A 4LFBB 1PR1A 1Y5LA 1XTVA 2R87A 3C5WP 4AULA 3GLFE 1L7EA 1U80A 1B43A 2QXYA 2JFUA 2PD4A 1JL3A 2EJUA 2YWJA 2HA0A 1RBZA 3HKCA 1XV5A 1QFJA 3EGCA 5CJJA 4BVLA 3T06B 2Q99A 1WXDA 2H52A 3KAKA 2Q21A 3M81A 2J6BA 3Q8KA 3S1SA 1K63A 2PSHA 4REOA 4UU1A 4ZEXA 3BH6A 1OIWA 3GJTA 2WP8J 3AR6A 4UZFA 3JRWA 4CIAA 4F6CA 3SKYA 1AK1A 2W70A 3AFGA 4MWZA 4MQ5A 1GUAA 4Z3KA 3S6JA 4L8GA 5KC9A 1KYYA 1NC3A 2I2WA 2C5FA 4GPIB 5IYZB 2LIPA 4WERA 3WRWA 4AB1A 3EW9A 4A16A 5C7IO 3IEMA 1QHNA 3PJRA 1EE2A 4Q9KA 2JARA 2YDXA 5BSUA 4ETWA 1GZUA 3IGFA 4MB6A 4EI7A 5CBPA 3F2IA 3LUGA 2ECOA 1UT5A 2ROQA 4PQRA 1LDGA 2NO7A 4IW3B 4N40A 4N49A 3E9QA 3IH5A 2RBGA 2WTBA 3VR4D 4ZZ1A 1FSPA 1YQTA 4MP6A 2QD1A 5HSGA 4R5MA 1VPDA 2RH9B 3MCAA 3ZX5A 3LHSA 2XADA 3HUTA 3ZWMA 1V5WA 4BRWA 3IV9A 1X2BA 1L4BA 1NVKA 4MIYA 3IIKA 3L7BA 5IBPA 1ANKA 4K2HA 3IQGX 4EAAA 2M6SA 1LI7A 1CVIA 1P9OA 2GGSA 3E8MA 1EUCB 3L82B 4JODA 4OP2A 3K30A 2IVZA 2HDHA 2P9QA 4D8VA 4AKSA 4KQ1A 1VB3A 2ZSFA 3Q3HA 3MTDA 1F8YA 1HE8B 4CM4B 3PPXA 2TMGA 3L1JA 1U3UA 5CB6A 4DC9A 1A9SA 5BVHA 3EFBA 4WY5A 2CXSA 4EH1A 1I36A 3FGNA 4J7AA 4CKBB 5HUQA 1SVSA 2OBXA 3LCUA 2P3LA 2J4FA 4M0KA 4I4LA 2ZXUA 5MN5A 5BR4A 4EO9A 4FMDB 5AMXA 2ZYGA 2GN2A 3V4RA 1OH6A 2YYYA 2P40A 4QDTA 4BB9A 2WRZA 3E03A 3FR7A 3LLSA 5GZ6A 3RS4A 3VC3A 1DIHA 4W6ZA 5AI8A 1SCBA 2VJPA 2ZK7A 4V39A 2D0PB 5AW9A 3UXEA 5CFLA 1Q74A 5JRZA 1SELA 4TV9B 4AF7A 4R9RA 1C3EA 1ODTC 4D02A 1SRQA 1NKTA 1KQPA 1MF7A 5HRUA 5TQ0A 5DHFA 4KI0A 2P65A 1JF8A 3I28A 1KJ8A 3QBVA 4Q21A 4EY7A 2QUAA 3GJSA 4KYVA 3I2KA 5G4KA 3CLVA 3BWMA 1SN7A 1J20A 2XB9A 4AUMA 1XQ6A 1B6RA 1S89A 1XXHB 5ITSA 2Q3MA 3EVTA 3PNYA 3EIQA 2TSYB 1D04A 3GBPA 2Z4TA 2ZRPA 1SHKA 4BLSA 1LBQA 1PJQA 5TR9A 2ADOA 1A0OA 1JDTA 3GJ8A 5I4CA 2OCKA 5DTJA 4RTPA 4L6AA 3JWJA 3OWHA 1II8B 5DTIA 3U3MA 2WKRA 4ZVQA 2R751 1EVJA 3RT1A 5GIPE 3KT8A 5F7JA 3IAFA 5CDTA 1E3EA 4PO8A 2WVGA 4MO9A 2JLAA 4EECA 4RVNA 1C80A 1H5UA 2NUTA 1P4RA 4Z1MA 1E98A 2GO7A 4J0QA 2D7CA 4K8OA 4AY5A 1A9QA 3UMRA 4TVOA 2FJUA 2O3UA 4MQFA 2BGWA 3RTAA 5AM1A 1NXPA 1T1RA 2DUUA 4LJSA 1IHDA 1S2OA 3E22A 1TC2A 2OZPA 5COQA 1WBJB 1Y9EA 3G0GA 5LQSA 5B5SA 1PK8A 3I61A 2P2CA 1B1CA 1DWPA 1XQYA 3BE6A 3O4IA 1XEAA 5C8XA 1AQIA 4BV8A 2RCNA 5E3JA 1V3VA 1XQ9A 2WB2A 4HH4A 5CM8B 1G42A 3DHEA 3LT0A 5CXSA 3ME5A 3S2SA 4ZU6X 4BQNA 1YU9A 4Y2XA 5DW0A 1N57A 1NUTA 4MR7A 2AF4C 4N5NA 3IUEA 4BZXA 1D2CA 3NX4A 4PHCA 5E1BA 1WLYA 3N75A 4XFJA 4H1VA 4YROA 4DLKA 3H0EA 1JEOA 3A4YA 1HQCA 1GT91 5I3CA 1BFKA 1HL3A 1NQXA 2O7QA 1J0CA 1IPHA 1DJOA 1NQ5A 4HEA1 3TTXA 5I7EA 5MN4A 4LXXA 4I8XA 2ZI7A 4MWDA 4PWZA 1GPLA 2AXPA 3OH8A 5DGHA 4RL6A 2GD2A 2HDOA 3H97A 3VHLB 4EG3A 2J7PD 1SCAA 5K0JA 4IRUB 1XD2B 1KVSA 4KPUA 4LOIA 1UJ6A 1N7IA 5H4GA 2EU8A 3WYAA 1X8XA 2E3JA 1S6YA 4PZDA 3ZCXA 3FOWA 4XD7A 4LV6A 2DWCA 4GRAA 1ST3A 2HKIA 3HDVA 1Z8HA 3AZQA 3KE8A 1W0JA 1C7FA 5G0WA 5FWYA 1QU3A 1IQPA 2D0IA 2O4CA 2BLLA 1XZDA 2O57A 4ME6A 1KI6A 2WM9B 1NHWA 1H2RS 1DX9A 2GCPA 2WW8A 4I5EA 5EMHA 3K53A 4A8JB 2O8FB 2IYFA 1X39A 4LV5B 3ZQKA 3RIMA 2KE5A 3OKAA 1ADGA 4YMVA 3KIPA 1KEVA 3T0GA 1W48A 4N47A 1JFTA 3ASUA 1WOMA 3KVYA 5L4SA 1RIIA 3JVUA 2AYYA 4ZWNA 2VPIA 5EVCA 4D56A 3FMOB 3ANMA 1WCIB 2O8DA 4IJWA 3CUEF 3ZBUA 2RARA 3F71A 1PYOA 4WKNA 5M3BA 5I7VA 3PC8A 3R9XB 2C5EA 2FZGA 3K92A 1YS9A 1LS1A 1CEQA 3M70A 5BOSB 1UBHS 4JB0A 3ROQA 4RF5A 4YIHA 1WSAA 3N2LA 3TSWA 1JECA 3BDVA 2JJ1A 1CQJB 2AZXA 2GCIA 2HA4A 4Z4IA 4YRGA 5JD5A 4IOJA 3SZ3A 3HJFA 4PICA 1JI3A 1LGYA 1XPJA 3C6MA 1Z38A 4MIEA 5J43A 1N1GA 3IR5A 1J21A 2UVPB 3M1YA 3MJEA 1B0ZA 1V5GA 3ZHVA 5IZCC 2P62A 2H7VA 2XYPA 3B78A 2VS1A 4K9LA 3E18A 1SD5A 4PU0A 4O5AA 1IUOA 2QTMA 2JGKA 3MGGA 4OFXA 3GEHA 2D1TA 1JSRA 1U5BA 2BTQA 2EAUA 2QMQA 3H7IA 4IG9A 1U81A 4XVHA 3GCDA 3TSCA 2ZJ4A 3JD0A 4DYVA 1BDIA 2ECKA 1KJYA 2FSFA 2GILA 2WPDA 3IAHA 3RSHA 5LNK6 1HC7A 1ECPA 3MIIA 4I6GA 5HGXA 1V7CA 1W2HA 1G21E 1HX7A 4B83A 1G66A 1S3SA 2UV8A 4GSYA 4BHTA 1NXWA 5IWAB 4MITA 3HXKA 1DWOA 2Z98A 4Q18A 2OM2A 1KMQA 2JD0A 4G24A 3GLGE 5FPQA 5DHSA 3NP9A 2R96A 1SBTA 9ATCA 1QK4A 1IWOA 1ULUA 4KXVA 4JBWA 4E21A 2ZRFA 2JFBA 1NE7A 5ECDA 1DOAA 1GUDA 1E9FA 5GTDA 2H18A 2XA9A 5FI5A 5JPIA 4ARBA 4QUKA 2YYAA 3ZDEA 3U7EB 1EU1A 3GA7A 1SUDA 4IF6A 3I8SA 2C2KA 4UTRA 2AFIE 1J2TA 1ETUA 2HXGA 5J5AA 1YF3A 1QE3A 4HAWA 4IIUA 3E0QA 1WEHA 3A37A 2G8LA 2CUNA 3I2HA 3GFQA 4YCCA 1A8IA 3ZBQA 1BXKA 3K8YA 4JGIA 4ZAZA 4MUBA 2A8YA 2ZWOA 3H2HA 2V7PA 2Z9DA 5DSZA 2YASA 2PCLA 3AHFA 4EYSA 1BVUA 3PJDA 2HMVA 2ISSD 4H7HA 4LYAA 4NJMA 4NMLA 3AR7A 4NENA 2XWBF 4QOEA 5IAKA 2O6LA 3RUAA 4G4JA 3ZD6A 1XZBA 1CUJA 4OA5A 3OTQA 2DEUA 1M2EA 5L40A 3TE6A 2JFNA 4D8YA 2CNNA 5CHYA 2AIRA 1OAKA 3A70A 3IVCA 2VPXA 4MZDA 4X6YA 1AQLA 3WYEA 2Q5CA 1HMPA 2ZJ8A 2IE8A 3NHJA 2FSPA 3I73A 4QUJA 2G76A 4FQ7A 2BZ1A 5EZ5A 3VH2A 4BNTA 2B2XA 4F8YA 3H1PA 2HTEA 2J3QA 5DWQA 3PTZA 4JC5A 2A0FA 2X40A 3S7ZA 1U7TA 1OV4A 4ZI7A 1KH3A 1SZPA 1WW8A 2FUNB 3TFQA 5D7BA 5A62A 4UXHA 2VFAA 1NYTA 2JDID 1ZIOA 1W4AA 2QTTA 2V4MA 1XDUA 2IYSA 4FI3C 2OG1A 3RK1A 4ZDJA 1XQVA 5IVPA 4PIVA 3L1KA 1THZA 3OJWA 3ZDBA 2P0AA 3IVRA 2O07A 2Q1TA 2J0QA 4DLPA 2WC1A 2QS9A 1H5NA 1YBVA 2CHQA 4HQLA 1OC2A 4AJPA 2AOUA 4PNHA 1U2QA 1W88B 3PRYA 4HVTA 4QUBA 2GFQA 3NBFA 3CFYA 4QO8A 3RREA 2HM7A 3B36A 1RYMA 1N8KA 2QTCA 3QA3E 1QYIA 3C45A 1DKPA 3I12A 3P4UA 2CFCA 2IEGA 3C3WA 821PA 3SZGA 2PTGA 1C30B 4FFSA 4D9IA 2EW1A 2FLVA 2W2TA 1P1BA 2XBMA 4DPMA 1GKUB 1DXHA 5B7NA 4DDMA 1XZEA 4IDEA 2GAOA 4XEUA 4OOEA 1QR2A 2I4NA 2JKYA 2P35A 4G26A 3I6ZA 5C4IA 1FL9A 1II9A 3V1KA 1FX0A 3GLSA 5KVAA 1EZ1A 4DDUA 2LKDA 2E4VA 4RHXA 2Y92A 4PSKA 1M1NA 3VU1A 2WIJA 4E51A 3LMKA 3EZGA 4Y2TA 1XELA 4JJZA 3UFXB 1GPUA 4C2UA 4WZBB 3UT0A 3ZGVA 1YA4A 2JH3A 1USWA 3S2IA 4MRRA 3RVRA 1FK8A 3W1VA 1FYXA 4KO8A 2HPHA 2IODA 4LJ8A 2ZUUA 2AJ8A 4TUYA 2ZYDA 3EW7A 3D6VA 4ENWA 5CYOA 3A6EA 1HDEA 2P8SA 1Q2XA 3LOPA 3PRHA 5KDLA 2FEWB 3K4QA 4IIXA 5C7OO 2VF4X 1Y9AA 5BN4A 3KZKA 2NTNA 3OUTA 3RU3A 3UG7A 1T1JA 2GH1A 3LT5A 4IBOA 4BZQA 4CT4B 1ZJ6A 3O4HA 2CNWD 1MGPA 3TXAA 5K8LA 4PW0A 3BTOA 4WHMA 1PEKE 2DTXA 3C6ZA 5DK6A 3FIUA 3QUQA 4AX8A 4CM1A 4Z6KA 1UBFA 4NMXB 3CR7A 1GARA 2QAIA 1SM4A 3NKLA 1IZYA 3DXFA 3TN7A 3L84A 5LMNB 2WFAA 3NWBA 1ZJJA 1EJ2A 4AMYA 1AU9A 3OU7A 4MAFA 4B6QA 2F4NA 3X44A 3DDNA 3EQ9A 3WGMA 2BSAA 2VIIA 3HKBB 1IXRC 1EX7A 1LS6A 1TO1E 3D8HA 3WNQA 4XA8A 4DWOA 3L40A 4NRDA 3ZUGA 4EG1A 1DAIA 2V1XA 4A0QA 3OO1A 4OXXA 1I32A 1GCAA 3RARA 1LK7A 3VVLA 5KBYA 3KUDA 2G8NA 4YP5A 1GTRA 5D3MB 4K5QA 4JA2A 2IHVA 1A71A 5L51A 1BEUB 4PYOA 3UBMA 2OCPA 4YPFA 1T6BY 4HDNA 2OYSA 3FDZA 4LOLA 4PLVA 1W5AA 4Q9AA 2LNDA 3I0NA 1DBPA 4MSUA 2WHPA 4QDZA 2JA2A 3GB9A 4EENA 1IZ9A 3LE8A 2FPPB 2ZZKA 1AHPA 1LSJA 2I3BA 1IM2A 3EPRA 1CPYA 1ZOSA 2O3SA 4JUCA 4EO7A 3G2KA 2VBCA 3O8OA 4DHWA 3PNOA 3ETNA 3NBQA 2EDCA 4MHSA 3TPFA 1RHJA 4FGWA 3H87A 4DJTA 1QF6A 1O2DA 3MZ0A 1DBRA 3PNSA 3BMOB 3R7AA 4D96A 2QLLA 2R5WA 5FOVA 5IG2A 3W5AA 1TPYA 3S5JA 4BNNA 1N5MA 1HLPA 5HA5A 4QGFA 5I7SA 2R7LA 3VNRA 3D6UA 4IIFA 1ZNZA 4IVNA 2FFAA 1PJLA 3OHPA 3DMTA 1L5KA 5DHTA 3GCGA 4L4YA 5T4BA 3LPLA 3OPYA 3BIXA 4G8BA 4LRTB 1Z2CA 2A5LA 4WDRA 1P4AA 2HRCA 5HIMA 4NFYA 1ABEA 3LT4A 1TQ4A 2AC7A 1E64A 3UT5A 4JSYA 3EVFA 1I1HA 1LPPA 2AWOA 2OSVA 4Q9JA 3AIIA 4UCQA 4DB2A 2ZWAA 2Q28A 1M5RA 3KUUA 2UU9B 3W0LB 4O2RA 5B1EA 2QQ5A 2HF2A 2ZTUA 1ZGAA 1I3KA 2R97A 1N2EA 4EL0A 3UATA 5A1JA 3VA7A 2RKOA 3UBTA 1E6UA 1TIKA 2P11A 3P0HA 2Y71A 1KEPA 1D9ZA 2WABA 1B4DA 1H1TA 2CJXA 2YXDA 4PQFA 3X1JA 2IHTA 2QW0X 4IXDA 3ITKA 1PQWA 4Z2YA 2YHSA 1ZSVA 5H82A 2IU4A 1V3TA 2NO0A 2JIRA 4EA7A 1H2XA 1N4AA 5ARCA 2ZPTX 2V5VA 2XUOA 1ZD1A 4RANA 2WAAA 4BRSA 5CA0F 4ICIA 4CL2A 3RUCA 1PJCA 1PJ3A 2O2JA 3E9NA 5E38A 2P2DA 5EE9A 1IY8A 1FMLA 4KFTA 2BKAA 1M73E 2C8VA 4IQGA 3V1YA 2WTNA 3QXCA 3WB0A 1RMYA 4R98A 4U39A 1U1DA 1PLKA 2NTYC 3ZDFA 3EFOA 1M75A 4FZ3A 2P9HA 1N6LA 1JLHA 2B3DA 3OD1A 5U4QA 3DPSA 1GY8A 3TYXA 5BVGA 3WY9A 2R85A 3R5KA 5BY2A 3DMNA 4JOSA 1N1MA 3CVOA 3DL0A 3U48A 1SNYA 1MJHA 5LVAA 4PS1A 3RQSA 5CIQA 1HSZA 1V5IA 3CGGA 5FLYA 1I51A 3IKLA 4YCBA 5HEKA 5HGJA 3ZV3A 1YI1A 4HDCA 3AEKB 3KHTA 4U3JB 3WLNA 4NJEA 1U3WA 3KP1A 1IZZA 1FLVA 2ZJFA 3QYAA 4HDQB 1U2RA 4J3FA 4PCLA 3UMFA 3FUUA 4NI5A 3U9TA 2JFFA 2QYSA 2FXVA 3DBLA 3D0RA 1UKEA 3EC1A 1TYEB 3RC1A 1CY2A 1TRKA 4GPAA 1HRKA 1WDKA 4ZVSA 1TMGE 5M2QA 4J2TA 4DCJA 3A3KA 1EI9A 3B1ZA 4HAYA 5IAOA 4RQTA 4YT4A 4W9NC 2NYVA 3UMVA 2HU2A 1B15A 3U3ZA 4B4OA 4BN4A 2EJCA 2GLXA 3K05A 2B2CA 5HE9A 2OTCA 1YR8A 1RRFA 1X9GA 2BF4A 2UYYA 2ZZNA 2AE1A 2X0NA 4DREA 1EDOA 2FEKA 4HEHA 4E2XA 5KYWB 3A25A 3GRKA 1QQ6A 2E18A 3EG5A 3QFCA 3PQ7A 5ESWA 1C9DB 4ZAWA 3VFDA 4DIOA 5IANA 1UMCA 1Z83A 1F8XA 4LJ6A 4JI1B 3DOUA 1YU6A 2NIPA 3A11A 3D0KA 5I6DA 1AQNA 2UYOA 3I39X 4O3FA 1IZ0A 4ILEA 5TSDA 3K0CA 1W52X 1YFZA 2Q7OE 3H5NA 3IAXA 4YECA 2GD0A 2C83A 1YB4A 2PPLA 2QRNA 1O58A 5GJCA 5JJBA 1V71A 7REQB 1XA4A 2YBDA 3QH4A 1NOKA 3U4GA 5K0CA 3D59A 3DTVA 3OU2A 4K88A 2YS6A 4FS3A 5H3LA 3ER9A 2FKNA 1AGYA 1UXIA 2O6HA 2CW5A 4ZVOA 3FPAA 3U56A 2WJAA 2FK7A 3BZUA 3CZMA 4P7BA 4XD7D 2JJQA 3I37X 4EIWA 4JYZA 2HD4A 4JAVC 1E18A 1U9CA 4N3NA 4AIIA 2AJBA 2EGGA 2F3RA 2PGJA 3B20A 5G41A 1JLMA 5CU7A 5ADVA 2HL6A 4X6UA 5B4VA 1RTKA 1O4VA 4Y67A 4J9VA 3I2GA 4JJIA 3CZCA 1KEEB 4URXR 3I92A 3D7NA 4QYSA 3ZJVA 5K2OA 2HCFA 4X1IB 1F38A 1OD6A 5BQOA 1FNDA 3KZNA 1Y8ZA 4FE3A 3M4YA 1R6VA 4G0OA 1VG9B 1AC5A 2I2AA 2C7GA 1G9XA 2A5GA 4Q7LA 2P6OA 4LHVA 1U1CA 3CXRA 1YZUA 4YREA 5B6JA 2KSQA 3EA0A 3KDPA 4N5LA 3M1LA 2FSIA 1W85B 4KAJA 1JDNA 3CURA 1R4ZA 2E6UX 3WB9A 4J0JA 4DDVA 1C3LA 1XF1A 2A9RA 3PNBA 1HL7A 4FZ5A 2GAAA 4NG4A 4X6LA 1GNQA 1F8UA 5CT6A 1G5QA 3RTBA 4C9BA 3M5CA 3W7AA 3GVXA 1N2HA 4DXDA 3B1KA 1EP9A 1JQBA 5G3ZA 4HV4A 1QU2A 3UYLA 2RGGA 3FGZA 2NUAB 5ED4A 2I66A 1N2GA 3K5PA 2ZYVX 1S8FA 1YDHA 5EYPA 3OCVA 2ZIAA 4HNQA 4JROA 1M2OA 3VQTA 4UEJA 1NLZA 1TGVA 3V8PA 5IJWA 2W83A 1G3UA 2V8BA 4LWPA 3OOEA 3UJ8A 2H07A 2CB9A 3DCNA 3B5IA 1PL8A 3OX1A 4JNKA 3VR6A 4DUPA 2PR7A 2OGTA 5AKZA 4ZXFA 2DG2A 4ZYYA 2RDMA 3UKDA 4RJJA 1M7BA 4TXMA 1FMCA 1QOQB 3C3JA 4LK2A 5KTTA 1Y63A 1CF9A 3LUAA 3SHQA 1DEKA 2KM1A 4GM1A 2BD0A 1WX1A 2QIOA 3RVBA 4BMVA 2HWUA 2SHKA 3ID6C 3QKWA 2W2KB 3GH1A 3N58A 4PVDA 4C7KA 4MUYA 5KYGA 2I2DA 2BHSA 4UEQA 2AFVA 4G84A 5DASA 1TD1A 1J8MF 2CVOA 2IYNA 3OE7A 3UJHA 1QNLA 1Z2DA 2PGLA 1OMOA 3PXEA 1FXUA 1E58A 1HH4A 4O1IA 4OQMA 2MINA 5AKJA 1NM5C 3FLMA 3Q6NA 1JIKA 2D2VA 2ZEJA 3P9ZA 1MPTA 3QF4A 4I9UA 4KV9A 4UHHA 1BD4A 4Y6PA 5CVVA 5J4VA 1TQ6A 1U2TA 1XUOA 2I33A 2OO5C 3K09C 3BKWA 3MAAC 3W04A 4BZWA 4ENUA 3BJRA 2AFRA 3HDTA 3OBIA 3RFFA 3SK0A 4EPYA 3AIMA 2C03A 2PNFA 5FORA 3GVIA 1K3TA 3CLHA 4ZHQB 2HJ9A 1VL2A 2WZCA 3D9QX 5CB4B 4EARA 3V80A 1O5TA 2AK2A 4LXUA 4ND8B 2MYTA 3Q7EA 2AN9A 3AZOA 1A69A 2O7SA 1VTKA 3JSXA 5JQGF 2FEAA 3EGDA 4UHJA 3SYLA 3ZLTA 5LQRA 5E9QA 1LI4A 1R88A 3LDAA 3SDBA 1GSAA 3RRBA 3VX4A 1MHPA 5L3SA 3IILA 3SSAA 4AZWA 5JSZA 4ILKA 3B6KA 2YWBA 1VM6A 4B47A 4G1EB 1VCOA 4AF6A 5K45A 1P9LA 4H0FA 2HYDA 4YALA 3ZPXA 4CU5A 3T3HA 3ZWNA 2EW2A 2P30A 3FFXA 1T3LA 2CBZA 1G17A 3K70D 1TJ4A 221PA 4F97A 1EVIA 1ZH2A 2RCYA 1S96A 2XVMA 1I6LA 1KJ9A 2UZ1A 3NC0C 4IXWA 5IK2D 3QLJA 1WETA 1MB0A 1ZXLA 1K4MA 3G0BA 3KZMA 4QHYA 5LMUB 4KACA 2PZJA 3ZU3A 5JD6A 1F0YA 1CQPA 3WG9A 3ZDQA 2IUEA 1KYWA 3N0XA 3PQ6A 3HM9A 2VQ6A 4Z4GA 2JI7A 4E5MA 2UYCA 4M46A 4HUTA 2M6RA 1N5IA 5CAEA 5DBOA 2XVZA 4RNDB 1DEAA 1QIKA 1UFRA 3DEAA 4QUEA 5FUBA 4BC0A 3KQLA 3OTWA 5CCXA 3LLMA 3X3HA 2GZMA 4C0HA 4HNUA 5LM3A 1G16A 1MO2A 1XAIA 2F3QA 2JW5A 3NCHA 1MAWA 4MMYB 1GTMA 3I3SR 4CVNA 1NMXA 1NQOA 4RTKA 1OTYA 4HUJA 1KQOA 3ZXYA 2OBMA 4PF1A 2OAQ1 2EX0A 3DDSA 5CMLA 4G65A 4JL5A 3LF1A 4HS4A 1I4OA 2GZ3A 3CUTA 3MFYA 4XIGS 3WP0A 5BNWA 4CN8A 4PEVA 4XCQA 5GIOE 3JYOA 4YK7A 4KR3A 3QG1A 4YJ3B 2JLUA 1NW3A 3EOBI 4NBVA 1DQZA 5AOCA 3CEHA 1XYYA 3EEYA 2HNKA 3MJVA 4KH0A 4UARA 3OF2A 5CK5A 2QAGC 3G2HA 4DIMA 2C9CA 3WZ2A 4E31A 5LKRA 2AYZA 5JTUA 5L8VA 5IDYA 2ZSEA 3DZKA 2QVGA 4Q9LA 3ZH2A 3R0QA 2HLDA 2WD7B 1CHNA 2XOKA 16PKA 3I9MA 4DIDA 2H9AA 1Y6JA 2ACWA 5D3ZA 2PZKA 2QU7A 4CLDA 4TKUB 4XX1A 1S7CA 4LZAA 1M54A 1RZVA 3ANTA 2ZSUA 4FONA 3R3XA 3HKCB 1Z5NA 2XYGA 4CWAA 3T0IA 1SU4A 4LNHA 4QQ8A 1OXVA 3R5XA 3GJ7A 5TJ9A 3HN7A 3CF0A 4LFAB 3LHDA 4I50F 5LFAA 3A1TA 4KIJA 1G9SA 4HGQA 2QIPA 3QENA 4Q12A 4UAJA 1I3MA 2WF9A 2N47A 4HWKA 2DCUA 5BQPA 3TOSA 2IC5A 1C2YA 2OP0A 3FDJA 3H9UA 4RLSA 4B6PA 4FNOA 2A5JA 2XSZA 3LC2O 1KPHA 2HJHA 3QLUC 5ALXA 4W5JA 3R7FA 3O9MA 5B7GA 4IWXA 1FLDA 2GNOA 2VN8A 4KMRA 1X87A 4MWEA 2IIVA 1V7QA 2WSBA 1GA4A 3NQ41 5AKHA 5B4UA 2O8CA 4RY9A 4MQ6A 1RCTE 3T7KA 3O7WA 5T8KA 4L51A 5CBPB 2HMSA 3S0JA 4LS3A 4RJIA 5CA0A 4EGQA 4YDQA 2VI5A 3KR2A 1AX9A 4ZQHA 3CX6A 4GI1A 2GFIA 1FX1A 4Y6OA 4MJ7A 4NLLA 4R9VA 4NWIA 3TZCA 5K4GA 3BXHA 3AU8A 4M36A 2ZDQA 1RC1A 4IJUA 3AF4A 3TCKA 4D0SA 1XNHA 1FRQA 4G36A 3TSZA 2WICA 3EBLA 3CLRC 4TMZA 5I3ZA 5AP9A 3RRYA 4M1YA 4YV7A 4XUGB 1WZIA 2XCTB 1ESCA 2BBOA 3CF4A 1U5CA 2HQOA 2XITA 1RXCA 1SUFA 2BELA 1SXJC 5C0OE 3IXLA 4WXEA 2JGLA 3F2VA 3MBIA 4FI3F 2VP5A 1RT9A 3I30X 1JTEA 4KRXA 5TNXA 3QVUA 1Y5NA 3K1YA 1U3FA 3L7DA 4Z0PA 10MHA 3IE2A 1H3EA 2VUSA 5CDSA 2Q5OA 1LFDB 1T8YA 1TT5B 1RP1A 1ZA2A 2WJZB 1QRRA 3S2UA 2EEZA 1J0AA 2XBUA 2NV2B 1EZ4A 3NHWA 3TOCA 4BLRA 1LWOA 1ZG3A 2EFDB 4WNIA 3JQBC 4FOPA 1XCOA 1VG0B 1SXGA 4QYXA 1U6IA 2VT6A 1XTTA 3ZU4A 2ZU6A 4I8DA 4TS1A 3HA7A 3PB3A 1IPEA 3DYVA 5FUYA 2PQ0A 1IU9A 5JSKA 2HMUA 1IIBA 3JZIA 5G4KB 5B1SA 4WZ6A 1Z2OX 2VDMB 1Z5WA 4RACA 2BMFA 1XZHA 5IAAA 1X2EA 3ABZA 4JITA 1JRLA 1BYIA 3OAAA 1AB6A 3GXOA 1RWWA 2FPGA 1SOMA 1UQUA 3BORA 5BPFA 4YYEA 1OXMA 3K9HA 2OFOA 2CJFA 2V7QD 2Y66A 4R8LA 4RSGA 3B3AA 4EUFA 3TXXA 2K4MA 4US2R 5K51A 1PYGA 1X0XA 2GK7A 4IWNA 1UWKA 2X1MA 3DLIA 2G1PA 4MW6A 1ZA1A 4NOKA 3S1AA 5JAMA 4PSUA 5KTKA 4N8SA 1UL1X 1DARA 3Q8LA 2XR1A 2NUTB 1KH1A 2Y6UA 3I2IA 1VGRA 3KYJB 1CDOA 4KK3A 1V2HE 3P96A 3HDYA 1JAZA 5F1OA 4K9KA 2ZIWB 1YDMA 4PXYA 3FFBA 3HP1A 5ENDA 5A6SA 2B1RA 4U9IS 1TVEA 2FV8A 1IY0A 2VJBA 3QY0A 5JVDF 3IDOA 2G71A 1L5YA 4D8WA 3SQLA 3SDZA 4KIFA 2CHVA 2JJ2D 3T7CA 5KMGA 3MA0A 5CEJA 3MWJA 4V1CA 5EHNA 4NE7A 4JBGA 1D09A 3OUUA 3D1VA 2X4DA 4LDRA 5L3RA 2OXTA 1QRTA 5ES3A 6ABPA 4TYYA 4JENA 1U8TA 1CRLA 1GPKA 2FF7A 4WFQA 4JC0A 4FSHA 4FWBA 4MA4A 2XVAA 2JGNA 1V0JA 1ZCBA 3IQWA 4DE5A 4ER6A 2XZOA 1EHIA 2GHQA 3PF8A 4D1YA 1CR4A 3JY6A 3IP3A 1GAWA 4FLMA 4BVKA 1NZFA 1B8UA 3BHMA 4J1TC 3CLUD 4N1AA 1WDMA 4OHWA 4LF5B 3RGWS 4KGZA 4W1SA 3Q0EA 1U1EA 3HVIA 3BTUA 4NABA 3SC4A 2DYKA 2O1XA 2FI1A 4DEVA 1XRPA 2DH6A 3C8HA 1G20A 4HDKA 1OILA 1E2QA 5EXDA 3M3DA 3U4HA 4FFLA 4JYCA 4CKYA 2FYTA 4WW0A 3KSDO 3QE4A 4HMOA 3N3BC 3G68A 4OHPA 5HBRA 4PSDA 3QEMB 5I51A 1K6MA 1PF7E 4LYYA 1XPUA 3A31A 2YOFA 5C1IA 2JPDA 5JS8A 3HR8A 3JD2A 4NH0A 1PGQA 4CF3A 4CIWA 5FBQB 3WGJA 3HPRA 1N2CA 4BATA 1DIAA 1Y4SA 1C0PA 1T1SA 4OHKA 3MMZA 2IOHA 3ZCQA 4U7DA 3DR5A 4NZNA 5LD2C 3V32A 2XQVA 3PV0A 4ZO9A 4A03A 4FHFA 1CUXA 3P9XA 4OAPA 1THMA 2BLNA 2Z1MA 2WU0A 4KV7A 5AW7A 2G1UA 1PN3A 3E3OA 2J0SA 1AHIA 2VUHB 3DVRX 1W75A 2DSNA