4P33A

Crystal structure of e. coli lptb-e163q in complex with atp-sodium
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
235
structure length
235
Chain Sequence
ATLTAKNLAKAYKGRRVVEDVSLTVNSGEIVGLLGPNGAGKTTTFYMVVGIVPRDAGNIIIDDDDISLLPLHARARRGIGYLPQEASIFRRLSVYDNLMAVLQIRDDLSAEQREDRANELMEEFHIEHLRDSMGQSLSGGERRRVEIARALAANPKFILLDQPFAGVDPISVIDIKRIIEHLRDSGLGVLITDHNVRETLAVCERAYIVSQGHLIAHGTPTEILQDEHVKRVYLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Decoupling catalytic activity from biological function of the ATPase that powers lipopolysaccharide transport.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Lipopolysaccharide export system ATP-binding protein LptB
total genus 80
structure length 235
sequence length 235
chains with identical sequence B
ec nomenclature ec 3.6.3.-:
pdb deposition date 2014-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF12399 BCA_ABC_TP_C Branched-chain amino acid ATP-binding cassette transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4p33A00
4A6XA 2CL6X 1GUAA 2JA1A 2WWWA 2MMGA 4DLRA 1VECA 1MABA 1DVRA 1ODFA 2P0EA 4YXWD 3SQXA 3X1DA 3EIEA 2KBEA 1N6OA 2BV3A 1UPTA 3SR0A 2VIIA 3L0SA 4URZR 3LLMA 2FFAA 2RB4A 3FFBA 3H4MA 3MFYA 1R0YA 3A8TA 3P1JA 3P32A 2JLVA 3WYGA 3O8RA 1VG0B 5E7MA 4BPBA 2F1RA 1OIVA 1S2MA 2A9KA 4EFNA 1NMYA 3WP0A 3WRXC 3SQWA 4PC1A 2HUPA 3CZQA 3L82B 3KQHA 2IL1A 2GCOA 4E22A 3HP1A 4OHXA 4HDCA 4XD7D 5AUOB 1KO5A 1KI8A 4BZQA 1S3SA 4NP6A 2JJ8A 2X1VA 4UJ3A 2V55B 1QZXA 2XJ9A 1SULA 3GJ5A 1YZKA 4H1VA 4IHQA 1KO7A 4WZAE 1VYVA 3NWJA 4OQMA 2G0TA 2GZAA 1TAGA 4M1WA 1IN6A 5L3RA 2AHOA 3UIEA 4PHTA 2LKCA 3KQKA 1TU4A 2OEPA 3NVAA 2QQ0A 3AVXA 4CYMA 3AVYA 1R6BX 4PZZA 4ITRC 1LTQA 3W3AA 4TWZA 2J0UA 4B76A 2FFQA 5K8UA 3PEWA 1OLOA 2XXAB 1N5LA 2RGGA 4TL8A 1G7CA 4GZLA 4C0SA 4TTQA 1G3UA 4JMPA 1TUEA 4BFXA 3RNLA 1KSGA 2J87A 2BMFA 2ZE5A 1E1QD 1P75A 3C5HA 3ND9A 1A2KC 3CR8A 2HYIC 1E0JA 1NN5A 1DAHA 1E1RA 3B60A 1UM8A 3MGCA 1VYUA 1OXTA 2JLYA 5DN6D 2CHGA 3QG1A 4C0LA 4E09A 1J2JA 3WYFA 1Q44A 2ZUCA 1ZYUA 3FDIA 4DBLC 1P2UA 2ZM5A 1M34E 3I4LA 2FZ4A 1WXQA 4YONB 4ZIRA 5SZKB 3SOPA 3L0IB 3IPYA 4TMXA 3A37A 1E0KA 2IYUA 4NZYA 3KXIA 3RLFA 4C9BA 3GJ6A 5BN4A 3PIRA 1YE8A 1NJGA 2ORIA 4B74A 4TYYA 3RS0A 5JEEA 5L3SA 1KIMA 3NBFA 2QZ4A 3E1SA 3EXAA 2NOAA 2OFWA 1E2HA 4NHOA 1OFTA 2GAOA 2GJSA 3JZAA 3PUYA 1Z6AA 5EE9A 2QE7A 1OYWA 1MV5A 3KJGA 3LD9A 5B30A 4R7ZA 2DCUA 1ZMXA 2IYLD 2ZRNA 2V9PA 2R6DA 1G8PA 1ZUIA 3VR4A 4MRSA 1JR3A 2FFHA 2ZSDA 1XTQA 1XEFA 4RZUA 1FZQA 4ZPXA 1FTNA 4A15A 3HPQA 1DARA 1K8RA 1I4TD 1Z0IA 3KXLA 4DLUA 3KJHA 3T15A 4DCNA 1RVDA 2PCLA 1GVNB 3CNOA 5G53C 1LF5A 3TKLA 3EG5A 4LHYA 2W6JD 1LFDB 3KTAA 1XBTA 3SHWA 4OK5A 1OIXA 4JVSB 2AKYA 2REBA 3IKJA 4Z51A 2ZYUX 1S3GA 3KUDA 1UKZA 2WJGA 4JS0A 3OFNA 3GEHA 4I1UA 2B8WA 5ELXA 5F3WB 4KSCA 3OFND 1HYQA 1KHTA 1ZUNB 5CB6A 2N1BA 4LV8B 1T0JB 1TPZA 3JZMA 4K46A 4Z1MA 3FKQA 2W6JA 2F1JA 721PA 3LH5A 4TMKA 1DE0A 4OBEA 3WY9A 4BEBA 2QAGA 1LNZA 1G7SA 4HLQB 2RH5A 2QT0A 5D3MA 1JB1A 4ON9A 4EPRA 5CIQA 1TF5A 4WIAA 3T1OA 2H8KA 3R9IA 1XEWY 4M9ZA 3K0FB 2ZSFA 3QG5A 5F98A 2YZ2A 2QUZA 1HEIA 3KB1A 1N6KA 1AS3A 2E1RA 4NCKA 5HPYB 2Z4SA 3K53A 2J41A 4DCUA 1LF0A 1P9WA 1WP9A 1KK1A 3BH6A 5IF9A 4ZDIA 2B8TA 4FMCF 3N70A 4OQXA 1Q20A 3SZRA 2P3SA 1I2DA 1N6PA 4X8MA 3KZ1E 4K8OA 1XXHB 2I3BA 1W0KD 1OV4A 2D4HA 1KO1A 1X8LA 4TLBA 3SJAA 3AGQA 1MABB 1W4CA 2ZQ5A 1X86B 5KUTA 1FW6A 2A2ZA 4I1SA 4CEJB 1IAQA 4OI0A 3EX7C 2HXYA 1UDWA 3UWOA 4IVRA 3SC3A 4H9GA 5FUYA 3TQCA 1G3RA 4DDUA 1X8KA 1T5LA 3BAFA 4LBVA 5HZKA 5FR1A 1GRNA 1KI4A 1TNDA 3EA5A 4RD3A 1OH5A 3CZPA 4P31A 3MJHA 5KSOA 4KYUA 1PLKA 2R6GA 4RZXA 1F2UA 3B1WA 4OQNA 1TF7A 3UPUA 4IRUB 4UNRA 1OE0A 4L5BA 1Z0KA 2F55A 2CHQA 2WWXA 2B7CA 2OZEA 4TSFD 1WCV1 1T3SA 3GMTA 4Q7LA 4Q4HB 3BK7A 2C78A 4FMDF 3ZVRA 1XD2A 2OLJA 4LOAA 4Q03A 3GLFB 4TQUS 2CNWD 3ZDQA 2OSBA 1AQYA 1R5OA 4V03A 2KJQA 2JASA 1Z8FA 4JVNA 5B57C 2F9MA 1XP8A 4FD2A 1Q3HA 3NH6A 3TW4A 1SVKA 2O52A 3ZQJA 3UG6A 1W44A 1U94A 1TQDA 1JR6A 3MWLA 3W34A 4K81B 1SXJC 4QGHA 5EP1A 1P3JA 4G0NA 3TH5A 1E2GA 1Z0FA 2FF7A 4TMVA 2GJAA 2FWRA 4Z8YA 4PQFA 5EZ5A 3T34A 3WHLA 2NGRA 1HT1E 4PQRA 2WWYA 1ZU5A 621PA 2J59A 4HB3A 2JIZD 2C03A 4HZUB 3VR1A 1QF9A 3ADCA 4B3XA 1NP6A 3OEHD 3FWYA 3RS4A 3CNNA 3K09C 4FCTA 4EQ6B 2XZPA 3R9WA 1FP7A 2ZRHA 2PZGA 2OXRA 5JRJA 1YR9A 1NLFA 2ZRAA 3LW7A 1OYYA 2H17A 4TLEA 5C46F 4JLPA 4BLOA 4Q9KA 1XTKA 2QSYA 4KSBA 4B47A 5HCIA 1ZCBA 2IHBA 4I4LA 5J4LA 1N6HA 3EZ6A 5JJIA 1G17A 1G1MA 1QHNA 3DVLA 4UQOA 4WA7A 4IFEA 4IOMA 3M6AA 3C16C 4Q9IA 2CXXA 1KI1A 1LVGA 2HDNB 1Z0DA 3DOEA 3GD7A 1YRBA 5EXSA 2IUSA 1VHLA 1ZC4A 3DZ8A 1XPUA 4KI0A 2R65A 5EXXA 3AVWA 1NMZA 4BFWA 2BKUA 2QMEA 4RD6A 1L4UA 1MO3A 1J90A 3RS3A 3REFA 2GCPA 3FYHA 2RCNA 2H1LA 1NBMA 4WXRA 3R7WA 4HAUA 4HSEA 1K5GA 4DSNA 2F43A 5FBWB 4MYHA 3SNHA 4BUJA 4W5JA 3SI7A 3ONWA 1XF9A 3AVTA 3OIUA 1KAGA 2FX3A 4KVGA 2F1HA 1W36C 5FOWA 1E98A 1NRJB 4WBSA 2ZI6A 4GP7A 2O8FA 4QBGB 2IXGA 2ZJAA 2A30A 3PCRB 1QHHB 4HDOB 1M7HA 3ZS9A 4MGYR 4C7OA 1XZPA 2A5GA 3GLIB 1JNYA 2XNDD 2WIBA 4LDJA 1W36D 3GEEA 2PLRA 1U0JA 5JSZA 2AX4A 2IYZA 4G5QA 4A8JB 1W4AA 3OF5A 4D0GA 5JBQA 1JBKA 3RSLA 3ZVMA 1F48A 1A82A 1R7RA 1PUJA 3A1TA 1DADA 4BASA 4DLWA 1ZRHA 3CX7A 4C0BA 3EARA 4NCNA 5DSZA 1SXJE 2GCNA 1F6BA 4DDWA 1Z83A 5DHAA 2RGDA 4HATA 4BFTA 4QBIA 4O2RA 3I1FA 4JLKA 4LC0A 3HJNA 4Q01A 5CJ2A 3HPRA 4Q4LA 5E95A 5J40A 4TTRA 4E07A 1XXHA 3E2IA 4MYCA 4GPTA 2JEOA 4M1TA 1AJEA 2QE7D 4B48A 4MDEA 3QKUA 2J0SA 5EP3A 4OL0A 2G1KA 3BXZA 4URWR 1G4AE 2BKEA 2CBZA 4CT4B 5BW8A 5JCPA 4RD1A 2VHJA 1EWQA 2YNMA 1HQYE 4TN1A 1P5ZB 4A0HA 2YOGA 5FL3A 4X8OA 1RKBA 4RCZA 4ZCIA 2G3YA 5A0FA 2ZIAA 1OFIA 3VU9A 4B2LA 4M22A 4B6FA 3FOZA 2EVWX 2Q9AA 1E3MA 3CWZA 3LX5A 1T8TA 3GLGE 5CJPA 3WBKA 4DEYA 1OFHA 2DBYA 1IN8A 3HYRA 3QPUA 4LYHA 2QTFA 1CR0A 3P4XA 4JLBA 4YMVA 2D7DA 1MO4A 3PUWA 3EPKA 2QAJA 3ASYA 1PLLA 3CRMA 2C2HA 4DHEA 4ASUA 4QG7A 2CK3A 5KDLA 1Z22A 3FE2A 2GEUA 4DVGA 4ZI3A 2FSFA 1KNXA 1GIAA 1SGWA 2VP0A 2ZRCA 3AP1A 3IEUA 2OBNA 3FKSD 1NVXQ 3QUSA 2P5SA 3W90A 3AP2A 4EJSC 1VG9B 1XD2B 521PA 5CM8B 5GVSA 3NIBA 2R6FA 3NKVA 1KKMA 4GOJA 3WNDA 2ZRMA 4L9SA 3ZVNA 4JLVA 3VQTA 5L3SB 3PVSA 3TK1A 2ZYTX 2EFEB 1NI3A 4Q5IA 1CJTC 4TTPA 1OH6A 1OB2A 4NCIA 1J99A 1SVMA 4F93B 3CPJB 4LYJA 3U5ZB 1TU3A 5C18A 3BB3A 2OG2A 4GOXA 2GHIA 1W0KA 5AJYA 3BD9A 2XZLA 1W4BA 1DO0A 1I2MA 4PXAA 1VYTA 3UG7A 5FOXA 1XTJA 3CRVA 4A2PA 3TNFA 1X6VA 3TSZA 2V7QA 3V9PA 4Q7MB 4JJZA 3A4MA 1ESMA 2QT1A 2I1VB 3BORA 1T3LA 4RSGA 2WMNB 2WICA 3MWJA 4CEHB 4S35A 1G8HA 1BKDR 2E87A 4DSTA 4DCVA 4XD7A 4OJKA 2V3CC 4B2PA 1U81A 1ZD8A 1PLJA 1BO6A 1G8FA 4JBYA 1JAHA 4MITA 2PJRA 2OLKA 4EFMA 4Q21A 4EKDA 1D2MA 2WMOB 2J0QA 5TDHA 1WRBA 2J7KA 1FTSA 3OZXA 1EFCA 3GJ4A 3KKQA 5CK5A 1NNEA 4IVPA 5E3HA 1JQLB 2OFOA 4OYHA 2OXCA 3NBXX 3SJZA 5JRZA 3WYAA 1NIPA 5JCZA 4NE2A 3CPHA 4EFLA 3E5HA 3OHMA 2CL0X 2QM8A 4ZKEA 2EU8A 4PC7A 5KPJA 1W0JD 3GLHB 1Z6XA 4R98A 1EX6A 2C96A 2WKRA 5TXGA 4URXR 1JPNA 2BJVA 4QC2A 1QG4A 2CCKA 2XEXA 4Q4AA 3U61B 1ONBA 2C99A 2FEOA 3GFOA 3X1XA 1C9KA 5CLQA 1SKYB 3Q7QA 1N0VC 5IK2A 3KX2A 1XB2A 1XNJA 3BFXA 3B85A 1X3SA 2EFHB 4FINA 2GXUA 4KFSA 3ADBA 3FFAA 1YZLA 2L0XA 1GKUB 2XNSA 2FJUA 2JLWA 3KXKA 2F1IA 3CF0A 2HEIA 4QRHA 1GP2A 4U00A 3ZIAA 3NXSA 3K9NA 2FGKA 4PPQA 4IOJA 3TUZC 3GLHE 1KK2A 1WA5A 3C5CA 3F8TA 4KV9A 2XB4A 2EYQA 3DPUA 1E79D 2FA9A 4NL4H 4NH0A 4B43A 3AVQA 3TAUA 3VR6A 2WWIA 1EFUA 2IHYA 4AKEA 3LQRA 3TSOA 3LV8A 4RCYA 2AN9A 3CR7A 3AGPA 3OEEA 2PX3A 3ZYCA 4X8LA 2J0VA 4BFZA 4RFVA 2GEVA 2C04A 4RJLA 4D0LB 1XTRA 1EX7A 1Z6TA 4NYMQ 1AA9A 3CKLA 2XTNA 2BVNA 2V1UA 1DAIA 2VP4A 1CBUA 3BH0A 4PANA 3ZZ0A 3FGNA 4QKQA 3RHFA 1F5NA 2FH5B 3X1WA 1RYFA 1YZTA 2ZS7A 1XCMA 4TL6A 2CJWA 1H8HD 1LV7A 2LWIA 2G1JA 4GT1A 4IDOA 3VKWA 2WJYA 1U90A 1E2DA 3CH5A 1XEXA 821PA 2VHTA 4ZCLA 3WBJA 1KOFA 5FUXA 2JJ2A 3K0SA 5AJZA 1Z2AA 2JDID 1I4DD 3X1ZA 4F38A 3TQFA 4A0FA 4ABYA 3QKSB 3X2SA 1NLYA 3BC1A 3CRQA 3NC0C 3ZD6A 3EWAA 3VAAA 4LZZA 4DIDA 4GMDA 2ZSBA 4B3DA 2GDJA 4TLDA 4DB4A 3BWDD 1GZSA 1GNQA 3N2EA 4WW0A 5DI3A 2IUUA 5KNDA 2O5VA 1F2TA 3PENA 2QPTA 1E32A 4D4KA 2FFBA 3LBIA 3QIAA 1W5SA 4DRZA 5CDFE 2J7PA 4DWJA 2B6HA 2ZRJA 4Q9JA 2WV9A 3WXMA 1P4SA 1NLZA 2GK7A 2PLFA 3GLFA 4KCGA 4DLYA 2Q3FA 4I1VA 4LYFA 3FHCB 4QHYA 5GJVC 1P60A 2A5DA 4I1OA 4XTCS 5FOSA 1JPJA 4CDGA 1Z29A 5EJEA 1IY2A 4NYIQ 4M2LA 2FU5C 1L4YA 4DDVA 3AVVA 1E6CA 1CEEA 1AS2A 4HYYA 4LX0A 4BECA 3K70D 3CBQA 2IW3A 3HU3A 4D80A 2WZQA 3M0EA 1ZU4A 1XEWX 4CEIB 2KSQA 1W4RA 1G8YA 1UADA 2H7VA 1U0LA 3KUCA 1PZNA 4Q00A 1G19A 1VHTA 4Q02A 4JJKA 2CNWA 4QJ3A 2A3RA 3EIQA 5IT5A 5DHFA 5TB5A 2BMJA 4CRWB 1RRFA 2WOJA 4GL2A 3B5JA 2AD5A 2JDIA 5FFMA 4ARZB 4BQSA 4NYJR 2OFXA 1QHGA 2ZAMA 5CYOA 1M2OB 2ZI7A 3B13B 2O8EB 1GL6A 3LAWA 3AQ4A 2WIAA 3CRRA 4I81A 1XJCA 2ZI9A 4ASUD 3ZLJA 4PSKA 5LPNA 1JXOA 2LKDA 4CGZA 1AZTA 1KSFX 4HB2A 4US2R 5LB4A 4P3YA 3T1QA 2GF9A 2YC2C 5FPSA 1RE0A 4PHFA 4Z54A 5HR5A 4ZCMA 4V0NA 4BZPA 2CE7A 1Z6GA 4C0KA 3DM9B 3CWQA 2Q0HA 3AKEA 2VP2A 4HB4A 3OEED 4S2EA 3JVUA 5D3MB 2GETA 1CJMA 1RFLA 3IO5A 1CXZA 3DDCA 3NTUA 4PPGA 4RD2A 2RGNC 5JS7A 3BOSA 3HDTA 4GDFA 4PHGA 1KSJA 3PUZA 1OH7A 2VYFA 3L43A 3LA6A 4DLZA 3U4QB 3CH4B 3HWSA 3NHBA 5LBIA 3BGWA 2YJTD 3T06B 3TMKA 3D6TB 4NKRA 1JR3E 1UBGA 2DWOA 2RGEA 2EWVA 3C7KA 1LS6A 1ZIOA 6Q21A 2KWIA 1MH1A 1E2QA 1OFUX 4G5OA 5KSPA 1S0UA 3W6OA 2QAGC 4RD4A 1G41A 2ZITA 4TQAA 5JWRA 3QVUA 1TMKA 2GKSA 2CL7X 3CO5A 5JWOA 5JJKA 3C4JA 5KDOA 1JJVA 2CDNA 5B64A 2FEMA 3FMIA 4JBXA 2VRWA 1ZD1A 3HYTA 2KB0A 4Q9HA 4XH9B 4IXMA 2ORVA 2WSSD 1E9CA 5G41A 4ZV4A 3QBVA 4Q4AB 2WSSA 2C9CA 1ZM3A 4IDNA 3F3YA 1H8HA 3IIJA 3GJXC 4YC7A 1NSTA 4BLPA 1KO4A 1QVRA 1P62B 3G5UA 1FQJA 3K70C 3OE7D 1W5TA 4BLSA 3EAQA 1O3YA 1Z63A 1E2JA 4YDSA 4QGGA 4MUBA 4TYQA 1BOFA 3LBHA 4PFSA 1DPFA 2Q6TA 3EC2A 1PVOA 3W3ZB 3VNUA 2G77B 4D4MA 4BWYA 1VCMA 3NH9A 4NTZA 4D0NA 1QG2A 2EQBA 1E9RA 2GRJA 5DI9A 2ZJOA 3U7EB 4AG5A 4EPWA 1YZGA 1ZM4A 3QY0A 4EIWA 3T35A 2FPLA 1II0A 2O8CA 1VTKA 2Q3MA 4UNQA 3RDPA 4ESVA 2PEZA 1EGAA 1S1MA 2W58A 2YINC 3DZDA 4FWIB 4XSGA 1DAMA 4IEIA 3RABA 1VG8A 3GJ3A 4QHSA 3FB4A 2V7QD 3GEIA 4G01B 1XD9A 2ZETA 3RWMB 1XJQA 2BBWA 2VA8A 2ZI4A 1NSFA 4LSGA 2RHMA 4UNNA 3U6BA 2BIFA 4F4IA 2FZLA 1GILA 3OIVA 1E2KA 4F7WA 2ZJ8A 3LX8A 5KO2A 5GJCA 2FG5A 2XOKD 2VL7A 3H0KA 2XSZD 2DFNA 1G6HA 2BCJQ 1DOAA 1OHHD 3MSXA 1Q22A 5FPHA 4I99A 1E2IA 1U2RA 5AUNB 1J8YF 5DISB 3VMFA 1TQ4A 4IOLA 4V0OA 4RKEA 5BWMA 4DUGD 5IK2D 2BDTA 3CM0A 4Q48A 2HXSA 3TR5A 2FV8A 3ZZUA 2GXAA 4B3GA 1TL7C 1PV4A 1QHIA 1OW3B 3AF1A 2P5TB 1XMIA 3X1YA 4B33A 3T5DA 4WZBE 4B73A 1OSNA 1R2QA 3IBYA 1F2TB 3PUXA 4QM6A 2YV5A 5EE1A 2SHKA 1EFHA 5EZ6B 1NY5A 3PXGA 4Q1FA 1KNQA 2CLCX 3RSOA 2NO9A 4AYXA 5KU1A 2BC9A 2HF9A 2IYQA 2JLRA 4G3XA 4DT1B 1NVUQ 3UXMA 1MT0A 4HZIA 3PG5A 8OHMA 4PSVA 3CRW1 2JIZA 5DI3B 3SU8A 1WBBA 3TVDA 1VCIA 2UZIR 4BRUA 3QOFA 1P7CA 1ZUHA 2JJ1D 5BQ5A 2Z43A 3WMGA 2GJKA 3LXXA 2VSXA 1DO2A 1Z0AA 2QL6A 4Q1EA 3P26A 4TZ6A 1HY3A 2RGCA 1Y3AA 4QOSA 1MRNA 3DEFA 4FW9A 1ZW6A 2QPOA 5ANRB 1V43A 2AXNA 3DKVA 4IOKA 2GJ9A 5FI0B 4AK9A 2R8RA 1JEDA 1SQ5A 2VLIA 2O8EA 2ZJBA 1XMJA 2F43B 3NBYC 1YU9A 4CEIA 1G20E 3P27A 4A36A 4D82A 1M8PA 2OAQ1 3BH7A 3R20A 1YHNA 3BFVA 3U7GA 4GZMA 4Q19A 5EE0A 4IDPA 3LNCA 3O8DA 3BE4A 4A4DA 4NYJQ 1U9IC 2VF8A 2D06A 5KDDA 2V4ZA 4P4TA 3WNCA 5HKKD 4U5XA 4FMBB 2PJZA 4MDFA 1NKSA 1Q3TA 2YWFA 3N2IA 3SHFA 4XSHA 4CW7A 2DB3A 4BFVA 4UKDA 1P9RA 3MUFA 3ZH9B 2XITA 4TMWA 1L2TA 2IEZA 3ZD7A 3GLHA 2VH5R 1DAFA 3EC1A 1E2FA 3RRYA 2QBYB 1S1CA 4UJ5A 1KDOA 4CF7A 3SYKA 4BLTA 1GKIA 2BMEA 4LGMA 4XWAA 5LDDC 3THXA 4HAWA 3H1TA 1KDTA 3B82A 1ZJ6A 4MRVA 1W7AA 1EESA 3QXCA 5FBLB 1CF4A 3THYA 2AFHE 1FQKA 2O8DB 2JCSA 3QKTA 3T61A 4LJ7A 3RRMA 4KFTA 3A58B 4DSOA 1Z06A 4BGDA 2MSCB 2ZR7A 4D26A 1E9EA 1KGDA 1KK0A 1GKYA 2NO0A 3WP1B 4LRWA 5GJWC 4N0EA 3UKDA 2VP9A 1OJLA 4M8NE 4TYPA 3VHLB 2XGJA 4P4SB 2QY9A 1MRSA 1K6MA 2BM1A 2G9NA 4DSUA 3AKDA 3EIHA 4II7A 3LBNA 1AKEA 3V00A 4U7DA 1OXXK 1GG2A 5KPDA 2YHSA 3U44B 3VTKA 3VX4A 1H65A 1XEXB 4Q1BA 3VNVA 5TMPA 1DBSA 3NDPA 3SBDA 3SE0A 2DY1A 4Q1CA 4YDHB 4TYNA 5EUMA 5E7IA 3A1UA 4OI4A 4KHZA 1BH2A 2VHQA 3MWKA 1W0JA 1J7KA 1SXJA 3AF2A 4AG6A 4URUR 1LY1A 3OAAA 4DDTA 3U6KA 3ICQB 2XNDA 1P72A 1QVAA 2CJWB 4AC9A 2JAQA 5FOTA 2IYYA 3PEYA 2YOHA 2ZS8A 1UFQA 1Z2CA 2FGJA 1DAGA 1WMSA 1WDTA 3K0CA 5JWHA 2P6UA 4LBYA 5K8LA 1AGPA 1SVWA 2QMOA 2ZSEA 4YMUA 3UMRA 2DYKA 1OXUA 4AKHA 5EE5B 3TJZA 1W47A 1R5NA 2J5XA 4MGKR 4M0LA 4XJXA 1Q1BA 4PX9A 1IJFA 3EA0A 3B8HA 4W9MC 5LD2B 1IN5A 1PUIA 4UNSA 3U2QA 2ERYA 3AUXA 2PT5A 2JGNA 5DIFA 3O47A 4D25A 2O0HA 1C4OA 4PTLA 3D31A 4A2QA 1TX4B 1KI7A 2J0UB 2O8BA 2HT6A 1IY1A 2IS1A 4XVRA 2IT1A 1VIYA 4A9AA 4IXNA 2F3RA 3GCGA 5DLQC 1KTVA 1B0UA 2JLUA 1NBMD 3W5JA 5BYKA 5AUQA 2W2TA 1FMLA 1NBME 1XWIA 2F3TA 1R8SA 2KE5A 2PL3A 4NBSA 2W6ID 1ZM9A 2BCGY 2WOOA 1GWNA 4ACAA 4EJSB 4URVR 2WJIA 1U99A 3B7GA 4FMDB 4D4JA 3C15C 3IEVA 3RVBA 2ODEA 4AI6A 4YMSA 1W49A 4XVUA 1XZQA 2JJ2D 3K9GA 3RS5A 3TUJC 1N5KA 4B35A 4LV5B 1FUUA 2ZU0C 1L7VC 3L8YA 2QTHA 5BXQC 3QEOA 3DMNA 4B3FX 2WWHA 2XJ4A 4QHTA 4JSYA 2A5FA 1EWRA 4Q4HA 5AJWA 3D7MA 1UEIA 3REGA 2ODBA 3QF7A 3KKMA 4YMTA 4OQLA 2PMKA 2GILA 2IC5A 2RGBA 3U3JA 2D2FA 1X1RA 1US8A 2CMKA 4W5HA 2XX3A 2WM9B 2ZRPA 2O0KA 2TMKA 2ZJ5A 4B6EA 4M21A 4NCJA 5FOVA 2Z5FA 2MMCA 4V0LA 1T4GA 3LRPA 2WPDA 4Q1AA 1AKYA 4HUQB 4TMTA 3SYNA 5HZHA 1NL3A 2GNOA 5JLJA 2QEQA 3TBKA 2CE2X 3LW8A 3MD0A 4DLSA 2RMKA 3B1YA 4O0MA 1D8TA 1T9HA 3QPWA 3QPVA 4RY2A 1S96A 2WWGA 1KKLA 3BFKA 4KVAA 4OI1A 2YVUA 3KJIA 5DH9A 4IW3B 4OK3A 2B92A 5D3QA 1DELA 1M74A 2ANBA 3FTQA 3QEJA 4Q47A 4IJMA 4BE7B 1E2LA 4DJTA 3QSYA 2FN4A 2J46A 5KYKA 2IBMA 3C41J 1QRAA 1JECA 1VCOA 2A5YB 3KFXA 3TRFA 4EPTA 3THWA 2YC4C 1GL9B 2QRZA 1RYHA 3RAPR 5AJXA 5G40A 3IUYA 4JKYA 3FMFA 2JATA 4C30A 2WKPA 2BWJA 4QGAA 4C2UA 1ELOA 1ZD9A 1RW4A 1G7TA 1N3BA 3F0TA 5LB2A 3WRYC 4DCSA 1L8QA 2F7SA 2R6AA 3QKRA 4Q9LA 1PJRA 4QXAA 1ZCAA 3KKOA 4B3BA 2R44A 4F4JA 3K8YA 3LDAA 1W2GA 3OIWA 5HCNA 1CJVC 3MRSA 1NVVR 3OAAD 4WVFA 1AM4D 1Q1ZA 1YQTA 5JEDA 1A4RA 3EZFA 1N2CE 2IYVA 2QMUA 4JLMA 4DUGA 3AM1A 1Z47A 4B34A 2Q9CA 4LHXA 4PAQA 4P0TA 2G83A 1DAKA 2LCFA 1M1YE 1TQ2A 3H2YA 4TT3D 3THYB 4LJ4A 3WMFA 2XSZA 2NO7A 3IPXA 5J4HA 1ZM2A 1TTTA 5L3QB 2ZRLA 1U9IA 4C0QC 3VHXA 1BMFA 3BJIC 1N6NA 2OILA 2ZROA 4PO9A 3R7WB 1COWD 4RZ2A 5H1YA 3NDBB 3U3MA 3NEJA 1Z08A 3MWYW 3CF2A 1CULC 3L0PA 4FCVA 5EP4A 4WAUA 1BIFA 2ZUDA 3ZIAD 1NN1A 2O8CB 1E79A 4HLUC 1BMFD 5FTKA 2ZU6A 3TSWA 1QBKC 1E9FA 4FMCB 4W7SA 1KO8A 2R6CA 2IXFA 4FI3C 2Z83A 3H86A 4TL9A 4RKFA 4OQFA 1YR7A 4OJQA 1XCPA 4EAQA 2VP5A 3B78A 3UK6A 2F9LA 2X19A 1HT2E 1QHHA 3I3SR 4LJ8A 4R71A 1NG1A 4HB0A 5LD2C 1E0AA 3K09A 2ZYVX 5FUVA 2H5EA 2P2LA 1RRCA 1KAOA 2P67A 3K70B 1UAAA 2OESA 5CM9C 2ONKA 4DLTA 2IS2A 3LVQE 2YWGA 4MQBA 4YMWA 1T5IA 4A6PA 2YYZA 4KBGA 1OB5A 3KJEA 5C2JB 1P61B 3OIYA 1E9DA 1WF3A 4AYWA 3VR2A 4MUAA 3IHLA 4ESHA 1WQ1R 2Z6VA 3VKHA 2ZUBA 1TEXA 4ERNA 3G82C 2IYWA 2G6BA 4CZ2A 1WE2A 3IQWA 2QRNA 4V0KA 4C2TA 2W00A 3U60B 4PC6A 2ZEJA 1A7JA 1T91A 2OBMA 2GF0A 1NIJA 1P2SA 2C98A 4DIEA 2P6RA 3KKNA 5FTNA 1LS1A 5EP2A 5FH9A 2D2EA 2CVFA 4G1UC 4MYUA 2NPFA 5H70A 1HE8B 2MSEB 4JLJA 2BM0A 4A1FA 4DT1A 3GP8A 4JIMA 4PZLA 4URYR 4PPNA 1KSHA 5CDFA 1T3HA 4ZDJA 3ADKA 4MRNA 3VFDA 3UANA 1FFHA 4MRPA 4HZUA 1NVWQ 4Q1DA 5F9HA 1TF2A 3EWSA 1U8YA 2HLDA 1XU4A 2HJVA 4LV6A 4LJ6A 4MYTA 1BS1A 4ZKDA 1ESNA 1ZAKA 4HLUA 4Q7KA 3QNUA 1D2NA 2WPDD 2J7PD 1N6IA 5K8TA 3OESA 2CHVA 3S1AB 2X8AA 1G5PA 2B7BA 1D5CA 3GLFE 3MJRA 4DEXA 4MGZR 3U4QA 1JAIA 3B1XA 3Q85A 5TV2A 3PUVA 1VIAA 4GSYA 3IHWA 4HUTA 4IEEA 3KB2A 4P33A 4AURA 2QBYA 3EPHA 2N42A 1N0UA 4ACBA 5CB8A 2IS4A 1KI6A 1J8MF 1KY3A 1Q1EA 2O0JA 2OO7A 2BJWA 1KDRA 4Z8XA 5DYGA 4PZYA 5FPTA 2YWHA 3BBPA 1X1SA 2ZYWX 3AKCA 1E1QA 2WAXA 1GFIA 1UBCA 4HUQA 4BLRA 2AXPA 2GA8A 2YWEA 5FBRB 4LJYA 3LQQA 4KLZA 4QGFA 4TZ0A 2V54A 3MMPA 2WKQA 1XDBA 5C4MA 3EZ9A 4YQFA 3TE6A 3CF6R 2IS6A 2Q9BA 1XMSA 1VDZA 4RFSB 1T6NA 2XAUA 3AP3A 3V4FA 3UWKA 1S8FA 4Q7JB 1YJ5A 3SDZA 3QENA 4HAYA 4JT4A 5JMTA 4JLAA 1CR2A 3C14C 3GJ8A 4LC1A 5JI2E 4E5UA 3THXB 4Q18A 2F6RA 1U98A 3AF0A 3HR8A 5AUPB 4R9UC 2QA5A 2DFTA 3THWB 2AK3A 1NN0A 3RS7A 4KLNA 3DO6A 3FPAA 1EG7A 1XD8A 2VO1A 4QNMA 3CX6A 1T0HB 2X2FA 2RGNA 4GI7A 4LHVA 2Q21A 1CU1A 3SJBA 4BFUA 5JS8A 4V0MA 4FXPA 4C0HA 3A1WA 2IWRA 3GLIA 5FPYA 5B58C 3BS4A 3BRWD 2VEDA 4JT2A 2ZRKA 3I8SA 2GXQA 3MG9A 4UNPA 4C0JA 2VTKA 1H8ED 3AF4A 3DOFA 4TT3A 3DHWC 3J81k 5J5CA 2GEDA 1II8B 1A1VA 4DXAA 1UBEA 4AD8A 3KFVA 1M6NA 4MGIR 1GTVA 5CIWA 2QSZA 3TUIC 1E4VA 2ORWA 1AIPA 4LBWA 4XWKA 1VPLA 1HV8A 4KXFB 3W8RA 1HQCA 4AIIA 3CONA 1FNMA 3OE7A 1OXVA 3PR1A 1R0ZA 1XMVA 1G7RA 2J3EA 3SN6A 2NG1A 3T5GA 4EPYA 5FL7A 3AVUA 4QM7A 3IO3A 2QQEA 3CNLA 3GFTA 3R8FA 1R8QA 3CPEA 4Q4JA 2HV8A 4HEJA 5FBVB 1UDXA 4QJ4A 4BRWA 2MSDB 2WAYA 2P6NA 2YKGA 3V4RA 3BB4A 3FVQA 1F2UB 2ZRDA 1SXJD 5DE3A 4R2HA 1YZQA 4W5WA 3QVVA 1P9NA 4C4PA 2J1LA 5EXPA 3VX3A 2IUTA 4CVNA 4C7OB 1NY6A 2QM7A 5M04A 4UXIA 3K1JA 1G6OA 1IM2A 1IONA 1U0HC 4HAXA 1D2EA 1IXSB 4A8JC 3DM5A 4JYCA 4EUNA 3D8BA 1AS0A 1Z3IX 2RAPA 1H8EA 4RZ3A 4A8JA 4B2IA 2AK2A 3QJYA 1RRGA 1D6JA 3PFIA 4M1MA 1Q12A 2VSFA 1IOZA 4HI0E 5JZVA 1IN4A 4LJ5A 1TQ6A 2NZJA 1KMHB 4AWXA 3LWNA 1AK2A 2VP6A 4O25A 2ZXUA 1CIPA 1E2PA 1G3MA 2HCJB 2IXEA 4KO8A 3I61A 4OHVA 5IRCD 2B21A 2R2AA 1W36B 2IA5A 1XTSA 1IXRC 3NEYA 1XTIA 2OCYC 3O8BA 3PITA 1QHYA 5FI1B 2C77A 3W9YA 2BBOA 4A2WA 4JKIA 3WMEA 4G5GA 1C1YA 4FIDA 3MLEA 4TLCA 3U3OA 4L9WA 4LJ9A 4GFDA 4OHZA 1AZSC 1MO6A 1ZM7A 1SVIA 4HLDA 5AK0A 1ZIPA 3GPLA 3P20A 4QBFA 2ZRIA 5FTLA 2OAP1 1Q57A 3T1VA 4M9XA 2IX3A 1ZNWA 1X8JA 3K9HA 3SS8A 2W0SA 4QL3A 3T12A 3BIFA 1XX6A 3B2EA 1VG1A 1BYIA 3EZ2A 1U8AA 1E1RD 2AD1A 5DO9A 2A5JA 5FPKA 4IKEA 3Q5DA 3TVTA 3VU9B 4UXHA 1MOZA 1M7GA 1CS4C 2OCAA 1KZ7B 3ICEA 4DKXA 2GZHA 4IDHA 4V0ME 2BEJA 4ZI2A 3ASZA 3QKSA 1G18A 3ZVLA 4JBWA 4LPSA 1W48A 1XXHE 4TL7A 4FCWA 1ZNZA 2QP9X 3GLGB 1IHUA 2PX0A 1G4UR 1Z28A 2UKDA 4POAA 1TADA 2ZVPX 2A7QA 1GNRA 1MKYA 1OHHA 3QXJA 4IDQA 2GBLA 1NJFA 1RZ3A 2ZRFA 1UEJA 2EFDB 2IYTA 1G16A 3IIMA 4JLDA 1II9A 4G5SA 2GTPA 3QXXA 1G5TA 1N6LA 1XCGB 2YOFA 3I92A 5C1BA 1QDEA 4LY6A 4C3ZA 2O8DA 4ZO4A 1N5IA 2EWWA 2CCJA 1US8B 3Q5EA 4N3NA 3GJ0A 4UXJA 2XTZA 4NDZA 4F92B 2JJ1A 1KZGB 3EASA 2AL7A 5B2ZA 1D9ZA 4F91B 1KJYA 2GWHA 4MRRA 4NPHA 1EFTA 2IYRA 3ETLA 2FNAA 2GAAA 1KI2A 3N5CA 2BBSA 3I8XA 5G3ZA 1NKTA 1CLUA 1HTWA 4BZXA 2R9VA 3Q7PA 2GVZC 1EFRA 4XOIA 3B9PA 3K0EA 4D6PA 2REXB 1A5TA 4AKGA 3IDQA 1ETUA 4CEHA 1JJ7A 4XTRA 3W5IA 2QORA 121PA 2ZVQX 4XVQA 2P65A 4B71A 1A2BA 1IBRA 2ODNA 2D3WA 4AYTA 4MH0R 1EK0A 3QF4B 5DNYB 1DG3A 1SVLA 1Q21A 1S4QA 3DKPA 4ILEA 2FDCA 2PBRA 4ZIRB 3AV0B 4GNKA 2FSHA 3FMPB 1NN3A 5J47A 5FL7D 1JEEA 1G21E 1NVVQ 1Z5ZA 3C8UA 2H18A 1JR3D 3AH8A 4A92A 4A0RA 5EQTA 4KBFA 1IJEA 3THOA 1KI3A 2IK8A 5FTMA 3K0AA 5TY0A 3AVOA 4EPVA 4HAVA 1CP2A 2VF7A 4KAXA 1E9SA 1GAJA 3KDSE 1NG9A 2NQ2C 2PEYA 5AR1A 3TR0A 2ZRGA 3W8NA 3HR7A 1CR1A 1COWA 1YR8A 1OH8A 4QBHA 3RC3A 2ZI5A 1GRRA 4JL8A 4WXPA 5CITA 1FMJA 1RRPA 3U3RA 5KHOC 2O8BB 4LHZA 3TIFA 5AWFC 5J4KA 2QGNA 3R8CA 5L3QA 1JXMA 3SEAA 2QMHA 1DS6A 2CCGA 2CLDX 2ZE6A 4M1OA 4TLAA 2WHXA 1CRQA 2QTVB 4NYMR 1GSIA 1UKYA 3NHAA 4LBZA 1SZPA 3KTAB 2JLZA 2ZSAA 1N5JA 3K9LA 2FOLA 3CUEF 3ADDA 4KFRA 2NO6A 3A4LA 3ECCA 3A6PC 5DN6A 2I4IA 2IWHA 5A4JA 4ZDKA 3I5XA 5IDVA 4EDHA 1I4LD 2NIPA 1UKEA 2AKAB 3ZZTA 2X2EA 4TMZA 3R9XA 2GCOB 1E96A 4P32A 3RYTC 2C95A 5H68A 3LVRE 2BBTA 4OKSA 2C9YA 1RJ9A 5JJLA 1EFRD 4FN5A 2V6JA 3HU2A 4M9SA 3TGPA 1S9DA 5CK4A 2EW1A 2W2XA 3OEHA 4PC2A 5E7JA 3O8CA 1R4AA 1Y63A 2ZREA 4US0R 2WJVA 3UMSA 4N1AA 2WJJA 3IBGA 4Q66C 3K0FA 2QG6A 4JYBA 1Z6YA 3BERA 2ZR9A 1AGRA 1W2HA 4GMXA 2C5LA 1RIFA 5L8VA 4TQ9A 3QI2A 2N46A 2UZ3A 1OKKA 2CVHA 2HJGA 4P4UA 3ZQ6A 4LHWA 3Q3JB 3TLXA 5K8IA 3MCAA 1AQUA 4B75A 1HH4A 221PA 1KI6B 1OKKD 4PO1A 2PT7A 2HCBA 2ZR0A 3CB4A 3IGFA 2IF0A 5SZJA 2PZFA 2PCJA 2WJHA 3K0CC 3S1AA 2ZJZA 1GRQA 4MKIA 4MKHA 1U8ZA 3PEUA 4V02A 5C4GB 2R62A 2ZAOA 4NCHA 3I32A 2QPAA 1QHXA 1XRJA 2QI9C 5DYIA 4JL5A 2HT1A 4XWOA 5A5GA 1T8UA 2AWNA 1YRAA 4RFSA 3CLVA 4U02A 4PHHA 3FHOA 3L2OB 1E69A 1FL9A 4KJZA 4WZ6A 1M7BA 4MKFA 2HYDA 1Z07A 2FPKA 1VCNA 4X8HA 4D2IA 2JLSA 2K5UA 5IHPA 5KOYA 1R0XA 1UJ2A 4BLQA 1XPRA 3FMOB 1EXMA 3M1IA 2XZOA 1KJZA 1NMXA 3I72A 3QKRB 5KSYA 5EE3A 1UF9A 2IEYA 3A4NA 3UATA 2DHRA 3I62A 1JALA 5HE9A 2H16A 4E03A 1XFAA 1SHKA 4QNRA 1N0WA 2EFGA 5JECA 5FTJA 1CJKC 1FOEB 4ZDWA 1BYUA 2ODWA 3Q72A 1GM5A 1P2TA 1TEVA 1IY0A 3M4YA 3AF3A 2XOKA 4DCTA 2NO1A 1GDDA 2C9OA 2FPMA 2IYXA 4KODA 1ZNXA 4PPFA 5JHGB 2W83A 1VKJA 1FP6A 1E94E 1GNPA 3G0HA 1KK3A 4H1UA 2OCPA 1R5BA 3SJCA 5H8WA 1JI0A 3B1ZA 2XB2A 1R10A 1F60A 2WWFA 4JL6A 4WOPA 1ZINA 1ZBDA 5KNCA 2ZI3A 3H84A 1S9HA 1FX0A 4HLCA 2ZJ2A 3PEVA 1CJUC 5KSZA 2A78A 5J4VA 1JQJC 4PSAA 4LCBA 4AY2A 2RKOA 2D62A 4EQ6A 1WB9A 1OPXA 4NMMA 1CRPA 1J70A 1II8A 4M9QA 4RVCA 2H92A 5TARA 1CKEA 1CTQA 2DFLA 3A1VA 4LWZA 4HDQB 4Y0VA 2GXSA 4KFUA 5P21A 5GADl 2C8VA 2H57A 1KDPA 1UBFA 1YZNA 3QBTA 1E2EA 4M1KA 1CR4A 3EZ7A 4YXWA 1HE1C 1SVOA 4LJAA 2ERXA 2CEAA 4LI0A 2DWPA 4L16A 3Q8XB 4KITB 2OT3B 3EW9A 4Q4JB 4A82A 1F3OA 4OHWA 3L8ZA 5UKDA 1HA3A 2FSGA 2GESA 4NONA 1OT3A 1SVSA 4QFMA 2KI5A 3IQXA 4DC9A 1E9BA 4OK6A 2QAGB 4JVLA 5HTKA 2XTMA 1WBDA 1XJ0A 3K0AB 3LO5A 2WVJA 2JLQA 3GQBA 5EXTA 2J9RA 2OM2A 5L3VA 2ZPTX 5CYPA 2PMDA 3IILA 4IFBA 3ZGXA 4DZZA 3LY5A 4JLNA 2FSIA 1KY2A 1NF3A 1DEKA 2W0MA 2VSOA 4M4SA 2V6IA 3U7HB 3KQUA 1UKVY 4Y0AA 3LXRA 3AEZA 3RWOA 3PJRA 4FWTA 2NMVA 4D4LA 4NYIR 4GRAA 2HF8A 3DMDA 3QXHA 3QXSA 5J4YA 5JFGA 3U3KA 4C0AC 2QENA 3ZS8A 4D81A 1RPZA 1KMQA 1G291 1W1WA 3VR5A 1KYIA 2IYSA 3MAAC 4A0GA 4RD0A 1TUIA 1ZNYA 3EPJA 1ZP6A 3BB1A 2J45A 2VQSA 3Q9LA 2KBFA 3GJ7A 2OCBA 4CEJA 1FUKA 2PZEA 1G3IA 1KMHA 1XPOA 5JSZB 1E9AA 2QN6A 3QQ5A 4LPKA 4O2LA 3IIKA 4N0DA 1RC8A 2ASEA 5BN3A 4Z1MD 3NBZC 3L0OA 4G5RA 3SBEA 3GLGA 1P6XA 3FKSA 4GP6A 4HAZA 5SZHB 4CIDA 3GFPA 3AB3A 1E4YA 2DFKB 2QP3A 4JSTA 5G3YA 2WTUA 1RJ9B 2GZDA 1KI9A 4B32A 5HKKA 1GOTA 1N6RA 4ARZA 4M1SA 5BYJA 3D3QA 1Z0JA 3KQLA 1IN7A 4JLOA 2Z0MA 5HE8A 4IVQA 4DB2A 1MO5A 2ONJA 3AKYA 2E9SA 3B6EA 3KKPA 4NU0A 3RRNA 2CK3D 5JHHB 1IQPA 2XXAA 2QU8A 4O3MA 2ANCA 3PQCA 3TAHA 2WBLC 2FE4A 3A36A 3DL0A 3PV0A 4EPXA 2QGZA 1E0SA 2D74A 5EUQB 2ZJYA 3I5YA 1LW7A 2BEKA 2NZ8A 2D7CA 4KU4A 1ZVQA 4PO8A 2Q3HA 3B1VA 1DG1G 5JI3E 1O87A 2I1QA 4MA4A 1OXSC 3UMFA 2VHUA 2GK6A 1B23P 1FPMA 3SFZA 3JVVA 1Q1QA 2NPIA 2V8OA 1DTSA 2ECKA 2VHCA 4EJSA 2FMXA 1SKYE 3RANA 2HLDD 4B44A 4M53A 4JVMA 2V1XA 1IXZA 3AVPA 1G3QA 3QE0A 1HUQA 4AKIA 2OBLA 2BMDA 2DR3A 2OHFA 1GL7A 1MR3F 3A1SA 2X77A 4PAOA 3ND8A 4PC3A 4BEJA 3W6PA 1LB1B 4TYWA 2GBLC 1ZC3A 1GITA 2OE2A 4US1R 4YLGA 2Y8EA 2WSMA 3KQNA 4KYIB 3HU1A 2AWOA 2CLSA 3I73A 1OIWA 1D9XA 2AR7A 4TSFA 5FR2A 1SHZA 5E4FA 1G5RA 5DGXA 4OHYA 2W2VA 4LUCA 4XIGS 5FUWA 3CX8A 1YZUA 4J0QA 1P2VA 4PAMA 3NC1C 5TVKA 4B3CA 5AJVB 2ZTSA 5FBQB 1V5WA 2GJ8A 1W46A 2DPXA 2RHDA 3SYLA 2QP4A 2Z4RA 1KJWA 2ZANA 5F9FA 3RRZA 3WNBA 2BHRA 3T1TA 2QNRA 3NG1A 3FHTA 1E2MA 1G8GA 2DWQA 3SFVA 1Q0UA 4L15A 4OI2A 3LLUA 5BN5A 1R0WA 1AN0A 2ZS9A 1YVDA 3F5FA 3GLIE 2W6IA 2O8FB 421PA 3CW2A 5GJBA 2BOVA 3QF4A 1VMAA 2ZE7A 4QJ5A 2ATXA 3U44A 1QHSA 2EFCB 4MKGA 4DLVA 1HURA 1N25A 1FX0B 2G88A 2EYUA 5KTYA 3AUYA 4GOKA 4GBMA 1E2NA 3KL4A 1ANKA 3CIOA 1P73A 4F4CA 2QROA 3VR3A 4L4UA 2IF2A 2REOA 4CT5A 1SXJB 4BFYA 3B9QA 4PQYA 3ZJYA 4LK2A 1K5DA 1YR6A 3RC8A 1G9XA 1YKSA 4PR0A 2G0NA 2GVDC 4JZKA 2AFIE 4BFSA 5KNBA 2VPPA 1FNNA 2ATVA 4R2IA 2RGXA 3W6NA 5GVRA 2UVQA 4L8GA 4LYAA 5CLLA 3LFUA 3VKGA 3RS2A 3WHKA 5SZIA 2NTYC 3E70C 1G64A 5FOUA 2ZRBA 2OV2A 3TW8B 2JLXA 4P4SA 4DLXA 1E99A 3P4YA 4M1YA 3EPLA 2OUKA 2RGAA 1DAEA 3U7FB 2ZE8A 5F2EA 1SKQA 2PH1A 1OF1A 2VBCA
chains in the Genus database with same CATH superfamily
4A6XA 4AN1A 3KYBA 4HTFA 1GUAA 1L5WA 4E14A 1HETA 3JQBA 4H7FA 2Q45A 4BQRA 3LC0A 1VECA 1MABA 2P0EA 3SM9A 2LDXA 4BO0A 1UOPA 4YXWD 1JIXA 3CUWA 3IAM6 2XCIA 2XE8A 1ADJA 3TB4A 1QC5A 2PY6A 5EERA 4CV2A 2FFAA 2RB4A 1KH3A 4CR6A 5K0NA 1R0YA 2WPNA 3OQPA 3IB3A 3A4IA 3P32A 3O8OA 4GH5A 1G59A 4G0UA 4Q9AA 5M7EA 1QWOA 1QRUA 2A9KA 3Q8LA 1NMYA 3ILYA 3BXEA 3NETA 3SQWA 2FETA 3CZQA 4NVRA 1NQTA 5FWAA 5LLTA 3I9KA 2GCOA 4GNRA 3MOSA 4XM2A 3UCEA 1WPQA 1FMCA 1KO5A 3EYWA 3DE3X 4NS4A 1O97C 2UYYA 2DG2A 4BZQA 4NP6A 2JJ8A 1Z75A 2QR3A 2RDMA 4NBVA 1NXXA 1U1DA 3ZCPA 4ZVTA 2EAUA 2V55B 2AC2A 1SULA 3L6DA 3E9MA 4N76A 2OAGA 1FFDA 2R6R1 5AVWA 4MV1A 1LVHA 1PQ4A 4Q9NA 2GN1A 3Q3GE 3H5IA 4LF4B 2R48A 3FRIA 5T41A 2QNIA 4FKBA 3RV3A 3FF1A 4XWGA 3K0KA 4D42A 2LKCA 1I7QB 3KQKA 3NVAA 1XZHA 2OEPA 3HA2A 3QU4A 2QQ0A 4OOFA 4S12A 2MCFA 1NBAA 3WE7A 4QU8A 3W1EA 4YACA 1R6BX 2CNKA 1ODSA 3NALA 4FMPA 1W59A 4Q24A 4CBVA 4E2WA 2PV7A 1K1EA 4TWZA 3KR9A 2OFPA 1FFGA 4LCEA 4QO7A 5CHEA 5K8UA 3PEWA 3F73A 2Q46A 1NRXA 2RGGA 4D97A 2FUNB 5CTJA 4C0SA 4JX9A 4TTQA 3CQ9A 2A94A 1TUEA 2BFBA 3A70A 3I3OA 4R84A 5HBRA 3ZNQA 3ECAA 2AG8A 3P2IA 3FX2A 1E1QD 2Z30A 3IOMA 3ND9A 4QYXA 2FSVC 1C3OA 1A2KC 4YAIA 1FIUA 4PBRA 3DTYA 1CF2O 1E1RA 4DBVO 1YOVA 3MGCA 3WLKX 4C7MA 2JF0A 1YR1A 3B1KA 1U2TA 5DN6D 1C2TA 3AUFA 1KZYC 4IH1A 3B3JA 3FUVA 3WYFA 4WKOA 1MIHA 2BELA 1BXRA 3PWTA 2ZM5A 1M34E 3JRNA 1MNQA 4LJSA 4EA8A 2WAMA 2CKDA 4PIMA 4DV5B 5FEUA 5KI6A 4I9GA 1Y3CE 2P9ZA 4RK6A 4PZPA 1ZZGA 4NZMA 4KLAA 3V46A 2F4VB 5AYVA 3MOIA 1YQEA 4WACA 3RVLA 1KJIA 3GJ6A 3PIRA 1NJGA 2FW6A 2ORIA 2ZIFA 3LTNC 3RS0A 4TKVB 5CYFA 4YJ3B 2VQ3A 1KIMA 1P7VA 3NBFA 3PA8A 3PQ5A 4OFXA 4KIGA 1LRLA 2E4UA 1E2HA 1OFTA 1RQGA 2Y67A 5CXXA 1S2NA 1YKFA 2AMLA 1EUCA 1B0PA 2W2NA 3JZAA 3EZLA 5LCXA 3RIGA 3ZGLA 4DG5A 4Z49A 2JK0A 3NTVA 4ZT7A 1VI6A 2ZJ7A 3LD9A 1G4HA 1PG5A 4WCFC 4AZ3B 5B30A 1WKBA 4R7ZA 4Z99A 3BSSA 5JAMA 3BE6A 2ZAYA 4P7BA 4LNUB 2R6DA 2A33A 3VR6H 3K4PA 1ZUIA 4U2BA 2GSDA 3B36A 5B2EA 3PGLA 4A15A 4OLFA 4KR7A 2JFHA 1FTNA 3HPQA 1DARA 1G9SA 1K8RA 1I4TD 3KXLA 1QFXA 1V0JA 1NVAA 4Z3DA 4J6EA 3AM5A 2G9VA 3CNOA 2XODA 4KDCA 3OPVA 4WNIA 4QT4A 3TKLA 1E5DA 2GBFA 2W6JD 3EG5A 4ZQBA 3WRYA 1SN7A 3KCQA 4DMHA 3C7DB 1EUYA 3K6RA 4P83A 3OQVA 4JVSB 4EG1A 1UC9A 2WIFA 5BSVA 1HYBA 5ICGA 4GVLA 1GARA 1U0FA 1FA9A 1YFZA 3GEHA 4I1UA 5ELXA 1I80A 1GDTA 4KSCA 3L1KA 4RQUA 4UDOA 3OFND 1HYQA 3FPKA 5K0JA 1KHTA 3SIPA 2ECPA 3TX2A 4R3NA 5CB6A 4UQPA 1TPZA 1SUPA 1UPXA 2P90A 4OQYA 5F1KA 1MB2A 1LDEA 2BL4A 5BSTA 4BS9A 4Z4QA 1Z4JA 1M6WA 3H2IA 1XKTA 4OBEA 1LNZA 1UJ4A 5C5EA 4HDSB 3PXXA 2QT0A 4RZSA 5A4DA 1ISFA 3T54A 5CIQA 1SIUA 2QRGA 1FDIA 3GN1A 3VOSA 3P2YA 4BN0A 3T1OA 4DLKA 2A1IA 3ASVA 4IAOA 4MYSA 3RAJA 2DHDA 1ZD2P 2WT9A 1NQWA 3R9IA 4KRYA 2OTCA 2WKSA 4M9ZA 3WLRA 2P9HA 4BNKA 2BFOA 1P9LA 2E4XA 2YZ2A 3GA7A 2XW6A 2QUZA 2YZNA 3ILVA 3PGJA 1SH7A 1FQWA 3HLYA 3KB1A 4WWHA 1UAGA 3OX4A 4RLSA 5DWDA 5HPYB 1JLLA 2DPGA 4UAJA 1YB6A 2RBGA 2XCOA 3MTBA 4D5EA 5IUJC 5J3JA 1JH9A 2IZ7A 3NIDB 4M89A 1BGXT 2B8TA 3N70A 4WD3A 5DRTA 2BRUC 1ZJYA 3H2KA 4OQXA 5B4UA 2GAFA 2O7NA 2P3SA 1N6PA 4O2AA 1T29A 2XCQA 3OD5A 4PE5B 3HA5A 4X8MA 3GFRA 4EJ2A 2YWRA 3IA2A 3RYHB 3OJLA 1V2GA 3H1EA 3MINA 4AMYA 3DAHA 1FDSA 4RA9B 1E1MA 4JZYA 5CLJA 4G6ZA 4UBLA 5CDSA 2DY0A 3HLTA 1DEHA 4Z53A 1YC2A 3MTAA 4QTZA 3I1YA 4X7RA 3A3KA 4H31A 3OMLA 4F86A 1IAQA 4H7DA 2P9CA 2YHIB 4N39A 2HXYA 1WO8A 1SBZA 1UDWA 2Y6UA 1KZ9A 2R3SA 4QOJA 1E4EA 2NSLA 3DL7A 4LBVA 3OJCA 1BWQA 5DWVA 2ATIA 3HFRA 3LQYA 4MMXB 4RD3A 1GZVA 5FR1A 5CEEA 1OH5A 2PMBA 1JDNA 4YT4A 5KSOA 1EHYA 5IBQA 2XIJA 3S8EA 1F2UA 3B1WA 2I29A 2AE1A 3EWNA 4OQNA 1NX9A 4Z7OB 3TSAA 1X0VA 2K7ZA 3WIUA 1Z0KA 4K7JA 2HF2A 1QE5A 1VE5A 3E8SA 5AVZA 1NTOA 1P1FA 1UXGA 1OGJA 2OZEA 2QY6A 3CNHA 1BWPA 4TSFD 4DXDA 5B2FA 4Q7LA 3EVEA 1EVLA 5EWMA 1Y8AA 1IU9A 4Q0MA 4FMDF 1XD2A 2DTEA 1YS2X 2OLJA 4LOAA 5L53A 2HBYA 2QW8A 2EKZA 3TNJA 4BVGA 4F3KA 4TQUS 3QP9A 3CLTC 4EYKA 3LF2A 5TRTA 3ZDQA 2OSBA 1Y3IA 3D81A 4L4SA 4QU5A 4RHXA 4X3CA 3F7TA 3GG9A 1XEAA 4V03A 1RKQA 5ECGC 1UWLA 3LVBA 1IMJA 4UMVA 1KS2A 1Q3HA 3G1TA 1WSDA 4KXMA 3FSJX 1U94A 1JR6A 3CLSC 4MCHA 3A31A 2FW9A 1DCKA 3W34A 4TROA 1DBRA 4NU6A 3NHZA 4J3NA 1T13A 3VISA 4PLPA 5TC4A 4D41A 1IVSA 2A59A 3TIXB 3IBCA 5CVJA 3H9EO 3K3PA 3N8IA 3DA8A 1Z0FA 2HPAA 3G2IA 3PRKE 2GJAA 2Y1GA 2JIBA 4UUNA 5DASA 4JX8A 4YCMA 2AT1A 2NGRA 1HT1E 3FHLA 3QUBA 2AYXA 3G49A 3VDRA 2EX0A 1IULA 621PA 4OGFA 3AVUA 3N58A 1GG5A 3DONA 4HB3A 3GAFA 1I30A 4JNKA 1JFRA 2ETXA 4ARAA 1QF9A 1Y34E 3NYQA 4BGIA 4B3XA 5CFLA 1NP6A 1ZK1A 4FEGA 3TMAA 5JD5A 3WBFA 4UMDA 5BMVA 3D4OA 4MKZA 4OQQA 4EQ6B 5BNFA 1XF1A 4CMEC 1FEZA 1SWVA 1KY4A 5GAJA 2PZGA 1H4SA 5JRJA 1JVNA 1NLFA 2XEDA 5HILA 3CT4A 2H17A 1E5TA 1FE8A 4FWBA 2XOXA 1U4NA 4L5YA 1ID8A 2QSYA 3QU7A 2RBEA 4R54A 1DUSA 5HCIA 1DIOB 1ZCBA 2VDQB 2OBYA 3JWEA 2JAUA 3EZXA 3QTBA 3NIFB 3OJWA 4GEKA 1G1MA 1QHNA 2HA3A 3K16A 1XLUA 1WV0A 3IRVA 2O50A 4WA7A 5AM1A 5FFNA 3ZOKA 3Q8KA 3PHLA 2NU6A 3C16C 2ZCUA 1ETHA 2A0UA 4F45A 3BHIA 4WJZA 5EPUA 1CQWA 3A1FA 3JQDA 2CYBA 5HCUA 4C88A 3HMKA 2QVLA 1YRBA 3BILA 1SD5A 4YGXB 3GFGA 4BPRA 3OM8A 1ZC4A 1XPUA 7MDHA 1O6ZA 1E3EA 2RONA 4P92A 3WWEA 3UK0A 3PGXA 4BFWA 1EXVA 2BKUA 3I34X 2GZMA 2YUIA 4X0EA 3GAAA 1C30B 5JV5A 5GM2A 3BSWA 1J90A 5T3YA 2GTHA 3EY4A 1KFJB 2OM6A 3CHYA 4MUHA 4MUGA 3FYHA 1ENYA 4OXRA 2PVPA 5KYVA 4MO2A 4ZA2A 5LU8A 3L4BA 3HDQA 4Z4GA 5AW6A 3QEMA 4W9NC 4NI5A 5FBWB 4Q39A 2FW8A 5JXGA 4JVOA 1QFJA 2XKKA 3MGAA 3C70A 5KVQA 1P2GA 2WKWA 4BO4A 3AVTA 2V7XA 3DOOA 1WLYA 4G5XA 5BSMA 2VF2A 1IEWA 4WXHA 1YZHA 1KAGA 3C74A 3K8QA 2QD2A 2FX3A 2PWAA 2ZYIA 4NEHB 3WJ2A 1W36C 4KDFA 2VDPB 3D2LA 2HMSA 1IB0A 3PEFA 4GP7A 3NX4A 4BTEA 1TQHA 3WLPA 2F90A 2C97A 4J3FA 2J07A 1BMQA 3TLCA 3GRAA 4DG8A 1JG3A 1QHHB 4W5TA 3GYGA 2CXHA 1GCAA 2LV8A 5IULC 3ZS9A 1GQYA 3HU5A 3GLIB 2F48A 2ZJ0A 2HY7A 3OCXA 2WIBA 3HDJA 4G9EA 4Y2PA 2FXIA 3GEEA 1Q92A 1TAUA 5CYGA 2XRFA 5JSZA 2Y1KA 2ZTHA 1GPH1 3GT4A 4KDRA 3NWPA 2G06A 4QA9A 4D0GA 1Z12A 4GR9A 5CB4B 3LC2O 3IAS1 1A82A 4QUEA 4YUZA 1SHLA 1IYZA 3HCRA 1DOZA 1PUJA 3A1TA 5J2TB 1CPYA 4R4JA 3T3MB 3JD4A 3CX7A 4V0SA 4C0BA 3P9CA 3K9FC 1WKVA 3TLBA 1EWTA 3A9UA 4M8IA 1Z83A 4E7PA 3TFOA 3N0VA 2PKQP 4ZQEA 4G8DA 4HATA 1DWUA 4O2RA 1NJ6A 2VSNA 3DMTA 3HJNA 4JLKA 3HPRA 3LZ6A 3TX6A 5J40A 3VUFA 2I7XA 3T1HB 3R8XA 1G98A 4W7IA 3R0XA 4M1TA 4ZOQI 1P74A 1PR5A 2ZM6B 3EFEA 4MS4A 1KDYA 4JXXA 4OL0A 1GAEO 4ZWNA 4URWR 3EPRA 1KBZA 2BKEA 3FAZA 4LI3X 1IL0A 3U4GA 2YXEA 5FLEX 2WK1A 2VHJA 2YNMA 3PWSA 4Y6PA 4ZQGA 1P5ZB 1I3OA 3FPJA 3HXPA 5FL3A 2EZ8A 3SSAA 3RUAA 4ZCIA 1H2YA 2G3YA 2OVBA 4LXYA 4F3TA 1QZTA 2PSFA 2B8NA 1WHTA 2IW1A 2XQFA 2X14A 2ATEA 1IVYA 3JX9A 3KT0A 5H3LA 3VHRA 4BNYA 4N3AA 4DWOA 2CN1A 1SR8A 4YI3A 4OGKA 1NLUA 3LZCA 3OOJA 4KKVA 3OPYB 3LX5A 1REQB 5CJPA 1IN8A 1TZMA 1F8XA 3QPUA 5EVCA 4GU5A 1CR0A 3P4XA 3R5TA 4JLBA 1TJ5A 4G0MA 2D7DA 4X1KA 3EPKA 5F3DA 2QAJA 4RH3A 2RHOA 2C2HA 2NUAA 4R0MA 1DCFA 1BXRB 1PNRA 1U63A 3T5AA 3QYAA 2V6GA 2Y76A 3ELUA 3CBGA 3FVWA 4G1VA 2Q4BA 3MF4A 3IEUA 5DYTA 4ZVLA 2VH2A 3HBNA 1DEOA 2QQFA 3OLWA 4ZRMA 1NVXQ 3FDZB 2XB9A 1R64A 4RMIA 2V6FA 1VG9B 1XD2B 4ZQIA 5CM8B 521PA 5JY6A 1M2OA 1C50A 5H4GA 4IMIB 1R4NB 2QD1A 3OQBA 4BX2A 4JLVA 4YJ3A 3VQTA 5HUJA 5LQJA 2ZYTX 1GUBA 4RMGA 5FULA 1NI3A 2PRZA 5JSUA 3T6KA 3W8DA 3ZXXA 4TTPA 4M0PA 4GOOD 4KX3A 3K6SB 1CP3A 1XIVA 5TT0A 4EHNA 4UMEA 5JJCA 5TQVA 4LYJA 1GNTA 3U5ZB 3HQ4O 1TU3A 1VLQA 3JQGA 5AP9A 4BO3A 1OASA 3RFXA 1TK3A 5ALHA 2JC3A 4GLJA 4MLCA 4WCFB 3CZRA 3WLHA 2ZWOA 1O03A 3HGTA 4I6GA 2X23A 1IVNA 1I2MA 2IY9A 4OREX 5ECWA 1VYTA 2XZLA 2PX8A 4KAJA 5FOXA 2N75A 3H5RA 3TLYA 3SC2A 3VZQA 4WKGA 4B82A 4EHHA 4LC9A 3HK2A 3E03A 3CRVA 2HKIA 2YNMC 3TSZA 1X6VA 4DQXA 2V7QA 5GPBA 1RWMA 3EC7A 2VHZA 2FK8A 1TCAA 4JJZA 1DCMA 3DZHA 2OP1A 4HH4A 3ZXIA 2I1VB 3GLSA 3LY7A 4RSGA 3JSAA 3RRXA 1QZUA 2FSUA 4CEHB 3MWJA 3U0BA 1PZFA 2FDXA 5A1JA 2N1MA 4DSTA 2X9QA 3D2BA 1MAUA 1TYBE 1U81A 3IEXA 1RJWA 1BO6A 1IQ0A 4GOND 2Z2ZA 2LCIA 2OLKA 4JA0A 4EFMA 4D45A 5EMMA 5CA0B 3IBFA 2QN9A 4C03A 1L3IA 5KKAA 1TJ3A 5E38A 5U1PA 1WRBA 1SBCA 4YRKA 5C5IA 1VIDA 1E1LA 1FTSA 3IAAA 3JV7A 3A6EA 2PVCA 3RHZA 1NNEA 3DPSA 1Z2PX 2P27A 2I8CA 4R40A 2C59A 2K2WA 1U2GC 3DLPX 2D8AA 1WSWA 2B5WA 2OFOA 3ZCQA 3HGMA 3IUEA 3WYAA 3LCJA 4M0FA 3GWGA 5JCZA 3G9QA 1JJIA 4DE5A 4FN4A 4EFLA 5BSWA 1PZEA 2QTCA 1V7ZA 4RPGA 1PZGA 2CL0X 4IIDA 2FWNA 1H3FA 4IJ6A 4DN6A 4Q93A 4TSRA 4X62B 4N6GA 3LS2A 1Z6XA 1B8OA 2K4MA 2RGYA 4R98A 5B1DA 2QUAA 2C4KA 2WKRA 3OO1A 5TXGA 3ZG6A 4AX4A 1Q91A 4URXR 4Q4AA 3U61B 4HQNA 2LD4A 2FWPA 2C99A 4QEDA 3ZGNA 2W37A 3FUUA 3GFOA 5J5AA 2PGDA 3QVMA 4UAGA 5B3LA 2HFKA 3F78A 1XNJA 1Y1LA 3ANNA 2QJRA 5E1BA 3ZDRA 4PYRA 4D9IA 1NRWA 5B55A 3IQHX 2H9YA 5CAEA 3RLIA 1LC0A 2EFHB 4NMWA 1OI7A 4NV3A 4Q9DA 4EB6B 1PFYA 3NBMA 4DMRA 2FJUA 3O91A 2H4JA 3KXKA 3CRZA 1NI5A 2ZBDA 3GP3A 4IJKA 1GP2A 1KA9H 3WQRA 4M6WB 4Z3KA 1PJ2A 3NAGA 3AB7A 1BHSA 4YJFA 4IOJA 3R3YA 1I0IA 4BMYA 1MOPA 2JVJA 2E18A 4ER5A 1WA5A 3C5CA 1E7YA 2XB4A 4NDNE 1Y5RA 3DPUA 4OHMA 3SYTA 5ARCA 1N1EA 5EHZA 3TAUA 4F2DA 1WY7A 1OFUA 3F1KA 1VJ0A 3OI7A 1S2LA 5D84A 1U7PA 2IHYA 1SUIA 3O82A 4ISBA 4AKEA 3LQRA 3TSOA 3HCWA 4MIKA 3WGVA 2HZ7A 4RCYA 1I6MA 3QX9A 4CLXA 4F4UA 4DPLA 2Z58A 5IEBA 5JVDB 3AGPA 4OB6A 3UAXA 3E4CA 1OPRA 2D1TA 2J0VA 4BFZA 2C04A 4JEHA 4R1TA 2FRDA 2Q1YA 5JTTA 1AA9A 3KEQA 2BVNA 2YV4A 5JS6A 3BE5A 4MV3A 4YO8A 4GOMD 3DDSA 5D86A 3VO8A 1KERA 1XI2A 1DAIA 2X7XA 2VP4A 3WVNA 3BH0A 3OOEA 2IDZA 3ZZ0A 4E12A 4D3DA 4BNVA 4QKQA 5LZ2A 1GN8A 1Q2XA 2FH5B 2INGX 3ITEA 5BQ3A 1HMYA 2VJKA 3NOXA 4L4RA 2HA2A 4JC4A 4GT1A 3DO5A 2CZGA 1SIOA 3VKWA 5HTOA 1U8CB 4L5JA 4OQZA 1K5HA 1O57A 1QGUB 3CH5A 1E2DA 4F04A 3F6BX 2AJ8A 2JB9A 3T9EA 1ZD5A 3KYDB 4QDJA 2JJ2A 3QK7A 5FUXA 1Z2AA 3ODGA 3MRVA 4LSWA 2JDID 3O73A 1MBZA 4F38A 4R6WA 1MQ9A 1MTZA 1Q7CA 3PF8A 3P9PA 1E7MA 3E9EA 2QMQA 4FZ3A 4QBTA 1ZK3A 1ZIYA 4HX2A 4QOHA 1ZITA 2HLHA 3DV0B 3NC0C 3GIDA 4PRZA 3INRA 5B3JA 3RS9A 4V1CA 4DIDA 3LQFA 3C1AA 4FTWA 2W98A 4FDTA 5HJ2A 4B3DA 4BNXA 1QOPB 2FUG6 5SICE 5I7HA 4DB4A 1GZSA 1GNQA 4WW0A 2HWKA 2O5VA 2KMLA 4HGPA 1VM6A 4RUKA 4TWRA 5J63A 1MT3A 3LBIA 1W5SA 3LDHA 1NMEA 2ZRJA 5CHYA 2AJLI 2Z1DA 4RFLA 2WV9A 3WXMA 2IPMA 5EMLA 5B36A 4G41A 2C5AA 5CGZA 4E5KA 4I1VA 3F4LA 1ZOSA 4OYYA 4C4AA 4CHTA 1TLTA 2W6MA 3RW9A 3EPHA 3H05A 1UDCA 2A5DA 3A4VA 3NP9A 4L27A 4XTCS 4MPJA 4DR6B 4D4GA 4X97A 5EJEA 4ZAVA 4M8KA 3M6FA 3UICA 1E6CA 3C1TA 5L3SB 3BXGA 4HYYA 1IY8A 1U7ZA 2Z2KA 3SOZA 1IZ8A 3W78A 5JNTA 1E3WB 3MJ4A 3H75A 1UADA 3AU8A 3KUCA 1PZNA 1G19A 4Q02A 2AIRA 2FPIB 4YFYA 1FTWA 3BJZA 2CNWA 3N6RA 3VYRB 3WB0A 4CM3A 2O57A 2C0PA 3GDGA 3GMDA 4QJ3A 5IT5A 3MSCA 1PL7A 4YAOA 5TB5A 1AK1A 1LBSA 1DIAA 1RRFA 1W5AA 1OWNA 4IO0A 3GFQA 4AZ0A 3TDNA 1GTL1 1NNSA 5E4JA 4TGLA 1QRDA 3HB4X 5ELMA 1RAHA 3OQMA 1N4AA 1MFZA 3B13B 4B3IA 3KBOA 5EJ9A 2UAGA 5TQ0A 1GL6A 4CGYA 1CERA 4A91A 1VPWA 4GC5A 3RS8A 2POCA 3JTEA 4HFJA 1MORA 3I64A 4GVXA 4S1WA 5H7XA 1EP1B 2Q7XA 4B5KA 4MIEA 1NXWA 1QLHA 1VLHA 3EZYA 3PPVA 4BAGA 1KSFX 4HB2A 3K15A 4J16C 3BFPA 1XQXA 1XTPA 5DHQA 1G8MA 4JP2A 2PL9A 2NYVA 3BTOA 3BA6A 4Z54A 1K98A 4V0NA 3CLUC 4ND5A 2CE7A 3ZBUA 4BZPA 1ZR4A 5HZMA 3SC2B 1R00A 3HE3A 5H16A 2OO3A 3IDZA 1B8NA 2I34A 2PO7A 3KC2A 1EGMB 3E22A 1SWWA 3NYRA 3R5FA 3H11B 1RFLA 3ZR4B 1CXZA 3JQ9A 3P9XA 3QTTA 5K20A 3ZQKA 2D7JA 1YA8A 2PXXA 1XLTC 1MB0A 3H7IA 4K6FA 3LDUA 2VYFA 3NS7A 2JGIA 3U3DA 3M4XA 4N9WA 2ZZMA 4IIXA 3T06B 2YJTD 4KE6A 2A9RA 2LDBA 4UU7A 4N6OA 1WZNA 1ADFA 2IPNA 2OKGA 2XMQA 1Q0HA 3B51X 5BV8A 2R7LA 2XUZA 3C7KA 2BTOA 1SKAA 2HWYA 1X7WB 2AJDA 1MH1A 3ABOB 5H02A 3ILHA 3MQ4A 3SHTA 4YVFA 4I1PA 1S0UA 1TJ4A 1W6RA 3HJAA 4Y3UA 1M34B 2OQRA 4LDPA 4QASA 1AO3A 1G41A 2RI1A 2QNBA 4G8JA 4RD4A 3EGCA 3TPCA 4RIEA 4JR2A 4HQKA 4L6AA 3ACBA 1V1RB 2W2PA 1VJDA 1OX4A 3FIJA 5E6RB 5AJHA 3GGGA 2CDNA 3FMIA 5JS2A 3HYTA 3MJTA 1ILWA 1E1YA 2A14A 2IZOA 3HUDA 4D9BA 2Z98A 3QVWA 1EXDA 2ORVA 2FW7A 4RQTA 1QAOA 3OY7A 3QBVA 1ZM3A 3HO8A 3L18A 1C7RA 3AUJB 5GONB 4GI3A 1UL1X 1DKLA 1X1DA 2WF6A 3IIJA 1JA0A 3JVDA 1JKFA 4YC7A 4ENPA 1GZ5A 1NSTA 8ADHA 5EKSA 1NE2A 3JQ6A 1P62B 1FQJA 3K70C 2XMRA 1UBJS 2J3MA 3B6KA 3UW3A 1RRKA 1E2JA 4B7ZA 1GR0A 4QGGA 4MUBA 1Y9JA 1BOFA 4RX1A 2WTNA 3DO8A 5KOHA 2Q6TA 3OE1A 4DQDA 2G77B 3VNUA 2XKJE 3I2IA 4H0FA 3GV0A 1AXRA 1J5PA 1P7WA 2Y1DA 4NTZA 1CZHA 5ESWA 3KD2A 4OAOA 3ZY4A 1GPLA 1ONNA 1F0NA 3S1LA 2O59A 1Y1PA 5JD4A 3EHEA 5ALUA 4EPWA 4B7AA 2G63A 3QY0A 4PTYA 3F6PA 3UCFA 4EIWA 1II0A 4TTVA 2X6QA 1FFXB 4UNQA 3FUCA 1E6WA 4P38A 3WO1A 1EGAA 4J94A 4O2BA 4RM3A 3R6TA 5D5QA 3MQFA 4FWIB 1DAMA 2B98A 3GRZA 1VG8A 4FR5A 4W8GA 3NR2A 1Y1KE 4XFKA 4PLYA 5ALYA 3QVJA 3WLOA 4BFLA 4G01B 1XD9A 5IHXA 3UYKA 3ETHA 4E5SA 2VA8A 2EBWA 1NSFA 4XYBA 2RHMA 4F4IA 4WGFA 1GILA 4CI9A 3T3OA 4BVJA 5JZ9A 3RG2A 4ZHQB 1C29B 1DT3A 5KO2A 2QD3A 2FG5A 3EAGA 2VL7A 1O95D 1ISMA 1F0PA 3L4SO 2VJAA 1RRVA 3E9DA 3Q1KA 4YR7A 2OC9A 3GXOA 3MSXA 5AUNB 1SCQA 1LW6E 4I99A 2WM3A 3DDZX 4P7GA 1J8YF 3JWGA 2C92A 3EXEB 4MICA 3KPYA 1NXOA 4NJMA 1OLSB 1RYBA 1X77A 3A11A 3D4IA 4KWHA 5IK2D 2FN9A 2FV8A 1TYDE 3K6SA 3V4VB 1PV4A 4NOJA 1JIUA 4UM9D 1OW3B 3AF1A 5EMJA 4ID3A 3I9OA 1KR2A 4GGPA 4A0SA 4OFBA 2C5HA 4X94A 1K92A 2R4TA 2R11A 4WZBE 1CK4A 4BKPA 1OSNA 4MULA 2VTVA 1Z7EA 1FLAA 2YV5A 4RTQA 2SHKA 4NZZA 3GA0A 3GFFA 4TWIA 4FGWA 4JGBA 4FSHA 3QKWA 3HBMA 5B12A 1B2LA 1Q2UA 2XMBA 4DNXA 1KNQA 1ZJJA 4FYYA 4IIHA 2IYQA 3QVGB 1VA4A 3OLYA 3UXMA 3AESA 1HI9A 3HYNA 3PG5A 2HU5A 2JNWA 4UCWA 4TXNA 2IOHA 1O96A 1BQ3A 1NP7A 1P4JA 3T7DA 3CRW1 2G67A 4LQCA 4U7FA 1PR4A 5K45A 1CVRA 5THQA 2C7PA 3TVDA 1VCIA 2UZIR 2Q2OA 2R1TA 3KEGA 4BRUA 3G9UA 4BMPB 3HLKA 5DOZA 1C80A 1PDOA 3PC8C 4BVHA 1ZUHA 2JJ1D 4C3VA 5BQ5A 2Z43A 3TIVA 4ER3A 1A8IA 1VRCA 1XK7A 1LPMA 3IVCA 1XLTA 1DO2A 2PKQO 3KCNA 3KJQA 3KTFA 1RM5A 1NZFA 1E8DA 2QL6A 4B45A 3FJ1A 1BCSA 4JUAA 4JAVC 3TGWA 2ALJA 2QX7A 4OHBA 2RHRA 4QOSA 5AHRA 1IZ0A 3FAKA 1MRNA 4H7KA 4KN8A 3SJAA 3VPHA 3WKEA 3DKVA 2IUEA 4IOKA 3L1JA 3T3PB 4AK9A 3PXUA 5BOSA 2C7QA 1SQ5A 4PYJA 3FSRA 1XMJA 4RVFA 3SXPA 3CINA 3BJRA 2QM0A 3D3KA 5KTKA 1EGVB 4TSKA 4D82A 1N5DA 1M8PA 1ZWKA 3KT3A 3R20A 1YHNA 4BQPA 1A4XA 1HTTA 1CVLA 2CLFB 3CZAA 2ZB2A 4FOOA 4XI9A 1QYWA 3KZXA 4GZMA 4IDPA 5FIUA 3LNCA 4IO1A 5LQDA 1U0OC 3O8DA 1X7GA 1V5GA 1UWKA 2JKYA 1H6AA 2ACKA 2G4LA 2VF8A 3JPYA 3PKZA 4UUPA 2CFOA 2V4ZA 4NPAA 4WBNB 5HKKD 3V2HA 2PFSA 3U81A 2H00A 4RSMA 1NKSA 1N5RA 1W94A 3CIFA 3N2IA 1KEZA 3ZY2A 5LDGA 4HX5A 3TJMA 4CW7A 1D09A 2ZSKA 5AESA 2DB3A 4DJEC 1BWRA 1X94A 2Y1FA 5JALA 3BCUA 2OL4A 3N3AC 3KOYA 4NZOA 4TMWA 4UZSA 4YRDA 2VH5R 1E2FA 1A5ZA 4ZVSA 1S1CA 1LUAA 1DC7A 3LT1A 1KDOA 1UP6A 3O84A 1IEXA 2P9EA 3CGGA 4BLTA 2ZFUA 4GUAA 2QUKA 5CVEA 4LG1A 4F72A 1UXKA 1G8AA 4XUGB 1ZJ6A 3QPDA 2ZIEA 3K30A 3QXCA 5EWJB 3THYA 4GQIA 2AFHE 1IDOA 1FQKA 3KLBA 4DMUB 4HKTA 3ZHYA 2O8DB 3T61A 1JFFA 3WTBA 4IHJA 5DEIA 2PZKA 3PNVA 1EAYA 1O89A 1N7IA 4KFTA 4LJ7A 3U49A 4BTVA 1HFWA 2H8GA 3QY9A 5AW1A 2JLAA 1AT1A 1KGDA 4GYYA 5EHIA 1BE1A 3ZGYA 5FWNA 4XGRA 4AZ3A 2DUWA 4N0EA 2Z3ZA 5AW2A 4IIFA 3GQVA 3VHLB 2IPLA 1YCGA 4MIOA 4RMJA 1M33A 3EUWA 3T1YB 1T9GR 1K6MA 3NHKA 4CKBA 5JXIA 2G9NA 2W5UA 1D7OA 3EIHA 4U7DA 5KPDA 3VTKA 3VX4A 2B35A 3VNVA 4XYLA 3NDPA 4TV9A 4B4WA 1QAMA 4Q1CA 5JAZA 3VSCA 3B7WA 4MHTA 1AKWA 1U5CA 1U04A 3BWMA 2CNDA 3EN0A 4CQNA 4MQ4A 2GN6A 1IG3A 2Q1XA 4OI4A 4CUZA 1RWOA 2YJGA 4DC0A 4PLTA 4MQ5A 1KBQA 5CNMA 2VHQA 4L4XA 3MWKA 3I45A 1J7KA 3G2HA 4LRUA 3AF2A 3SZUA 2E6KA 4URUR 2EP7A 3OAAA 1C8BA 3WI7A 3J7TA 3U6KA 1P72A 1LA2A 1ACMA 3FIUA 3TQSA 4M7RA 1USUA 2PNFA 4CLEA 1AHPA 4RTKA 1DAOA 2Z9DA 1UDAA 2G82A 4LMPA 1BC5A 1UFQA 1C7QA 3R0ZA 4KQHA 1KVUA 1GGMA 3AYZB 3CTMA 1Y5NA 1DAGA 1WMSA 1WDTA 3G59A 3K0CA 1KGSA 3RVPA 3RYCB 4B3MB 2H0AA 3CUVA 1AGPA 2I6QA 4TRNA 3RSCA 2ZSEA 3ND5A 3MS2A 4YMUA 1NMQA 3RVOA 4ARBA 3ZCVA 5EE5B 4PX3A 1LZKA 1EXWA 3G2MA 3L7AA 3O9ZA 4IZIA 2P9GA 5A6SB 3V80A 3OQ6A 4DA6A 1XA4A 2B3DA 3OWOA 1AKVA 2NXCA 5LBTA 2Q8QA 5AD1A 4L8WB 5LD2B 5IARA 2CBXA 3U2QA 2VS1A 2XUFA 4KQJA 4D25A 2ZKIA 1MX9A 2WTBA 1TDJA 2O0HA 5GZ3A 4PTLA 2HGSA 4BP1A 2TMGA 3D3NA 4NMXB 2HT6A 3EVGA 1IY1A 4DZTA 2IT1A 4UHJA 2F3RA 2OO5C 1A72A 4PICA 5DLQC 1LV8A 2CUKA 2Y1EA 5BYKA 3UYLA 3I4CA 2KPOA 3TLMA 3KOXA 1D8AA 1FMLA 1MG0A 1O97D 2PGIA 1ZWLA 3KDPA 3PPWA 4NBSA 4Z0HO 1TM2A 2CVPA 3C3EA 1Z17A 3JU3A 2IXTA 5ALTA 1UC5B 4D6XA 1ZM9A 2B4YA 2W6CX 4OX9Y 3NDRA 1U99A 2AYYA 5C52B 3UJNA 1NUAA 1K3TA 4HEA6 5KJ6A 3VM6A 2IE0A 3DXFA 4G81A 4AI6A 1A0OA 1HDYA 4HWGA 3VO1A 1OWOA 5JPCA 4MV0A 3GVPA 3K9GA 3SZ3A 2XUPA 1L7VC 3F9CA 1RHKA 4P4LA 1L4NA 5I7RA 5CD1A 5GP1A 3R76A 4C04A 4E1VA 4YXFA 1L4GA 4RE5A 3NMUF 4GLOA 4OGWA 5L3ZA 2A5FA 2RK4A 2OZKA 1E2BA 5L40A 1QZZA 1BQ4A 4UTOA 5AJWA 3DNFA 2ODBA 2ZJ3A 2NXNA 1S2DA 3QF7A 4QSMA 2VAPA 1KZHA 2ZYDA 4YMTA 4UBKA 1X2EA 3I58A 1JXAA 2ZIGA 1N33B 5HXAA 3K71B 1T2NA 3H5LA 1TAQA 1IUKA 2C4VA 5HIKA 5L9AA 4O5OA 2BGJA 1EWVA 2FR8A 3MCTA 2ZJ5A 3C3XA 4R2KA 1ZXLA 4H6WA 3S44A 9LDBA 1VMIA 4U6NA 3LRPA 2JFGA 2WPDA 3SYNA 1AKYA 4HUQB 1PFWA 2FF5A 2A5LA 1EGHA 2I8AA 2OGWA 4OBBA 4DLAA 3H8VA 3JQAB 2ID9A 4G4SO 4RW0A 3O74A 2CE2X 3LW8A 3NHYA 1YMQA 4P54A 4TTJA 4EKGA 2JFBA 3M1AA 3DAOA 3FOCA 4NBRA 4IM7A 4WVLA 1F9EA 5A7GA 1E8NA 3IE1A 1T9HA 1HORA 5HDQA 4NQZA 3MRXA 2IOFA 3DT9A 1R18A 4OI1A 2CB9A 3KJIA 4H7JA 4BVAA 4GVPA 2A58A 1M8KA 1J8QA 1OX4B 4IP0A 4IDEA 2BAGA 1BX1A 2PWYA 4R0VA 4RK7A 4A6EA 3QEJA 5JE8A 4Q47A 4IJMA 1R88A 1XOIA 2DBVO 1EK2A 2C4MA 2XDQB 5IXSA 1ABBA 1E2LA 3QSYA 1NW8A 1F4PA 1R0RE 4YBRA 2J46A 1QFMA 4C20A 2B2CA 2IBMA 1QRAA 1JECA 3C41J 3O03A 3VC7A 4EPTA 2QYTA 5CM2Z 1L5QA 5DTEA 5TX7A 3V42A 1H5NA 1QO7A 2QRZA 4R3WA 5ILGA 1RYHA 4J7UA 3LKZA 5AJXA 2O2GA 4JKYA 3HRHA 3FMFA 4MA5A 5KVSA 5GV7A 1WLSA 5DNUA 1J0AA 3W3AH 2OC4A 4RV9A 4C4OA 4EH1A 3LFTA 3UJ6A 1IXKA 1ELOA 1RW4A 1G7TA 4W1QA 1Z2NX 1CDOA 1O58A 3LVFO 3FVTA 1C3EA 3QKRA 2I2DA 1PJRA 1PZXA 4KQGA 4M3NA 4Y9RA 5K0FA 1TUGA 1ZCAA 2QRHA 3KKOA 2EGUA 4YIHA 1M6EX 4GECA 4PAWA 3AHGA 4I4TA 3G88A 4UHKA 3UPTA 4JB2A 2ET6A 2HSDA 2VQFB 2FMKA 1G38A 4ZHSA 3MRSA 3NDIA 1NVVR 5H4HA 3OAAD 5MF6A