4P33A

Crystal structure of e. coli lptb-e163q in complex with atp-sodium
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
235
structure length
235
Chain Sequence
ATLTAKNLAKAYKGRRVVEDVSLTVNSGEIVGLLGPNGAGKTTTFYMVVGIVPRDAGNIIIDDDDISLLPLHARARRGIGYLPQEASIFRRLSVYDNLMAVLQIRDDLSAEQREDRANELMEEFHIEHLRDSMGQSLSGGERRRVEIARALAANPKFILLDQPFAGVDPISVIDIKRIIEHLRDSGLGVLITDHNVRETLAVCERAYIVSQGHLIAHGTPTEILQDEHVKRVYLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Decoupling catalytic activity from biological function of the ATPase that powers lipopolysaccharide transport.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Lipopolysaccharide export system ATP-binding protein LptB
total genus 80
structure length 235
sequence length 235
chains with identical sequence B
ec nomenclature ec 3.6.3.-:
pdb deposition date 2014-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF12399 BCA_ABC_TP_C Branched-chain amino acid ATP-binding cassette transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4p33A00
3ADDA 3N2IA 2FZ4A 1NG1A 1ZNYA 4NCHA 2CLDX 2GZDA 2Z4SA 2EFEB 1JNYA 4URVR 3AF1A 4QNMA 1WB9A 4QRHA 5AUPB 3B7GA 3THWA 1DTSA 1P9WA 4QHTA 3R8CA 5A4JA 1Z8FA 4LK2A 1DO2A 1SQ5A 4G5SA 3SS8A 4LPSA 4MDEA 5K8UA 2E9SA 3UMFA 1M6NA 4C4PA 1XU4A 4JJKA 4MH0R 1XMSA 3SFZA 2C9YA 1ZBDA 1JXMA 2FSFA 3CF2A 4M1YA 4A1FA 3W34A 4GMDA 1OF1A 4TWZA 2C98A 3WMGA 2O8EB 2B8TA 3HYRA 1RRPA 2YC2C 2PEZA 4PSVA 3AM1A 5JS7A 1U90A 2EFCB 4DCSA 3ZJYA 1AN0A 2DFNA 3K0AB 4NCJA 1A7JA 3MSXA 2CDNA 1E98A 4HB4A 4JLOA 1CJKC 4C3ZA 2ZM5A 1A2KC 4XIGS 3REGA 4S35A 3KKNA 2ORVA 4ZPXA 1QHXA 2RCNA 4NTZA 2I3BA 1Z6XA 2GZHA 3P20A 4DDUA 1FPMA 1Z63A 4LJ8A 4MYCA 2JJ1A 4AKGA 3OEHA 4JBWA 4NCIA 4JLJA 1F2UA 4US1R 1SXJD 2JASA 4MRNA 3C8UA 1H65A 2QPAA 1KO5A 1G8HA 2F43A 4OI0A 1UBCA 2F9MA 4JVNA 4YC7A 2FX3A 4CEJA 3B2EA 4D4MA 2FFAA 2JJ2A 3M1IA 5L8VA 4X8OA 1GNQA 2FMXA 2YWHA 3AVPA 2NPIA 2Z6VA 1JPNA 4XSGA 1IN5A 1SVMA 1NSTA 5G3ZA 4FW9A 3RC3A 2F1IA 3ZZ0A 2NOAA 3EG5A 3CUEF 3PEVA 2EYQA 3K0FB 4P4SA 3FMFA 5IRCD 3ZD6A 3I62A 4B2PA 5CITA 1WQ1R 3L82B 1GITA 4BFWA 3ZLJA 1XTKA 1IXRC 5EZ5A 4HB0A 2XAUA 2QL6A 1MO3A 4US2R 3RANA 4UNRA 4M1SA 3LW7A 4Y0VA 1Z3IX 3VHLB 1N5LA 2ZJAA 3ZIAA 1KDPA 1X1SA 3IDQA 3G82C 3AGQA 2PCJA 1W0JD 5AK0A 2WJHA 4ABYA 2R62A 1ESMA 2XNDA 1UEIA 1EFRD 3EA5A 1M34E 3TAUA 3ADCA 1HT1E 1TNDA 3HYTA 4AWXA 1G6HA 2I1QA 1OFIA 1YU9A 4RZ2A 3BH7A 3W5IA 4Q1EA 2NO6A 4M53A 5JFGA 1OLOA 2OFXA 1E2JA 2N1BA 2XXAB 2KB0A 2J45A 4GP6A 3VNUA 3IIMA 1NVXQ 2JLXA 4TL7A 1PLLA 4PFSA 1N6IA 4Z8XA 3RS2A 1A4RA 1IN8A 1JQJC 2WWGA 3CW2A 3PUWA 4JLNA 3T15A 2ZRKA 4RZUA 2WAXA 5JHHB 2R8RA 3HU1A 3B1XA 3WMFA 4EUNA 4PAMA 1EX6A 3H1TA 4AKEA 4US0R 2AFHE 3NG1A 1XZPA 3WYAA 4JJZA 1BMFA 2PJRA 4A82A 1P60A 3NHBA 4PPFA 3THYB 1Q22A 4G5GA 5KSOA 3UKDA 1ANKA 4LYHA 4MKFA 2ZROA 2YKGA 4QGAA 2BIFA 3TH5A 3ZVNA 2ZRHA 2VSOA 3BB1A 3HR7A 4MGIR 3DVLA 4JSYA 3VR1A 1Q1QA 4DEYA 4AG6A 1GWNA 2P0EA 4ACBA 1CIPA 3IBGA 3QPUA 2ZE7A 3UG7A 4LBVA 4HDCA 1ZM3A 3KZ1E 1QRAA 4JVSB 4A92A 3K9GA 4EJSC 4WAUA 2ZU0C 4GOXA 3WBKA 4LSGA 4D4KA 1HQCA 1P2SA 4HAWA 2GA8A 1XBTA 2GETA 1VIAA 1F2TB 5G3YA 2ZJZA 3TVTA 4R71A 2MMCA 3U3OA 1VDZA 4IVRA 5HCIA 4GFDA 1W5TA 1E99A 2HT6A 2RGCA 3SYNA 2RHDA 3L2OB 2DR3A 4RY2A 3GLIA 3U4QA 4BLTA 3BIFA 2G6BA 4EQ6B 1UKVY 2QEQA 2IUTA 1FL9A 1S3GA 4Q48A 3TIFA 2VIIA 5LB2A 5F9FA 4WIAA 1E96A 4V02A 4XTCS 2OEPA 2OBNA 4KITB 4ASUA 4XWAA 1G9XA 5J5CA 2W58A 1XXHA 2FPMA 1Q1ZA 2HT1A 1ZRHA 3KB2A 3ZH9B 3IUYA 1KOFA 1H8EA 3KQHA 2RB4A 1OH6A 1JEEA 5EE9A 4DLSA 1NN0A 2ZUBA 5EE3A 2IEZA 1M1YE 1DAMA 1Q3HA 4JLMA 3AUYA 3GLGB 1KYIA 3UXMA 5DI3A 1JXOA 2A5DA 1KSFX 4NYMR 1HA3A 1IBRA 3LA6A 1UKZA 3SDZA 4QBFA 1KO1A 4BFUA 2W6JD 3KB1A 4H9GA 3U3JA 4FINA 2O8CB 3MLEA 1AZTA 2R44A 3RWMB 1CS4C 4HAUA 1GL6A 2ZUCA 4AIIA 1JPJA 2BCGY 4PC2A 5SZIA 1N0UA 1U98A 1NIJA 2V55B 2PEYA 5FR1A 4TL8A 4KVAA 4NMMA 4JBXA 1U0HC 1E1RD 4XSHA 1Z28A 4Q66C 3ASZA 1T9HA 3K9HA 3PEUA 1GG2A 1J2JA 1PUIA 3U2QA 2QAGA 4ARZB 4R9UC 5E4FA 4LRWA 4KFRA 2ASEA 2IWRA 2JLWA 4DLUA 1F2TA 2QUZA 3P4YA 1IM2A 2VHQA 1DPFA 2FSHA 4QJ3A 1R7RA 4V0ME 4BQSA 5C4MA 1N5KA 2HYIC 2BVNA 1W47A 3CZPA 3BFKA 4LOAA 2G0NA 3ZZTA 1E9FA 4UNSA 5AR1A 5JJKA 1MRSA 2J59A 2R9VA 1I4LD 1YRAA 3CLVA 3SU8A 2WPDA 5JS8A 3DKVA 1LS6A 1RRFA 4V0MA 1RJ9B 1ZJ6A 2IYUA 5DYGA 1E9CA 2NO0A 4WVFA 2NG1A 1W4AA 2ZRLA 2WTUA 5DISB 2P6RA 4HI0E 3T12A 4LI0A 3NXSA 3DEFA 2GILA 4OK5A 5JWRA 2Z0MA 3HR8A 5HE8A 2QZ4A 2XGJA 3R8FA 1V5WA 2WMOB 4NH0A 3SQWA 3THWB 2K5UA 2GCOB 1KKLA 1X86B 1M7BA 2QA5A 3CX8A 3SHFA 1YVDA 2BMDA 3M6AA 1G3RA 1UBFA 4B3FX 1JR6A 2YZ2A 4BFZA 1SXJB 3X1XA 1IXZA 2XTZA 1D9XA 2QG6A 2IC5A 2WV9A 3WP0A 3L0SA 2VEDA 2X77A 5AJYA 2OFWA 2DBYA 2H7VA 3OAAD 4KODA 1NMXA 2AFIE 2G3YA 1E2EA 1XTRA 2AKAB 2QQ0A 2ZJ8A 3K1JA 4U5XA 1HH4A 3D7MA 5HKKD 2ZAMA 4QBGB 3GCGA 1RJ9A 3EARA 2Q6TA 3LBNA 5AJVB 1KIMA 1KI6A 1ZU4A 5J4LA 2PBRA 2OG2A 4FMCF 4BFTA 2BMFA 4IDNA 1GNRA 1DEKA 3MCAA 4ERNA 4O2LA 2J1LA 3KUDA 1ESNA 2WHXA 3FMOB 4QJ4A 4GP7A 4KLZA 1ODFA 3QENA 2R65A 5KNBA 3IEVA 4EFNA 821PA 2QMUA 4OK6A 5D3QA 1I4DD 1PZNA 4TN1A 2O8FB 2PLFA 3GEEA 1HT2E 4FD2A 2AXNA 3R7WB 1XCGB 1OT3A 4NYMQ 1TEVA 2VO1A 1W36C 2PJZA 4NU0A 1KNXA 2V8OA 4PHFA 4CGZA 3K09A 4OI4A 4TMZA 3EZ9A 2HXYA 4UXJA 4D26A 1BS1A 1KDTA 2WZQA 4HB3A 4PPQA 1XP8A 4NCKA 4IXNA 2RMKA 3L8ZA 5UKDA 1SVIA 1XEWX 4RKEA 1G17A 1Q21A 3WY9A 3O8DA 1ELOA 5FBVB 1XD9A 2WAYA 2NPFA 5A0FA 4D2IA 4EFMA 2QP9X 5SZJA 4GRAA 5HKKA 3DOEA 1Z0JA 1N25A 2FE4A 1Z83A 3BH0A 4LBYA 2QU8A 3WP1B 1MO5A 4ZCLA 2Q9BA 2IF0A 4O25A 4QL3A 3H84A 5FL3A 2OHFA 3CH4B 2ZI4A 3QF4B 2F3TA 1EX7A 4TYQA 1L4UA 3ZQJA 1OIVA 4LBZA 1PLKA 4JIMA 1WRBA 3IILA 4KCGA 1OB5A 1NMYA 3X1ZA 4DEXA 2HF9A 8OHMA 4FCWA 1QBKC 2KI5A 1LTQA 2LWIA 4EAQA 2F1HA 1HYQA 4FCVA 2UZIR 2A30A 4GBMA 3UMRA 1NN3A 3GD7A 2CJWB 1N2CE 4QFMA 2WKRA 2V7QD 3ZS8A 3V4FA 3VR4A 4DLTA 3GP8A 1YE8A 4Q9IA 1FOEB 1ZNXA 3MRSA 2Q3FA 2VSXA 3PIRA 3B9PA 3W8RA 1IAQA 5EQTA 2C2HA 2HXSA 4TQ9A 1JR3E 3B82A 4MYUA 4NHOA 1F3OA 4JKIA 1TX4B 1BOFA 4O0MA 2W0SA 2VP4A 3LXRA 3KJHA 4MGYR 1DG1G 4GNKA 1N0VC 4M1MA 5JJIA 1FX0B 4LHXA 1HY3A 4BLRA 5G40A 2BKUA 1LY1A 1DAFA 4FMDF 1DE0A 2YHSA 3TUIC 4BE7B 2ZR9A 4W5HA 1TF2A 3EPLA 1A82A 5DNYB 3TBKA 3C4JA 1EGAA 5BN4A 4TLBA 2QTVB 2V9PA 1XJ0A 5CLLA 2H1LA 2GHIA 4WZ6A 2WJYA 1FMLA 1NN5A 2A5JA 4NZYA 3V9PA 5FL7A 2ODNA 1FUKA 5FPSA 2HDNB 1P2UA 4H1UA 2Z43A 2J0VA 3U61B 5TY0A 2IW3A 3GLHA 1QZXA 1A1VA 5GJBA 1OJLA 1R6BX 2WIBA 3WNBA 3QPVA 2OZEA 3O8RA 3GMTA 1CF4A 1CJVC 2B7BA 1IJEA 4OHYA 1UBGA 1BMFD 4IVQA 2WIAA 1C4OA 2CK3D 4OHXA 1XEXB 2IF2A 1OIXA 4JLBA 1TQ4A 4LDJA 3RSOA 5DGXA 1U81A 4TQAA 1WA5A 4BWYA 1SVLA 2P2LA 1E2GA 3BRWD 2BBSA 5E7MA 2KSQA 1OIWA 1E94E 4QOSA 4G1UC 1KSHA 1KAOA 4OQFA 1GRNA 2XOKD 1G19A 5AJZA 1JEDA 3NEYA 3P4XA 3U5ZB 1KI9A 3KDSE 1NBME 2W2VA 2C96A 1XRJA 5AUQA 4L9WA 1TF5A 4BZPA 1G8FA 4ZIRA 3KJEA 5CB8A 4JLAA 1TAGA 3TSWA 1P73A 1AKYA 1E9SA 2FA9A 3B1WA 3W3ZB 2CE7A 1NVWQ 1E6CA 1RFLA 1WCV1 1DELA 1X3SA 4ZKEA 1ZM2A 3W6NA 1G7SA 2H18A 1QHHA 4OKSA 1H8HD 4PANA 1KO7A 1EWQA 3LDAA 4MGKR 4E09A 1Z07A 4X8HA 5TVKA 1YZQA 2FFHA 3WYFA 3U7FB 3UWKA 1UADA 1Z08A 3RS7A 3B1VA 4BLQA 221PA 2OXCA 3O8BA 2KE5A 2ZYWX 4HUTA 3EPHA 1G5PA 2IYTA 4L8GA 3UK6A 4JZKA 1E0AA 2ZRPA 2CK3A 5EXTA 2OXRA 2H17A 5HZHA 1FTNA 1KI7A 1R10A 1S4QA 4WXPA 2IYZA 4C0QC 2ZYVX 1TADA 2IYRA 5GJWC 1CRQA 3EZFA 2PCLA 2BDTA 4RFSA 2YOFA 1PLJA 2Q3MA 3EWSA 1YKSA 1U94A 4AYXA 2J46A 2G77B 2GBLC 2EWVA 2IA5A 4E22A 4IRUB 3EA0A 1MABA 3TR5A 4NKRA 3U7GA 5DE3A 1HV8A 3TAHA 3PEWA 1P6XA 5J47A 1XF9A 1GZSA 3DZ8A 2ZR7A 5C2JB 4UXHA 1YZGA 3PUXA 3I5YA 4DB2A 1KJZA 5FTLA 2JJ1D 2PMKA 1E2KA 1M8PA 2JAQA 3OAAA 2XXAA 3VR5A 3DHWC 2VHCA 3X2SA 1P2TA 2GJAA 1H8ED 2W6ID 3H86A 3QG1A 3RABA 4JL5A 3W90A 1CKEA 2ZYTX 4G0NA 2H57A 4Q5IA 4DWJA 4X8LA 3GJ6A 1E2PA 3EX7C 2AK2A 1OXXK 1VECA 4ZCMA 1KI8A 1JECA 1E79D 4MQBA 4XTRA 1S9HA 3EAQA 2V1XA 3TNFA 4C9BA 2QE7D 5AWFC 1N6LA 4M1OA 1IN6A 1G3UA 2BBTA 2IS1A 1BYUA 1IY2A 1DBSA 2EW1A 2QSYA 4F92B 3AP2A 2QAJA 3RYTC 1NJGA 2WKQA 4LHYA 4UNNA 5IT5A 4W5WA 3P32A 1UFQA 4DCVA 4DDWA 1OKKD 4L5BA 2BBWA 2O52A 2J7PD 4EPVA 1RRGA 1ZUNB 3FMPB 2JGNA 4LYAA 3OZXA 4OYHA 121PA 5CK5A 2WJVA 1O3YA 2IT1A 4TZ6A 2ZITA 2I4IA 1ZC3A 1S96A 2NO7A 3CWZA 2P67A 4RFSB 2A5GA 3TVDA 1I2DA 1JI0A 4EPXA 1AS0A 1R5BA 4HDQB 5FPKA 1GDDA 4HAVA 1Z0AA 2BWJA 3VAAA 4LJAA 1KZ7B 3CF0A 3QXSA 3I1FA 3OEHD 3CRRA 1VCMA 4PC3A 3T06B 1VCNA 4KV9A 1R0XA 2GCOA 3OIUA 3KTAA 5G53C 4R7ZA 2IL1A 3QXHA 4AURA 4YMUA 5JMTA 2GCNA 1QVAA 2F6RA 3I72A 1ZINA 4TMVA 1ZM7A 3Q7QA 4QKQA 5J40A 3K9LA 3SBDA 4KSBA 1VG8A 2IYQA 5D3MB 3SFVA 2FG5A 3EC1A 4RCYA 3TR0A 5LPNA 4QHYA 1SZPA 2YNMA 4TMKA 4ZI2A 2WICA 1GRQA 1XD2A 1G1MA 2C9OA 1QG4A 3AVQA 3TRFA 1DVRA 1Q44A 1IY0A 3L0PA 4YONB 1OFUX 4K81B 2HLDA 3SE0A 4F4IA 2JEOA 3CIOA 2R6GA 1J99A 2A7QA 2DWOA 3EZ2A 4TT3D 4B2LA 2FV8A 2IEYA 3QF4A 2WMNB 3GJ5A 3TW8B 2FNAA 4AY2A 4D4JA 4A0HA 4L4UA 4CZ2A 1Y63A 4DXAA 5G41A 1KO8A 3MG9A 1G7RA 1RZ3A 3RSLA 4WW0A 1P75A 2B6HA 5IK2D 2ZTSA 4MDFA 4QBHA 3P27A 5DHAA 1JR3D 1R5NA 2F1JA 1W48A 3TQFA 4TYYA 3PCRB 4C30A 3T5DA 1E1QD 1NBMA 1Z06A 1KDRA 4TTQA 5KU1A 5L3SA 1WXQA 2NTYC 4UQOA 3PVSA 2EYUA 4N0DA 4RVCA 5CB6A 2J0UA 2B7CA 3A8TA 2MSCB 3LX8A 4URZR 2O5VA 2NZJA 1D6JA 4TYWA 2BMJA 1L2TA 3HP1A 1EXMA 2NGRA 2QT0A 1AS2A 3NBXX 2QROA 2IWHA 2TMKA 3K8YA 3W6PA 3A36A 1FX0A 3NH6A 4MRSA 1XFAA 3TK1A 3C16C 1L4YA 2VP2A 1YR6A 1E9EA 1QHSA 2ODWA 2YYZA 3B5JA 3HJNA 3N70A 4RJLA 3GJ8A 4DCNA 4FMBB 4Z1MD 5FOUA 2ZSBA 1LVGA 4QGHA 1FQKA 1KMHA 2D2FA 2B8WA 4OQMA 3S1AB 4XJXA 1BKDR 4F93B 2CNWA 5J4VA 2GESA 3TW4A 3KQUA 1JAHA 4KO8A 1E0SA 3UG6A 4KAXA 3VR3A 3QVVA 3WRXC 1KI6B 3BC1A 4NYJR 3VNVA 4Q9JA 2O0JA 2DCUA 3TLXA 4C0LA 3VX3A 1MO4A 2HCJB 1OKKA 4LJYA 2C95A 2YOHA 2BEKA 1JALA 2VP0A 4DLRA 3WMEA 4URWR 3IGFA 4M1WA 3NVAA 4TQUS 2RHMA 4JYBA 2RGNC 2GCPA 3KFVA 2RKOA 4B3XA 4GOKA 2ZE6A 1DO0A 5CYOA 4PTLA 3C7KA 4G5QA 4JBYA 1ZD9A 1OXUA 4FI3C 5JHGB 1E79A 1R5OA 5CLQA 4A4DA 2IX3A 5FTKA 2IYXA 4B75A 2B92A 3CB4A 5FUWA 2FSIA 2Q9AA 1EG7A 1FUUA 2KBEA 2RGXA 5LB4A 1RRCA 2BM0A 3IO5A 3GLHB 4ZV4A 5B57C 4G5OA 2GK6A 1GILA 3QUSA 2ZJYA 5FBWB 4P4UA 1F60A 2C77A 1NBMD 4DDVA 2WPDD 2RH5A 1KTVA 3HU3A 4OQXA 2Q3HA 2ZRDA 5KSPA 1T3HA 3DMNA 3FFBA 3NDBB 4LJ6A 4XVUA 4J0QA 5BXQC 3CPJB 4EKDA 3QE0A 4XVRA 5F2EA 1FP6A 1YZUA 4YDHB 3GFTA 2A9KA 2OM2A 2CL7X 3FOZA 3E2IA 2NO9A 3OIWA 4TYPA 2ZSEA 3A6PC 3NEJA 3W3AA 4IVPA 3VMFA 2VP6A 3CONA 4TT3A 1R0WA 1ZCBA 2BCJQ 1T3SA 2AD5A 2FSGA 3SBEA 1ZNWA 2PX3A 3SJAA 3T1QA 4E5UA 3BGWA 2IYSA 3AQ4A 1Z0KA 2FEOA 2XITA 4HZUB 5K8LA 3BBPA 1E1RA 1X6VA 3JVUA 2V6IA 3VKWA 2VP9A 5TV2A 3KJGA 3LXXA 3GLGE 1P2VA 2R6AA 5B2ZA 2EWWA 4ARZA 3LX5A 2JIZA 4MKHA 3GLFA 1GL9B 2IK8A 3AVWA 1ETUA 2GF9A 2SHKA 4R2IA 4OHZA 4C2TA 2J7KA 2C9CA 1GP2A 1GSIA 1TMKA 1E4VA 5EZ6B 2WSMA 2IYWA 2XB4A 4GT1A 5L3SB 5LD2C 2E1RA 3A1TA 5M04A 4TMTA 3A58B 1YZTA 1XPRA 4LV6A 4HEJA 4L15A 2A78A 1F48A 1PUJA 3LW8A 1PV4A 2IYYA 3AV0B 2ZRGA 4OL0A 4M1KA 3PEYA 2JLRA 3BERA 3OESA 1G20E 1KK2A 1N6RA 4EJSB 2J0SA 4MGZR 5FOTA 1H8HA 4GPTA 2YWFA 1S0UA 1ZIOA 2LKDA 5FPTA 2W0MA 4D0NA 1NVUQ 3QOFA 4GOJA 2GAOA 3GJ4A 3NDPA 3WBJA 2ZRCA 1U9IC 4Q1CA 3ZVLA 1V43A 5FUYA 1IOZA 4JSTA 1R4AA 4DSTA 4BECA 3JVVA 2C78A 5BQ5A 1CLUA 2OUKA 4PQRA 1CJUC 4BRWA 2W2XA 4B6EA 4CT5A 3DM5A 1YJ5A 1OXVA 3LO5A 2H92A 2OILA 5FH9A 4XH9B 5FPHA 3TMKA 4Q1AA 2QP3A 2P65A 2QENA 4I4LA 1SKYB 2D2EA 2JLVA 4DIDA 5EUQB 2AX4A 1G4AE 1MR3F 4QGFA 1G6OA 2AHOA 2QE7A 4KSCA 2OCPA 3ZIAD 4JL6A 3TSZA 1Z2CA 1E9AA 2WOJA 3SJBA 4PXAA 4TSFD 5EP2A 1MT0A 1Z6AA 1I4TD 4OJKA 4ASUD 1OSNA 1W0KA 3A1UA 3FHOA 1MKYA 3SI7A 3VKHA 3AVVA 3QF7A 3H0KA 5FI1B 1OH7A 5DHFA 2RGNA 5JEDA 3D31A 2WKPA 2ZJBA 3NH9A 2ZI3A 3QSYA 3AVXA 2FH5B 3EC2A 4Z51A 1L7VC 1O87A 5FTNA 4KFUA 3T61A 2QM8A 3PFIA 4HUQA 4HB2A 4LZZA 1XMJA 2RGBA 1Q1EA 4Q4JA 3K09C 1M7GA 2ZS9A 4IDHA 4Q01A 5ANRB 1NKSA 2CHVA 2G9NA 4B34A 5H70A 3BORA 3WXMA 3CNNA 3AF3A 2CLCX 3SR0A 1Q0UA 3W6OA 2VRWA 1Z0DA 1VCIA 3AKYA 4DZZA 5J4HA 1F2UB 5HCNA 2XSZD 1D2MA 4DVGA 1ZM4A 4MRPA 5JSZB 4B76A 1P5ZB 2OO7A 1VKJA 3AF2A 5GJCA 4LYFA 3SYLA 3K70C 2VYFA 1NN1A 3SOPA 3WHLA 1JR3A 3ZZUA 4MYTA 3P1JA 3E5HA 4ZI3A 5F3WB 2MSEB 3QVUA 2D3WA 2D74A 1KJYA 3RRNA 3DM9B 4JLKA 1XTJA 3VR6A 4BRUA 4JKYA 3SJCA 1G3MA 4YXWD 1P9NA 4DLZA 2F3RA 5TARA 2WVJA 4RCZA 2WJJA 2OAQ1 5TXGA 2X2EA 3VTKA 2WWXA 1P3JA 2ANBA 4EFLA 4M4SA 2CEAA 2AXPA 3LD9A 1ZYUA 2W2TA 3CRW1 2B21A 1VIYA 2IXGA 2G0TA 4LHVA 1OV4A 2FFBA 2R6FA 3AF0A 2HF8A 4OQNA 4Q9HA 3PUYA 3A4NA 3K70B 3FDIA 3KFXA 3I5XA 2GF0A 3AGPA 4QGGA 4KHZA 4H1VA 4Q9LA 5JJLA 1CRPA 1G16A 1MRNA 2R6DA 2X1VA 2Z83A 1TUEA 2XOKA 4DT1A 5KPDA 3W5JA 4BZQA 2RGDA 3TUJC 1KI2A 4JVMA 3FVQA 5IF9A 4TL9A 3D3QA 4JLVA 2RAPA 1GNPA 2YWGA 3RRZA 2QORA 4F4CA 4Q47A 4IFEA 1US8B 1COWD 2WM9B 2ZUDA 1X8JA 4D80A 3Q5EA 1BO6A 2ZVQX 1CR1A 1R8QA 1N6HA 2ZANA 3ND9A 1Z6GA 3EIQA 4B6FA 2GJSA 3UPUA 4URXR 4ITRC 4A0RA 1KKMA 4OHVA 4HLDA 4IDPA 5FBLB 3U7EB 5B58C 1CEEA 3MAAC 5BN3A 2ZRNA 3U7HB 2EQBA 3EZ7A 1J90A 4JLPA 2HEIA 1ZMXA 5GJVC 5FL7D 2GNOA 3GLGA 4MYHA 3ASYA 5E95A 2UZ3A 2FGJA 1S2MA 4URUR 4HZUA 1KY3A 2XZLA 3U3MA 4AD8A 3GEIA 1GOTA 5DSZA 3QKRB 1CR2A 2R6CA 3OFNA 4ON9A 1NRJB 4W5JA 4GZLA 5TMPA 2CLSA 4X8MA 4EPWA 2RGAA 3FFAA 3IBYA 4LUCA 3GFPA 1D2NA 4PO8A 4MRVA 3RRMA 5GADl 4HDOB 3KQKA 4CDGA 1R0YA 2IUSA 3LVRE 2O0KA 3MWYW 4MKIA 5JLJA 3IPXA 1ZNZA 3FGNA 2QY9A 3FWYA 4IEIA 3O47A 1CJTC 2ZPTX 3U3RA 4A36A 4D25A 1G8YA 4R2HA 3Q8XB 2ORWA 1ONBA 5EUMA 2BV3A 3J81k 2ZU6A 2F43B 3AKDA 4KVGA 1CBUA 1DADA 2OESA 5JRZA 3QI2A 1VYUA 1JJVA 1GIAA 1NVVQ 1E2FA 1QHIA 5JZVA 1A2BA 3ONWA 4M9SA 3K53A 5TDHA 2QM7A 3LBHA 4AYTA 5K8IA 4KYIB 4TMWA 2EFHB 4DBLC 1RIFA 4EQ6A 4PZLA 3QEOA 2CHGA 3ADKA 5SZHB 4Q7LA 1NMZA 1Z2AA 4IDQA 3RWOA 4YMVA 3LAWA 1WP9A 2D4HA 1GM5A 2YC4C 4OK3A 3WYGA 1X8LA 1S9DA 3B78A 1RE0A 5JI3E 2ANCA 1E0JA 3IKJA 4Z1MA 4DHEA 3M0EA 1NJFA 1Q20A 1QHYA 2ZSAA 3MJHA 5L3RA 3CR7A 3X1WA 1NLYA 3I8XA 2DYKA 1RVDA 2OBMA 5DI3B 2Z5FA 5CDFA 3X1YA 2DB3A 4KFTA 4Z54A 5KSYA 2I1VB 3GJ0A 2GEDA 4IOJA 2QT1A 2J7PA 1D9ZA 4KJZA 3OFND 3ZVMA 2WSSD 1S1MA 3DL0A 3F0TA 1LS1A 3K70D 4W9MC 3G5UA 4Q1DA 4NBSA 4MUBA 1ZU5A 3FHTA 3LY5A 2WWFA 4BZXA 4TTRA 4B35A 3QKTA 1QDEA 2X8AA 3BXZA 4IFBA 5H1YA 1UEJA 3CF6R 6Q21A 5EE1A 1G21E 2JDID 5KDOA 5FTJA 1IY1A 3PXGA 3GLIB 2OLJA 1LV7A 3GJ3A 1FP7A 1W2HA 3Q72A 2IS2A 3CWQA 4IOLA 4EJSA 1KMQA 1HEIA 3VU9B 3QQ5A 3HPQA 2OBLA 1RPZA 1TUIA 2W6IA 4RZ3A 2XZPA 2ZI6A 4Q9KA 4D81A 2FFQA 2CL6X 3AKCA 4NYIR 3TGPA 2CVFA 2GJ9A 2ZS7A 4A6XA 5JBQA 5JWOA 2CCKA 3RAPR 3VFDA 1XMIA 3SQXA 3W9YA 4EPYA 3QXCA 5KNDA 2ZRIA 1KSGA 4PO1A 4W7SA 3PR1A 1E69A 5D3MA 1FQJA 1MV5A 5AJXA 2N42A 2ONJA 1J7KA 5IDVA 3NWJA 2ZRBA 3SZRA 1EFUA 5KTYA 1N3BA 4CT4B 1AQUA 5A5GA 2XNDD 2OAP1 1FNMA 4U7DA 3MD0A 4V0LA 3GJ7A 1U0JA 3BH6A 3ZVRA 3AP3A 3FPAA 4A2QA 2YJTD 1SXJE 5C18A 2CL0X 3QIAA 3F8TA 3ND8A 1II9A 1YHNA 2JLQA 4NE2A 3IQXA 2J3EA 2QBYB 4Q4LA 1DS6A 4JT4A 3GLIE 4KXFB 2AWNA 3B8HA 2VTKA 1KI3A 4UJ3A 2V1UA 4ZCIA 521PA 2ZRJA 1T6NA 1SKQA 1UDWA 3OIVA 1WDTA 1YRBA 3FKSD 1XPOA 5KOYA 1SXJA 1CR4A 5CM8B 3Q9LA 3SN6A 4AG5A 4QBIA 1LB1B 1KK0A 2ORIA 4TTPA 4UNPA 2O8EA 1Z47A 1XEWY 3F5FA 4AKHA 1UF9A 4PAQA 5DI9A 5EP3A 4IOMA 2GXUA 1T8TA 1Z5ZA 4N3NA 2CVHA 2O0HA 2FPKA 1LF5A 4A9AA 2JATA 3LLMA 5C1BA 4DSUA 4LHWA 3TQCA 4A8JB 4DCTA 2ODBA 5CIWA 2GXSA 2V54A 3RHFA 4Q7JB 3BK7A 2VHUA 4YMTA 1FW6A 4M22A 4G3XA 1W2GA 3EASA 1I2MA 4NPHA 1WBDA 3MWKA 5FTMA 2ATXA 4NL4H 5KO2A 1KAGA 2BKEA 4OQLA 1TU4A 4P31A 2IUUA 3RVBA 3V00A 2FPLA 3UWOA 3PUZA 3THXA 5KDDA 3N5CA 5CYPA 3KL4A 1ZIPA 1DAEA 1RC8A 4CVNA 1KMHB 2Q21A 2ERYA 1G8GA 2BOVA 3MGCA 2FZLA 4ESHA 2ZSDA 1SVKA 2A5FA 4Q4HB 2Q9CA 1K5DA 1COWA 4B3GA 4PC1A 4UKDA 1K6MA 1DAKA 3U4QB 1AQYA 1ZAKA 3RS5A 2XJ9A 2XSZA 3T1VA 4M8NE 1G291 4A8JA 4IXMA 1AK2A 1CJMA 2EU8A 5LDDC 2C8VA 4DRZA 4LWZA 3HPRA 2DY1A 1XDBA 2GRJA 3NC0C 1EK0A 1OH8A 3X1DA 2OSBA 4DLYA 4BLSA 4OHWA 2GTPA 1XEXA 3FB4A 2FF7A 4PC7A 2IS4A 1XCMA 5L3VA 1G3IA 3K0SA 1OHHD 4QM6A 2AD1A 2NQ2C 3R9WA 4KU4A 2FGKA 1X8KA 4LJ7A 1W0KD 1NLZA 1QG2A 5C4GB 4F91B 3E70C 2PZFA 1W4BA 4LBWA 4B48A 1AJEA 1US8A 1ZD8A 3IHLA 5H68A 2GBLA 2OFOA 5E3HA 2ZAOA 2BEJA 3EIEA 2VBCA 5IK2A 3GLHE 4LC1A 1OXTA 1II0A 4P0TA 2V3CC 3VHXA 1R2QA 3QEJA 2ZRFA 2ZE8A 4B44A 4LV8B 3TKLA 2BM1A 2VA8A 3I8SA 1DAHA 3JZMA 3BFVA 1NSFA 1G7CA 1ZC4A 3VQTA 1ZVQA 2CCGA 1XTQA 1N6KA 1XNJA 2D7CA 2VHJA 2DFLA 3I4LA 1XTIA 2BJVA 3LLUA 4LX0A 4I1VA 5DLQC 1UJ2A 2UKDA 3BOSA 2GVDC 1II8B 4BFXA 3SNHA 3WHKA 2UVQA 421PA 4PQYA 5DN6A 1FNNA 1UM8A 2ZJ5A 1TF7A 1D5CA 1UAAA 5F9HA 3LBIA 3SHWA 4DLWA 1Y3AA 2XEXA 3QBTA 4WZAE 1N6OA 1VTKA 5EE0A 3KQNA 2QTHA 1VMAA 2NO1A 1YZNA 1W0JA 3NKVA 2HUPA 3RLFA 2HJGA 2ZQ5A 4M9ZA 4XWKA 1GVNB 3BE4A 4AK9A 1DG3A 2E87A 1SGWA 1GTVA 4II7A 2Q0HA 2JLYA 5HPYB 4LJ4A 2QMOA 5FOXA 2HYDA 1VG1A 4S2EA 1AM4D 4K46A 4QG7A 4PX9A 1G8PA 1MH1A 4I99A 2H5EA 3LVQE 1AS3A 2IBMA 2CE2X 3T34A 4LV5B 1HTWA 3RS0A 3WRYC 2PZEA 1U0LA 2NMVA 2Y8EA 5CJ2A 4DDTA 1M74A 3O8CA 1OFHA 3BFXA 1HE8B 3BAFA 3SEAA 2CXXA 1XXHB 3BD9A 1E2MA 3PQCA 4UJ5A 1JBKA 1NVVR 2QRNA 1CP2A 3AB3A 1XXHE 2C04A 2PMDA 3FKSA 3OIYA 4G5RA 2DPXA 5L3QB 2X2FA 1P4SA 3EIHA 4TYNA 4C7OA 2WWIA 4A6PA 4P4SB 4CEHB 2KJQA 2P5SA 5SZKB 2GZAA 3CBQA 4BGDA 3ZDQA 4OI2A 4AYWA 4TSFA 4KBGA 3KTAB 3CNLA 2ECKA 4HLUA 4JL8A 3KXIA 1TPZA 2EVWX 1II8A 1BIFA 1XTSA 2OE2A 3Q7PA 4JT2A 4DCUA 5GVSA 4UNQA 3TSOA 2DHRA 3NC1C 2PLRA 4BUJA 4RD6A 1XPUA 3GEHA 4CRWB 4Q7KA 5AJWA 4N1AA 4TMXA 2OCAA 1QHGA 2AKYA 4V03A 5FBRB 1CTQA 2MMGA 4MA4A 3GLFB 4NP6A 3B60A 3LQQA 3NTUA 4ILEA 1NLFA 4EIWA 1EWRA 2QGZA 4P4TA 4D0LB 4WOPA 1S1CA 1GFIA 2ZI5A 3W8NA 2ZXUA 3VU9A 1Z6YA 4AC9A 4F4JA 2BC9A 2GK7A 3T35A 1IN4A 3B85A 4V0NA 1JJ7A 3DPUA 2O8BA 2ZI7A 1G5TA 3ICEA 1ZCAA 1KK3A 3I92A 4RKFA 4A8JC 3CX6A 3KKQA 1P7CA 4HATA 4KBFA 4YXWA 1OFTA 1WBBA 1XZQA 2XB2A 4LC0A 1OB2A 4ZDKA 3TJZA 4ESVA 1KI4A 1P62B 1R8SA 2DFKB 1QF9A 3AF4A 4L9SA 3QY0A 1N5JA 1B23P 3AKEA 3R9XA 4DUGA 4LHZA 1M2OB 4BFSA 4IOKA 3Q5DA 1UKYA 3QKRA 1OPXA 1Z29A 1W46A 1KK1A 2ZS8A 1BYIA 1GKYA 1VG9B 1Q12A 3QPWA 2JIZD 4IHQA 5CJPA 1OYYA 4Q00A 1HE1C 4LY6A 4B47A 3IHWA 1E2NA 1T5IA 4RZXA 1TQ6A 2XNSA 3BB4A 2QBYA 2O8DB 2RGGA 3E1SA 2C99A 5K8TA 1P72A 2JLSA 5FFMA 2WWYA 5LD2B 4OI1A 2JLUA 1RYHA 4HSEA 2WWWA 3LV8A 4Q18A 3EXAA 4EDHA 4U02A 2H8KA 3A4MA 4N0EA 2J0UB 2R2AA 4E07A 4IW3B 1OW3B 4OJQA 4Z8YA 3MWLA 2YOGA 1T3LA 5CK4A 2ONKA 5KUTA 2W00A 5J4YA 2GVZC 5HZKA 1AIPA 4B43A 4U00A 3BS4A 2QAGC 3RDPA 4HAYA 1FFHA 4PO9A 4B3BA 3LFUA 4GZMA 1KSJA 2L0XA 3RS3A 1E2QA 2JDIA 2PL3A 5FI0B 4HZIA 2VF7A 4XOIA 2QP4A 2JLZA 3CNOA 1GRRA 3KXKA 2CBZA 2D7DA 4Q4AB 1U8ZA 5EXSA 3NBYC 3RNLA 2GAAA 4BEJA 5TB5A 4D82A 4GL2A 4HAZA 4DB4A 1E3MA 3C14C 4HUQB 2ZI9A 4C0KA 3ECCA 4NDZA 2WSSA 1MO6A 1UDXA 1ZW6A 1NG9A 3SC3A 4GDFA 1IQPA 4D6PA 4PPNA 2ZRMA 1QHHB 1GUAA 3Q3JB 3I73A 1C9KA 1E2LA 1ZD1A 4A0GA 1OYWA 4BFVA 3LH5A 3R20A 2X19A 3THOA 1DAGA 3THYA 1SULA 1TU3A 4YMWA 1E9RA 3A4LA 2WOOA 3R7WA 4PZYA 3WNCA 621PA 3PITA 5B30A 5EXXA 5KNCA 3ZD7A 2V7QA 1W44A 2ZETA 3C5HA 4PZZA 4DLVA 1HURA 3LNCA 3S1AA 3BWDD 4CYMA 1C1YA 2DWQA 1WE2A 4CW7A 2AN9A 3AP1A 3D6TB 5KDLA 4RSGA 1KJWA 3K0CC 1WMSA 4PHTA 2BMEA 3A1SA 2N46A 4TZ0A 4C0BA 2CNWD 5FOWA 1YQTA 1GKIA 4AI6A 1J70A 3OE7D 3MWJA 3CRMA 2JCSA 4A2PA 1E4YA 4EPRA 3BB3A 4Q03A 5KHOC 2OCBA 2A3RA 3ZYCA 4BASA 1SVWA 3U60B 4C2UA 3CO5A 1KHTA 1E1QA 3LRPA 2ZR0A 3PG5A 1QHNA 2J0QA 2REBA 4HLCA 4LJ5A 4PSAA 2IYLD 2PT7A 4I1OA 4R98A 4DC9A 4BLPA 1L8QA 4BLOA 2OV2A 1E0KA 1E9BA 5BW8A 3QXXA 4RD0A 1XJCA 1DARA 2XZOA 2V6JA 1T0JB 1DAIA 4Q7MB 5LBIA 1CR0A 4ZDJA 1VPLA 4YLGA 4JMPA 1YZLA 4KI0A 4B32A 3B13B 5FOSA 4M1TA 1EESA 4FMDB 3CPHA 1N6NA 2XTMA 4Y0AA 1DOAA 4NYJQ 4DIEA 1CULC 3ETLA 2GEUA 4Q1FA 1FTSA 1W36D 2ZRAA 2VPPA 4V0OA 5JCPA 1W1WA 1ZUIA 1F6BA 5CM9C 3AUXA 1T5LA 1G5RA 2ZREA 1VG0B 4F38A 3CH5A 2D62A 2YINC 1N6PA 2O8DA 5JCZA 1VHLA 2AK3A 1LF0A 1J8MF 2GXQA 3C15C 3KJIA 4IDOA 3EWAA 3B1YA 1R0ZA 3NIBA 4HAXA 4WZBE 4PHGA 1P61B 3HDTA 1EFHA 1JB1A 3ZGXA 1E2IA 4A0FA 2CHQA 2A5YB 2V4ZA 3FTQA 2QNRA 4IEEA 1BH2A 3FYHA 1AZSC 1SHZA 1TQDA 3C41J 2ZIAA 2BJWA 4B74A 2F55A 1YR9A 4MRRA 3GJXC 1FMJA 4CEIA 3U6BA 3TUZC 1GAJA 4KLNA 4DT1B 4I1SA 2ZYUX 3RRYA 3CZQA 5FUVA 3KKOA 1EFRA 5EE5B 2IHYA 5F98A 3I32A 3GPLA 2JJ2D 4XVQA 4C0JA 3CRQA 1S3SA 4KYUA 3REFA 1N0WA 2J5XA 4TLDA 1SVOA 3THXB 1VYVA 2ZJOA 3A37A 3EZ6A 1KDOA 2J41A 2J87A 3I3SR 2QMHA 4JYCA 4TL6A 4NONA 3UATA 5JRJA 2AWOA 2HJVA 3L43A 1U8YA 2O8FA 4LPKA 1T8UA 3FMIA 1W36B 2P5TB 2MSDB 4MITA 1Q57A 2F7SA 2O8CA 4WA7A 2DFTA 4M21A 1W5SA 4WBSA 4P32A 1UKEA 1A5TA 1GL7A 4PR0A 3U6KA 3QNUA 2AL7A 5EXPA 1OH5A 4ZDIA 1D2EA 2QTFA 1F5NA 1XEFA 1E32A 3NBZC 4HLQB 3FHCB 1EFTA 3CKLA 2YWEA 3K9NA 2ERXA 3V4RA 1KGDA 1VYTA 2QQEA 1U2RA 4LJ9A 2BBOA 3SJZA 2HV8A 2G88A 3DZDA 1WF3A 5J4KA 4A2WA 4QHSA 1XB2A 4B3CA 5DO9A 4ACAA 4OBEA 4CEJB 2GJKA 5AUOB 1G7TA 1W7AA 1XX6A 2CMKA 2W6JA 3DDCA 4IKEA 3DO6A 4Q19A 4LYJA 4Q4HA 3D8BA 1JQLB 5FUXA 4EPTA 1T91A 3AH8A 1NY5A 3KKMA 1QVRA 2OCYC 2VLIA 4FWIB 3L0IB 4Q4JB 2P6NA 2IHBA 1NF3A 3UIEA 2G83A 2OLKA 4B71A 2GWHA 4O2RA 4ZDWA 4BPBA 3IO3A 4B2IA 1IHUA 3QJYA 3BJIC 1IONA 1T4GA 5JI2E 4G01B 1SHKA 4URYR 1TEXA 5JSZA 3AVOA 3PUVA 3RC8A 4QJ5A 3VKGA 2D06A 2ZJ2A 3QKSA 3SYKA 1Z0FA 4WXRA 3IEUA 2BHRA 3T5GA 1CXZA 2PZGA 1AKEA 1NI3A 3LQRA 4PPGA 1ZP6A 4YQFA 4FWTA 3KUCA 5DN6D 1SXJC 2QRZA 2KWIA 4JLDA 4POAA 4B3DA 4LGMA 1S8FA 1YR7A 5FR2A 1OE0A 2QI9C 5ELXA 2GKSA 2WWHA 4B33A 3CX7A 3RS4A 4RD4A 4BEBA 5C46F 4C0HA 4V0KA 1U9IA 4GSYA 1NKTA 2LKCA 4DSOA 4E03A 1J8YF 2VP5A 2ZVPX 3H2YA 5BYJA 2P3SA 4P3YA 1IXSB 3KXLA 3QG5A 3ICQB 2VQSA 4TLCA 4ZO4A 3U3KA 4PAOA 5EP4A 3M4YA 5HE9A 3I61A 1U8AA 4PQFA 1G64A 3EPKA 4XD7A 2IXFA 4Q4AA 5FPYA 1OXSC 2ATVA 1ZM9A 3CR8A 3DOFA 4QXAA 4KFSA 2PH1A 4M0LA 4D4LA 5P21A 5FBQB 1TL7C 4XWOA 2H16A 1XWIA 5IHPA 1NP6A 3KX2A 4LCBA 4CEIB 3HU2A 4YMSA 3EPJA 2QGNA 4QC2A 1M7HA 3MMPA 3IIKA 3B1ZA 5KYKA 2J9RA 3OEED 4FIDA 4B73A 1T0HB 2JA1A 3H4MA 4AKIA 5EJEA 1HQYE 1NL3A 1YR8A 5E7JA 1NNEA 4PSKA 3K0EA 3F3YA 5BYKA 3QXJA 3MFYA 2RGEA 2ZE5A 1PJRA 1X1RA 1SVSA 3CRVA 3K0CA 4ZIRB 5JEEA 5KPJA 3B6EA 2OT3B 3WNDA 2REXB 2PT5A 2VHTA 3L0OA 3EW9A 4GI7A 5HTKA 1E2DA 1Q1BA 2AR7A 1AA9A 2QN6A 4Q1BA 5FOVA 5BN5A 1G18A 4I1UA 2C5LA 3GQBA 4RD3A 3K0FA 3LWNA 3NBFA 4M2LA 3UANA 1Z0IA 2ODEA 3HWSA 1W4RA 4K8OA 4MUAA 3NHAA 5E7IA 3FKQA 4DLXA 3CPEA 5HR5A 5JWHA 5DIFA 4NYIQ 4BFYA 3Q85A 4FCTA 1U99A 5B64A 2F9LA 1XD2B 2EFGA 3IIJA 5L3QA 1KZGB 1Q3TA 2GEVA 4I81A 1MOZA 4HLUC 1XCPA 4CEHA 3T1OA 5GVRA 4RD1A 4DUGD 3G0HA 2GDJA 1KNQA 1ZUHA 3AVYA 4JVLA 1N5IA 1UPTA 5EP1A 3MUFA 3QKUA 2A2ZA 3PV0A 1TTTA 2G1JA 2P6UA 2QMEA 4CIDA 3N2EA 5H8WA 1Z22A 2G1KA 2F1RA 1E2HA 1KY2A 2DWPA 1TQ2A 2JJ8A 4RD2A 1AGPA 721PA 3ADBA 1CU1A 3B9QA 3L8YA 4DSNA 3DMDA 1XMVA 5KSZA 1XJQA 1HUQA 4YDSA 2GXAA 1SKYE 3IPYA 3PENA 4C0AC 2WJGA 4IJMA 3OF5A 3OEEA 4DKXA 2LCFA 1RW4A 4Q21A 1NIPA 1K8RA 3FE2A 3ZS9A 3AVUA 1GKUB 1LFDB 2XJ4A 1KI1A 1IJFA 4FXPA 4F7WA 4M9XA 1G41A 3VX4A 2NIPA 5CDFE 1KO4A 2FWRA 1G4UR 2WJIA 3KQLA 4M9QA 1D8TA 4D0GA 3AVTA 2KBFA 3A1WA 1W4CA 4JS0A 3GLFE 2YVUA 4HYYA 1P9RA 4PHHA 3JZAA 4O3MA 3VR2A 2YV5A 4CF7A 2QPTA 2ZEJA 4UXIA 2XTNA 3P26A 3C5CA 5CIQA 3PJRA 2PX0A 5DH9A 1K5GA 1RYFA 4RFVA 3TE6A 2FU5C 1UBEA 3U44B 2HLDD 1FZQA 2W83A 4GMXA 4QNRA 5JECA 4A15A 4NCNA 2FDCA 2VL7A 2VSFA 2WBLC 4FMCB 4P33A 3UMSA 4C7OB 3R9IA 3CM0A 3MJRA 2IS6A 3IQWA 2NZ8A 3K0AA 1W49A 3AEZA 4DJTA 2CCJA 4FN5A 1PVOA 1VHTA 2REOA 1EFCA 3OE7A 2QAGB 2ZSFA 4XD7D 1G3QA 2FN4A 3KKPA 2IXEA 2QPOA 5BWMA 1MABB 4ZKDA 1Z6TA 1B0UA 4MKGA 1VCOA 1E9DA 2FOLA 2HCBA 2GJ8A 4PC6A 2VF8A 3DKPA 2EFDB 1XD8A 4C0SA 4TLEA 5DYIA 1IN7A 4Q02A 1YZKA 4L16A 5AUNB 1AGRA 2FEMA 1LNZA 3QBVA 1OHHA 2C03A 2FJUA 3QKSB 1LW7A 4QM7A 2Z4RA 3T1TA 2IYVA 2QSZA 2O8BB 3OHMA 3GFOA 1NY6A 1RKBA 1JAIA 3ZQ6A 3U44A 3A1VA 4TLAA 2XX3A 2CJWA 2VH5R
chains in the Genus database with same CATH superfamily
3QY9A 4BS9A 3ZY3A 3DR5A 1VLMA 1DQYA 4QUJA 1ZNYA 3MBIA 1T2VA 2CLDX 2GZDA 3IUBA 1MX9A 4CMGA 4URVR 4AZ0B 1T1EA 3HA2A 2WP0A 1W8IA 1S2OA 3KQPA 4XIFA 2I7XA 1KQ3A 3F7NA 3B3GA 4BCDA 5BV1A 3HWWA 1DTSA 4MEJA 4GR5A 3TZHA 3V4OA 4CFYA 1P9WA 4QHTA 1P5HA 2D2IA 1Z8FA 4RA6A 4LK2A 3RTDA 1SQ5A 3UB2A 4X60A 3WK8A 4BNVA 5J3JA 2E9SA 1E59A 2QE6A 3UMFA 5LP1A 3I01A 4U2DA 3UAOA 1I01A 1TZMA 4P7JA 3RTBA 3HBFA 1TM5E 3P9IA 1XMSA 3FCOA 3I3OA 3C1OA 5E9WA 1UPXA 3SFZA 3ANXA 1ZBDA 4J76A 3W3AD 1IU9A 3CF2A 4KWTA 1OF1A 1M0WA 4BTLA 3HYRA 1RRPA 2FWPA 1YFZA 2GR9A 2Q5IA 3HQ4O 3K15A 3ZEAA 2P4QA 4HDRB 3FCXA 5F7ZA 1M0EA 2FSPA 3K0AB 3EGDB 4H6XA 5IBPA 5A5EA 2O59A 3MSXA 1IUPA 1CJKC 1KXJA 1UBTS 1EFVB 2NW6A 2IUFA 3DAGA 2IVFA 2VF5X 4YMIA 5FWXB 3TLBA 2FR0A 2B5OA 2ORVA 3IDAA 4YA6A 2P62A 3QFTA 2I3BA 1W5AA 1Y3FE 1Z6XA 1U8FO 4LJ8A 1WY5A 3ZWBA 2JJ1A 2GM5A 3OEHA 4X6YA 4NCIA 4OHOA 4BNJA 4US1R 2JVIA 3FD8A 4W5RA 1R0SA 4MRNA 3C8UA 2QPAA 3NHRA 4RTMA 1MTOA 3V8NA 2JBWA 2J9FA 5EMKA 3HSKA 1UBCA 3DFZA 1DU4A 2F9MA 4JVNA 1JEYB 2FX3A 3G8YA 3B2EA 2YN0A 3FJOA 4R2LA 1L4FA 4B9AA 4D4MA 3L1IA 2FFAA 3U5TA 1ADJA 1G6Q1 2YMPA 3QE4A 1F8UA 3AVPA 5JC8A 4RF2A 5IVHA 3SM9A 5REQA 5JAIA 1QV6A 3SHVA 4AULA 1R66A 1L3CA 3ADPA 5HYVA 5TQ2A 1D4FA 3PNSA 4E2WA 4EEZA 1TQHA 3EG5A 5IRCD 4YMHA 2EYQA 1DDIA 3I62A 1T4MA 5EJIA 1T6ZA 1GITA 1B8UA 1G21A 3KQYA 3L82B 2JD0A 4JU9A 1AGXA 1IXRC 3HYCA 3JWGA 5EZ5A 3L6EA 3RSQA 3PSHA 1V0JA 1QFZA 3F5MA 3I9KA 2HU5A 2R8PA 3ND6A 2JGMA 1Z3IX 2WYWA 3VHLB 4GKKB 2ZJAA 2OENG 1KDPA 2CD9A 2LNDA 2WP8J 3KHKA 5CH8A 4KIFA 3IDQA 2ZIZA 3R40A 3RHSA 3IPLA 4EI8A 5AK0A 3GQVA 1RAEA 2H9IA 5LP6F 3FDJA 1ESMA 2XNDA 1UEIA 3JQBA 1UMBB 1M34E 3TAUA 1R0CA 3HYTA 1U04A 4DQVA 4EJ2A 1NQAO 1W88A 4TTAA 3JD2A 2I1QA 4RZ2A 3IAS1 3GRRA 5F7OA 3BH7A 1TGVA 2PSDA 1C9YA 2ADOA 2AC4A 1LPSA 4DWVA 3RVSA 3EWIA 5AXDA 4Q1EA 3OO0A 5JFGA 4QBKA 4P1ZA 5BRNA 1TM1E 4RJKA 4BMDA 2OFXA 3ISJA 4I9NA 2OCXA 1HRDA 3AESA 4GR4A 1C1XA 1MT3A 2Z8YA 4JOBA 3A14A 3STXA 3NVMB 3RS8A 1ZLYA 3IVCA 2EP8A 4KPUB 3BSYA 5EG5A 3TD6A 4PNHA 1RMYA 4PFSA 1YRHA 1KY5A 5CFMA 2AFHB 4YUWA 5JD3A 1Y89A 3Q6MA 2O6LA 4YUXA 4WUVA 1JQJC 1E77A 2WU8A 1LFAA 2BCEA 2XLCA 2P1DA 3P5SA 2CHEA 1F3LA 1C8LA 1NJ5A 2ZRKA 4EG0A 5JHHB 4HNUA 2ZZNA 2J4DA 4R1NA 2I03A 4PAMA 1AOXA 1J0BA 1EX6A 2R6JA 1BOOA 3H1TA 2ZWPA 3KU4A 3OU2A 4QPCA 3M7IA 5HIMA 2AXEA 4OIFA 2HADA 1BMFA 2DHDA 5T4HA 3C8HA 1XZEA 3M6MD 2A58A 3PNPA 1P60A 3DSRA 3BGIA 3NHBA 5DRTA 5CDUA 1SBYA 4ZVQA 4JBLA 3BM5A 1U8CB 2BEUB 4LYHA 2OYRA 3F8WA 3C6XA 1O95C 4NFSA 2BIFA 2EBFX 4H0FA 3GVPA 3HR7A 2Q50A 2J5RA 3LPAA 3DVLA 4HXFB 2QN2A 1GWNA 2P0EA 2BSQA 1CIPA 3QPUA 4DM4A 2KW5A 2EZTA 2ZE7A 4O5OA 1NP7A 1DUIA 1M2GA 3RVNA 1QRAA 1N8SA 1CLEA 3RADC 1U3FA 3PHLA 3S4YA 3IXMA 4WAUA 4GOXA 4KOEC 1SVNA 5A4FS 3WBKA 1AGYA 2RH8A 5DWVA 3DLAA 1KQFA 2A1UB 3EOBI 3GEGA 3P5BA 3TGWA 1D4ZA 4FYVA 5EWJB 1UDRA 4R71A 5TMEA 3HS3A 2CDRA 4Z0TA 2YNMD 2CLKB 2WU1A 1W5TA 3B8EA 4MVXA 5D86A 4L0CA 3L2OB 1D04A 2DR3A 4Q3DA 3RYCB 3I1IA 3GLIA 2W48A 4QYTA 2BM9A 3QELB 2GD1O 3ZW7A 3IP9A 5LCXA 4PYOA 4EQ6B 2QEQA 1G60A 2OHVA 4HGPA 4TKUB 3TIFA 7MDHA 4V02A 1RP7A 3HTXA 3TDNA 2OBNA 3GC6A 4CF6A 1AK1A 4Y2QA 3MTAA 2W58A 5C1OA 2HQSA 4BL5A 1J5XA 1R0BA 2DVMA 3TBHA 2JFXA 4KQMA 1ZRHA 5DRYA 1SCBA 3WL6A 5ENVA 5C8YF 3KZXA 1H8EA 1BJTA 2RB4A 4YY3B 1TAQA 4DLSA 7GPBA 1BW9A 1GHTA 3AETA 2WZCA 3PWZA 2X15A 3NKLA 4RC9A 4XW2A 4BV8A 5JJCA 4DCCA 2IEZA 5LZ4A 1KPGA 3ABIA 3EISA 1DAMA 3PYLA 3AUYA 1JXOA 2B83A 3VO9A 1S89A 4DMRA 2I34A 4F56A 3BCSA 1JH8A 2E21A 2GZ3A 4HEQA 3OLYA 1UKZA 5ICEA 1IVYA 5LQNA 1SRRA 4QBFA 3BIWA 5ALHA 3SWWA 1EHYA 4TRRA 4EB6B 9ATCA 4K5QA 1GZ7A 3VU3A 2WQ6A 3NUGA 1B14A 4XJVA 4BVLA 1F9EA 1BFUA 2R44A 1CS4C 3RWMB 1F0PA 2BEVB 2MR6A 2ZUCA 1EP1B 4M76B 4UBKA 2BCGY 3RR2A 3W8FA 1J39A 2WZBA 1NIJA 2P9YA 3SDSA 2PEYA 4IYRA 2I6QA 4RTLA 2B2NA 4U7TB 5ERGB 4LYYA 1ZCZA 3VNRA 1E1RD 3A2KA 1SOVA 2JLBA 3BMOB 3AJAA 4HQOA 4NZZA 1WLSA 4XSHA 5SYAA 4BUCA 1T9HA 4CG1A 4B7AA 4YAUA 2E5FA 2OZKA 3K9HA 3O1LA 3AFGA 1TTPB 1GG2A 1YS1X 4MAAA 5KWEA 1ULBA 4J0IA 4R9UC 3AILA 3A9CA 4F9TA 2P6MA 3IP7A 3FF1A 3JR3A 2BGUA 1RHKA 2DR2A 2HSZA 1V16B 1DXOA 2IUEA 4DLUA 1F2TA 5T5QA 2JLWA 4WEOA 2WUGA 1MIOB 4V0ME 3SR3A 4R51A 5DI3A 5HM8A 2F2TA 3WKEA 3OOYA 2JIDA 4LOAA 4OCZA 3AESB 4UNSA 2ZSUA 1MRSA 4GVXA 4OBBA 2RBKA 4C7JA 1DBIA 1I4LD 4YS6A 4KAFA 2X5XA 1YRAA 1AA6A 2LTAA 4NBTA 3TM4A 1N7JA 5KVSA 1ZI8A 5FA5A 2WK1A 4CMJA 4O29A 4V0MA 3WADA 1RJ9B 1ZJ6A 5DYGA 1U2GC 1RE1A 2O14A 2AXQA 2NO0A 4UUBA 3TLGB 2LPMA 1G8JA 2PWYA 4DKJA 3OJEA 5DISB 4XYBA 4OFZA 3EXEB 4HVAA 1OLUA 1RLTA 3BCRA 2ID8A 2RSLA 3D2CA 3NXSA 5TPWA 2SKDA 5EJ4A 3C7TA 4GMKA 4Z7OB 2GILA 2Z0MA 2C4MA 5EJ7A 2RGUA 3LECA 5KSWB 2WR8A 4PV7A 3R8FA 1R18A 2ZPUA 1J0XO 1B7GO 5DYTA 5JV5A 1KP9A 2GCOB 2GPSA 3FCYA 2BDUA 1F0YA 2VUTA 3Q0TA 1RADA 4O2BB 4J43A 3M6AA 2BMDA 1CIJA 1YTLA 3G2IA 3I45A 3MMZA 3PD7A 4NEGA 4PFQA 2XUJA 3RKUA 4BB5A 3PXEA 4IKOA 4QPDA 3F73A 3DTVD 3DJYA 4KO1S 4Q39A 1D9XA 4RF3A 5EVCA 3OCUA 2AJ8A 1JKMA 2VEDA 1XQ9A 1W1IA 3ZDEA 2H7VA 4KODA 2AFIE 1HYEA 1EZZA 1UANA 3KJNA 2ZUFA 1S5PA 1UBSB 3NU1A 1HH4A 3D7MA 3BJMA 3I2YX 4YAJA 3NOXA 2WNSA 2Q2NA 1H1LA 4HQNA 3UUFA 3EARA 2Q6TA 5I5EA 5KOJA 1QJCA 1A71A 1KI6A 2PBLA 2G72A 2PBRA 5K7SA 2IPAB 3V3KA 5J2UB 1W76A 3Q3VA 3ZWAA 1HEUA 2Y1EA 3MCAA 4YRJA 3E35A 4O2LA 1AK9A 4ISCA 5TX7A 4OKNA 4BAGA 4GP7A 2P4HX 4YRZA 2AFIA 1ODFA 4X71A 1DKPA 1QIMA 2R65A 1UZMA 4WNAA 2O7NA 1LRJA 5FCDA 3SQNA 4EFNA 1DC4A 821PA 3ZDYB 1I4DD 1PZNA 3BZWA 3G1UA 4PM4A 5HBGA 4F46A 3U4MA 4K2HA 3NTXA 2JGFA 2K6GA 3MZ0A 4J0KA 1HT2E 5AVJA 4UFNA 5HFAA 4JDUA 4DZRA 3AEUA 4AU1A 1DTWB 1J24A 4D8XA 4K9OA 2ZYDA 4TPKA 3RFVA 2VO1A 1H3NA 1ZW1A 1MAUA 1KNXA 1TKRA 3K9CA 4ZAZA 4BNKA 2QX6A 1GQYA 2BISA 2FPIB 5ICSA 2V8OA 2G1UA 1U3VA 1DEAA 4TMZA 5DBGA 4G4SO 2HXYA 2J3QA 4OQPA 1BS1A 1UMDB 2WZQA 4PPQA 3W7VA 1XVVA 1PJLA 2FRVA 4NCKA 2R8ZA 3LCMA 4HGYA 3E7FA 1OLXA 4KL8S 3QVXA 5KOJB 4DLNA 1EE2A 1N5DA 2HNAA 5K0JA 2C97A 1WY7A 2ROQA 5D7NA 5SZJA 4ZICA 2I1LA 1CR6A 1Y4DE 3LFHA 5KINB 1A7UA 1N25A 3BH0A 4WZAA 3WJ1A 1ZAYA 1YS4A 2IF0A 4QL3A 1LBTA 1DWQA 4BGUA 3QF4B 2XNCA 3CJTA 4KXYA 4ZVOA 2QNBA 2AF4C 3MTGA 2F3TA 2HK6A 4OJTA 3BRQA 1Q14A 2PT9A 1E1CA 2BEVA 3ZQJA 1ZGHA 2WAOA 1KFJB 1PLKA 3A3PA 1WRBA 2FRDC 4JGGA 2FEKA 3ETJA 4C5BA 1OB5A 3WQRA 2R1TB 4WCFA 5AKYA 5CXQA 2I2XB 3X1ZA 3Q15C 5FOQA 8OHMA 2HO5A 1P0MA 4FCWA 5H0IA 4H4DA 3OPYA 4INZA 2AUTA 1Z33A 3AR3A 4BC0A 1GT6A 2KI5A 4G1CA 1F7UA 1VPEA 1EX1A 3AB7A 1HYQA 4LF6B 3B6MA 3JD0A 4GI5A 1NN3A 1GGFA 3GD7A 2PH3A 3U56A 2B35A 1FQWA 5AVOA 5JD5A 1AZLA 4JIGA 1YT5A 3L7KA 1LSJA 1IHXA 4KPUA 4RIHA 2XKBA 1IZ8A 3CLKA 3RYFA 5C5IA 5AVRA 4UAVA 1D1TA 3ZY4A 5GV7A 2PTHA 3H0CA 3MRSA 4Q9IA 3B9PA 3K4PA 2CNKA 2OB1A 2C2HA 3DBHA 3L4SO 4ND8B 3TLMA 4TQ9A 2IZ1A 4D56A 5HKOA 1DDGA 1JAZA 1EKXA 1SUCA 4MYUA 4KQ6A 4Q3BA 2CKDA 2HJSA 4JKIA 4EGFA 2BFEA 3PC4A 1BOFA 2BI7A 3D6VA 5FWNA 2IYNA 4MGYR 1DKMA 3H9BA 4GNKA 5IYZF 2O8VA 4M1MA 1FX0B 4J1QA 4LHXA 4LJLA 4ZMBA 2ABWA 4C0WA 2ZT7A 1IQRA 3P52A 4PX2A 1ISRA 4QLOA 3B89A 3FNFA 5JXGA 3GDFA 1HLPA 3I04M 1TF2A 3IFSA 1A82A 3O9MA 4MQ5A 4ICIA 4NOMA 4WGGA 3SC2B 1GPH1 2RGYA 3FI0A 4TLBA 5AW2A 2FW7A 4LSMA 3HKEB 1B74A 4HDRA 4GICA 2GHIA 4R9SA 1JFFA 1K86A 4P3OA 4NZYA 1JHZA 1NBAA 4G1BA 4YP5A 4HRXA 5DM0A 5ALPA 2IXTA 5FL7A 3WRWA 3ITDA 2XMQA 5FPSA 3HXQA 1P2UA 2XCQA 4H1UA 3JARB 4ZU6X 3L8HA 1AMOA 5IFLA 3MD9A 5IXSA 1OU4A 3O1HB 5TY0A 3OHSX 1TOAA 1Z82A 3H5RA 1PWHA 1A1VA 4BWGA 4F2HA 3WNBA 3B2QA 3QPVA 2CKMA 3G79A 2PKQP 3KLBA 4N7BA 3GMTA 4UBNA 5DW3A 3K0BA 1CJVC 1FF9A 2B7BA 1CDEA 2IYAA 3PEFA 1UOEA 4OHYA 1UBGA 1NW3A 4FR5A 5ALXA 1BMFD 2QYHA 5ECWA 3IVRA 3JR7A 3FN4A 4OHXA 1X7XB 2WB2A 3OFJA 2P2ZA 2R6R1 3N0WA 1PR6A 3H8JA 1FA9A 1RXIA 4PGGA 4IZHA 2R7LA 5FNVF 1ZIXA 1FRZA 2WIKA 1K8ZB 1Q83A 2AYYA 4JX9A 5IPFA 2JRLA 4K26A 3QP9A 1E94E 3ZHZA 1UXGA 2Z58A 5BMVA 3HK2A 3MNFA 1P2GA 1KSHA 3I12A 2CUZA 2BTEA 3DBIA 5H4HA 2XOKD 2DQ4A 4X92A 3BWBA 2R68A 5AJZA 4DR6B 3OBIA 2J32A 3NPMA 2G09A 1G55A 3KDSE 1NBME 1SR8A 1FFDA 1YS9A 4BNYA 2HREA 1THTA 1QDUA 3RVRA 3BULA 3ZXXA 1TIPA 1A8QA 4GE3A 4PLHA 1E9SA 2IY9A 4XVHA 4G81A 5DNCA 4Q9DA 1E6CA 1WCV1 3B3FA 1Y9DA 5DF1A 4KR6A 5BN3B 2AS0A 3W6NA 3WZMA 1PW5A 2VHEA 4CKEA 5H59A 5FAKA 2ISQA 2JBAB 2QW0X 3F5DA 4I5DA 3JQQA 4CHTA 4E09A 4CF3A 3IL2A 2FFHA 1CY8A 2I29A 5B58T 3TIVA 3U7FB 1Z6ZA 3B1VA 3R0QA 221PA 2DHQA 3PT5A 4MQ6A 2KE5A 1IY9A 1KGSA 2HAEA 5LKRA 4HWOA 5J2UF 1RBQA 1G5PA 3HA5A 3CNQS 3UHAA 2R7AA 2ZRPA 1RAFA 2CK3A 2IH2A 1RTKA 2Y4NA 2F62A 1R37A 1A3CA 1D2GA 4C0QC 1K3FA 1PSWA 1VFPA 4RLQA 1Y33E 1UINA 1UPFA 3AOEA 3Q88A 2HEGA 5JE8A 2Q4EA 1PLJA 3EWSA 3HNPA 1M8JA 3LX6A 3HVKA 1NVFA 3QE9Y 3VYRB 3ZIUA 4F9FA 3HB9A 3W1WA 2V3WA 2UUCB 1I30A 1NFRA 2WUFA 3LSYA 1E4EB 1DUVG 2HU8A 3AV3A 2WUWE 3MERA 1CS0A 4FDLA 2M2IA 4M0CA 1RKUA 1XJWA 2EJVA 1Z4OA 3EA0A 1T3ZA 2BONA 1MABA 1V5GA 4M55A 4NKRA 3TR5A 2JFYA 5DE3A 5GM2A 1HV8A 3TAHA 3DXXA 3UKJA 3PEWA 3KYJB 4LE1A 1AO3A 1BEEA 3DZ8A 4EW2A 1W30A 2MT9A 4NECA 5J2TB 4AICA 1U6JA 1M0TA 2QG9A 4IS2A 1B6RA 2GCIA 2YJ4A 4UXHA 5EHQA 5C2JB 3PUXA 3LGXA 4DB2A 1EFVA 3N9IA 5CJJA 2GZ1A 1T8RA 2C2MA 2JJ1D 2WJPA 2XXAA 3PI6A 1I2AA 4BWFB 2H52A 1QGED 3H86A 1H8ED 2AYXA 3QG1A 3ETHA 5JXIA 1P44A 4HYQA 3W90A 1CKEA 4LTMA 3QVGB 1Z16A 4Q5IA 4DWJA 2EF1A 2V7UA 2AK2A 1OXXK 3GUZA 3PPYA 4YV7A 1KI8A 3LPNA 3UM9A 4Q24A 3ZQKA 2Y68A 4KNWA 2BJHA 4QDKA 2VOJA 4PXYA 4YR7A 3CWCA 2Q5EA 2QE7D 5AVQA 2E4VA 1IN6A 1DSSG 3EQZA 3LIIA 3NNSA 3DLBA 3L4BA 4M7OA 1INLA 5EJFA 5E9JA 3AP2A 2QAJA 3ZDRA 4LHYA 1NXTA 1ZI9A 4WASA 4BNUA 1C9MA 2GN2A 2GPYA 2H5LA 3P32A 2HF2A 1UFQA 4PE5B 5FLYA 1VL1A 1LW6E 4RAQA 4D3DA 4RWEA 2C4HA 1UT8A 2V7BA 1XCBA 2J7PD 2RCYA 2WU3A 1TZ2A 4RU1A 2JGNA 4O2BF 3T5BA 3UGJA 1JHQA 1HDYA 3OZXA 1TUBB 5EJ6A 5F9MA 4OYHA 121PA 1FZTA 1E6UA 4CF5A 3EYAA 4W82A 3UHFA 1YE3A 2ZK7A 2CFOA 2I4IA 4N0MA 1ZC3A 1S96A 2NO7A 4G56A 4XQGA 1T4BA 2A5GA 1KH3A 2DBZA 1A1SA 2Q6IA 3O84A 1SBNE 2XRMA 2NNWB 4EPXA 2WWTA 3FPCA 1KZ7B 3X1JA 2QXYA 4IGFA 3I1FA 4BMXA 3T06B 3H2HA 2G67A 4R9RA 1A9XB 1VCNA 2YV3A 3ESRA 3QQPA 3W78A 4EENA 3UH1A 3VAZA 4QTYA 4HL6A 3KOWA 5EGSA 5G53C 5BV0A 1I3KA 2BHTA 4PRKA 4TWJA 1DC7A 2VXOA 2GN8A 2GPTA 3Q3HA 1GSAA 1YB2A 5EKDA 4M0FA 1C0IA 3JWIA 4TV8F 1CE8A 2ZQZA 4YCLA 4X1YB 1CIVA 2NPOA 5F73A 2JEYA 2GCNA 4IIJF 3V1UA 1W52X 4H1HA 1TA9A 2G8NA 3G23A 4ZT2A 2DULA 2YTZA 2CFRA 1IEQA 2W98A 3A6LA 1ZM7A 1F8YA 1H2FA 2OHGA 1NI4B 3Q7QA 3ZK9A 2I71A 2OQIA 3HZRA 4GSLA 3SFVA 4MW9A 1DJMA 2FG5A 3EC1A 4RCYA 3A1FA 5LPNA 3OTGA 2IV7A 5I4IA 1CJSA 3IUSA 1K27A 2RBGA 5HEKA 2GN6A 4J16C 2YS6A 3TTXA 2HWUA 3D9QX 1GRQA 4PRZA 1G1MA 2C9OA 3EVDA 4C04A 5IKPA 3AVQA 3H9GA 2F55A 1Q44A 3S5UA 1U8EA 5LXTB 1N1EA 3AOEC 2JFQA 3L0PA 3WSWA 1OFUX 1M5RA 2V7PA 4EMSA 1SBCA 5BXYA 3SE0A 1C1DB 3I9V1 2NU6B 2R00A 2VAWA 1E1CB 1WVIA 5J43A 5PNTA 4QUKA 2A7QA 2DWOA 3TPCA 2V5VA 3DC2A 5JATA 5THXA 4YEDA 3H8WA 3CKKA 1I4WA 4HFMA 3QF4A 3OPVA 2HHLA 1W96A 4Z9BA 3C7DB 4C20A 4EHBA 1ISMA 1YUNA 4RK5A 2NTJA 2QI9F 3CTMA 3LMKA 1QSGA 4DXAA 5ETJA 3HUUA 1G7RA 4I9UA 1K7SN 1U8XX 4H77A 4L51A 4MXDA 2H2FA 4N5DA 4RY9A 2ZTSA 5IK2D 1NVDA 2WFLA 4D42A 1WVMA 3GUHA 3T5DA 1AU9A 4RHTA 3V1LA 4HFNA 1UZUA 3DE6X 1SKBA 1Y3CE 1E1QD 1EAMA 2HRQA 2YHIB 3VU8A 5AKIA 2H2GA 2JZCA 5G1NA 4KREA 3ZTTA 4ARCA 5H3CA 4ZOAA 3PVSA 2D0PB 2OY0A 3RUAA 4CN8A 3P0EA 5AM5A 2J0UA 5CVEA 2BMVA 2ON6A 4JB3A 2MSCB 4TSRA 1E8DA 1XQYA 5BQXA 1SUEA 4EI7A 2E3JA 3CLRC 4NU6A 2NZ2A 3I1JA 3ILYA 1L2TA 2COKA 4P22A 1W5EA 1GA4A 1O5OA 2EJTA 3HI4A 3D6FA 1EXMA 1Z8NA 3Q3EA 4PHCA 4UMDA 1IG0A 4ZXPA 2TMKA 3H5IA 5B5SA 3EQ9A 3QRWA 3W6PA 3BBLA 3H1BA 3TK1A 1GQ2A 3ZHSA 3C16C 3GLVA 3LFTA 3ZX4A 4TVOA 3N70A 4BZZA 2SNIE 2Y3IA 1IIRA 3AHDA 3TQHA 3QHAA 4BIMA 1AHHA 3EJWA 4PGFA 1WKCA 5BV7A 3O4RA 1DBQA 2PJUA 4E94A 6AT1A 3IVXA 3ENQA 2XAAA 1BDJA 3HYSA 3BL8A 4KAXA 4PLWA 4X45A 1RXVA 2ZIXB 2JFWA 3LP8A 4XX0A 4RHFA 4CIVA 4MV6A 2FPRA 4Q9JA 4E5NA 1ATIA 2TECE 1RCFA 2FWJA 4KMMA 4MV1A 4R9VA 2FWNA 4C0LA 3KOUA 2JGKA 3VXKA 1OKKA 2V0NA 3Q6NA 4KQCA 4LJYA 5PGMA 5C8ZA 2A67A 4TRNA 4HDNA 4NK4A 1Y48E 3ORFA 1JALA 4RPGA 1ZCJA 1EDEA 2Q1UA 4QARA 1XOIA 3DOJA 3IGFA 3JQFA 4M1WA 5FWDA 5AVZA 4FWBA 4F2PA 1JHAA 2PD4A 5KOIA 2GCPA 4XQ9A 1WDLA 1XP5A 5JUWA 1VIDA 3B7WA 3WLLA 2EQAA 1RM4A 4W9NA 2IY7A 4Y2JA 1RHQA 5JADA 1ZD9A 1D8AA 3TZEA 5JHGB 1N2EA 1R5OA 5CLQA 2WG1A 4A4DA 5FTKA 1RRVA 4BMOB 3NX4A 1KQNA 4B75A 4EZIA 3VDMA 4K9MA 1L6IA 2FSIA 3PHHA 4OREX 3Q2IA 1H1TA 3LUPA 4JBNA 3NBAA 4LNUA 4JC5A 1NUAA 4MA0A 1RC1A 2BL4A 2X4GA 1RRCA 1OZ0A 2YV4A 2FPOA 4FFVA 3SZMA 3OCYA 3Q40A 1MO2A 1R74A 1SCIA 3QUSA 2FE1A 4WNAB 3JALA 4JUDX 3UK1A 3I42A 2GZRA 4HH3C 2C4VA 2VDKB 2YCBA 4DDVA 2WPDD 1LA2A 3GLSA 2DLCX 2MWMA 3OCCA 1KTVA 2EKBA 4WA8A 5K4AA 4EG6A 3LTNC 1JWLA 4BP8A 3GB9A 3CZMA 4BMSA 3FCAA 5KYNA 5I7AA 3FNGA 3OQHA 3F6PA 4WOCA 5BXQC 3CPJB 1ICIA 2XHZA 3DZBA 2BGTA 4XVRA 3PD0A 3W05A 4YDHB 1S2DA 2OM2A 2SCUA 3FSRA 3T99A 3A6PC 3L6DA 5EJ5A 2E55A 3FTFA 2IOQA 3NEJA 3D4PA 5B3KA 2LXNA 3FROA 4TKLA 3CONA 1H85A 1ZCBA 3PJEA 1RKXA 1T3SA 2YNMC 2FSGA 4WLOA 4R8SA 3UJ8A 4XX1A 3PC2A 4J8PA 5HF6A 3TLCA 4B3JA 3BGWA 1N33B 3ONDA 1PNQA 5K8LA 2P9HA 4RTQA 3TRJA 2I9PA 1X6VA 1DQPA 1QYCA 2P2CA 5JCXA 2R47A 3OJXA 1FNBA 2W2KA 5TV2A 1I7DA 3UMMA 1V7CA 1Z68A 4QDUA 3H1AA 5LIRA 3K30A 2LZ0A 4KPEC 4MKHA 3EMVA 1TD9A 2OO5C 3FETA 3EFEA 3IERA 3OFKA 3AVWA 1ETUA 2SHKA 4PAGA 4R2IA 1OT5A 3VUFA 1M8GA 1MFZA 1NJ8A 4QIHA 3G59A 4LRTB 1TMKA 3F6RA 4QUAA 4FW8A 1DZ3A 1GZ4A 1WBJB 1ZHFA 4QDTA 5E6RA 5EZ6B 2NZVG 1TCBA 1XNHA 2XB4A 4LWQA 4OYRA 2IV2X 1N9ZA 3A1TA 3IAFA 5LZ8A 5L3SB 2NSLA 3R09A 3RJ5A 1QLHA 2DAPA 4XWTA 2JFVA 4R8MA 2KLHA 4D3SA 1PUJA 3LZ6A 1XUOA 1PV4A 3RYFB 1ISJA 2X8JB 2C2OA 1JG1A 1A5ZA 4P8RA 1TZKA 4PNZA 3JRXA 2JLRA 3BERA 3OESA 3WMWA 1QQ7A 4XARA 1KK2A 1N6RA 1PDVA 4Z3OA 5BSVA 2YRFA 4GQBA 1I8TA 2WE8A 1H8HA 5B1DA 5CD1A 3M6WA 4GPTA 1YFLA 2VZ0A 2XCOA 3EXHB 1S0UA 2LKDA 2R7NA 5EN4A 1RXCA 2W0MA 2XYVA 3NDPA 5JT1A 3ZVLA 4Q1CA 1X1AA 1V43A 4YAEA 5A05A 1VBNA 4JSTA 1R4AA 4N5NA 5BQOA 5KQSA 2XCUA 3DBLA 2ECPA 3JVVA 4HZGA 4I3GA 1MAHA 4PS0A 1ADFA 2NO4A 3N76A 2Z5GA 4PQRA 3RSZA 1CZLA 2YMMA 4B6EA 1D7OA 3C3CA 1OXVA 4RJJA 1RJEA 5K2MA 2OILA 5BURA 1M2VB 5K3CA 4ZEOA 4C08A 1E60A 1F1BA 1RVV1 2P65A 5E1BA 1SKYB 1EGQA 1P0PA 1OC4A 2GN1A 4L95C 1JKFA 3ROQA 4JQZA 1M6WA 3F6EX 5ALSA 4QGFA 1G6OA 2AHOA 2FK8A 4N12A 4KSCA 3ZWOA 4D74A 2PUBA 3KBOA 4MKRA 5I3CA 4A10A 3TSZA 2K4MA 3BCHA 4X64B 1L5NA 2X1MA 4M1EA 4ZD6A 3HCBA 3IDZA 2WOJA 2TS1A 3SJBA 4BQNA 3W2IA 4TSFD 1EM8A 3PR2B 4N54A 1Z6AA 5KAMA 3HZHA 5IMBA 3VZCA 1CHDA 4FZRA 4ZCTA 5IXYA 2PUFA 3H1EA 5A4DA 1L9XA 4REOA 3NETA 1MKYA 3A6FA 3VKHA 1X9GA 3E27A 3HV0A 5COAA 1M5UA 5FI1B 3ZU4A 4DGSA 1OH7A 3D31A 4LSWA 3QSYA 3DWFA 1RAAA 3K71B 4P0QB 3E3LA 4KO3S 1JSRA 1WHTA 4MTLA 2FW9A 5CDHA 5AK5A 4LZZA 1SU8A 2CVOA 1IWOA 4IZOA 1JWBB 4Q4JA 3K09C 1N4AA 4DN6A 2ZS9A 5F23A 3BK1A 4Q01A 3WFZA 2VDJA 3AR9A 1NKSA 1SELA 3JWJA 1FDSA 4G07A 1H0KA 5F5LA 3WXMA 3ZUGA 4XDZA 1F0KA 3SR0A 1LNSA 3HY6A 3L02A 1Z0DA 2VH2A 1SY7A 3G2JA 4HN4B 4K88A 7REQB 2H11A 3MA0A 5FXMA 2VT3A 3L7AA 4BU0A 1CRWG 1ZM4A 4EH1A 4MRPA 1E3EA 1V4NA 4B76A 1P5ZB 2CHUA 4KIUA 5IJ0B 1WO8A 3K70C 3TGLA 4IDDA 1NN1A 2XGSA 4RNDB 1GA6A 5TMDA 2PAAA 4MYTA 1J2EA 3QNMA 4H3SA 4RA9B 5FFNA 5CA0B 2KX7A 3E5HA 4BJ6A 5HGJA 3C3MA 1N5OX 4V0RA 4ZVUA 1U3GA 2D74A 1XNGA 2HHJA 3JX9A 1DMRA 1JU4A 1YMQA 4ERXA 5CPFA 1EIWA 4JKYA 1GUDA 2FP4B 5JCOA 2XUKA 4DLZA 1FTYA 1M2VA 5DLEA 2C7VA 4GECA 1YAHA 1VI6A 2WVJA 4RCZA 3CG4A 5TARA 1PT5A 1X15A 1IEXA 1TK3A 2WWXA 3VTKA 1EXNA 1P3JA 2QQGA 1NQTA 3E53A 3H4TA 4UHKA 1SBHA 1XZKA 2JFBA 2V74B 3HVJA 2OWDA 3JVDA 4RKQA 1QGUA 2XNKA 3LD9A 4P92A 1OVMA 2W2TA 3CRW1 3DOUA 4IS3A 4ZOQI 5IT4A 2I6GA 1ZRMA 4FE4A 2JGEA 4F2GA 4G0PA 4UDXX 3P9RA 1QFSA 4Q9HA 1OTXA 1QHFA 3CSDA 2FSSA 2YVKA 3FDIA 3EZGA 4QGGA 4K28A 1Z75A 4IIEA 3IP1A 4ZT4A 4PYMA 3UAXA 3WSVA 4Q9LA 1H4VB 1P17A 1QIJA 3RS9A 2I65A 4YYEA 2FLWA 2H4ZA 3RV4A 4C6TA 5KPDA 2XMRA 1P6UA 2RGDA 4B8YA 1AKNA 1D03A 3FVQA 2XH8A 3M3DA 1U0GA 1UMCA 3RVDA 1V3TA 5EIFA 2JHAA 4PXSA 5K01A 5CU7A 3ER8A 3LKBA 4IQ4A 1GNPA 4EHFA 1LSUA 1PZGA 2BM8A 3QM1A 2VDUE 1RQNA 1US8B 3QVLA 1MB9A 4IFEA 1T9AA 3S3TA 3TB4A 1GTJ1 2YWDA 4W9NC 1VI5A 3GH1A 1BO6A 2R86A 2ZVQX 3HJFA 1N6HA 3LRTA 5ALRA 1CRZA 3EIQA 3KS9A 2GJSA 3N87A 3PQDA 4UULA 3QEAZ 1PL6A 4QOHA 4W1SA 1FIUA 4AUMA 2AA3A 2IBSA 1KKMA 2A1TS 5K2OA 2VSNA 4HLDA 1EG2A 1Z5OA 3MAAC 3SICE 1WKVA 1E3JA 5DT2A 4OATA 3U39A 4UTZA 3HUDA 1T9KA 4UE2A 3PWTA 5ALZA 3PIIA 3JY6A 3I28A 1UXOA 3PNVA 5ARDA 2UUOA 5E95A 3F46A 3RBVA 4URUR 5A9TA 1QQBA 3DTNA 3E61A 1T4CA 1LXCA 1TO2E 1GOTA 1A9RA 5AVUA 3D3WB 4IIFA 3U31A 4BX0A 1CR2A 3OFNA 4W5JA 5JAMA 4RXUA 2CLSA 4X8MA 3IBYA 3GEBA 3IODA 2NV0A 1R6VA 1DX4A 3EH1A 3WL7A 1ND6A 4G84A 4CDGA 1R0YA 2IUSA 1T6BY 2B98A 3ANLA 3S7ZA 2PD6A 3L9XA 5EC8A 5JLJA 3HXOA 4MUGA 2EJBA 1ZNZA 1YS7A 2SICE 2QY9A 3R3YA 1S2GA 4QE3A 3C3KA 1LLDA 5DTRA 1JHXA 4U3JA 4XGIA 2TMGA 5HDBB 3T7DA 1Z2EA 1YA8A 3LF1A 1KFKB 4P36A 4RYLA 2EKPA 2R0QC 2R96A 2Q1XA 1X7ZA 2ORWA 1E3TA 1MFPA 1XRQA 1PK9A 2ZU6A 2Z1DA 3D3KA 3D7NA 1Q74A 1CBUA 2WT9A 4CTNA 2PUEA 2HC9A 1JJVA 2CZGA 1WABA 2VHXA 3PLAE 3T1YB 2QK4A 3MSCA 1MAAA 5TDHA 2WA1A 4P82A 3LBHA 1YZHA 2CFTA 4NBNA 1YE5A 4KYIB 2B34A 5G0SA 3A6DA 2FMHA 5IAEA 4AQDA 3QEOA 4X9XA 2JARA 2CHGA 3ADKA 3EUFA 1XZCA 4GGMX 4Q7LA 1DXHA 4XIYA 4LDAA 3BSFA 4X61A 5SZHB 3RWOA 3W2TA 3LAWA 3V8EA 4CIYA 2MOKA 2D4HA 4LHEA 5GGXA 4JY7A 2CMFA 3HDJA 3LE8A 4IDCA 4OK3A 5BOSA 1S9DA 3WGJA 1RE0A 3D7LA 1RI4A 4M9CA 3RF7A 2XRZA 2BTQA 3RUEA 1T5TA 4RS4A 3ZCUA 4ZRMA 1R4MA 4DHEA 5CEJA 1L1RA 2F3SA 1Q20A 1X1CA 2HRZA 2JK1A 1TCCA 3K2BA 3M0EA 1RM0A 1GYQA 4LMPA 3SG0A 4PQGA 3X1WA 3R5XA 3I8XA 5CM2Z 3KXDA 1RVDA 3ICCA 3B6ZA 1HYBA 5DI3B 1C0LA 3KK0A 4HWSA 4UUMA 3X1YA 3ZZMA 4U7FA 2YQ5A 4AMUA 2HF7A 5JDCA 3NIFB 4NR0A 1BWSA 1L4BA 3WIVA 4K6HA 3OFND 3QH4A 5FKJA 4U0JA 5MN4A 3F0TA 3HKBB 3V97A 3VZBA 5L45A 4L3VA 4HQLA 2WQZA 1P8JA 1E8NA 1TKBA 2HMYB 2XYGA 4TUYB 2JFUA 3LVBA 5I4KA 3P9CA 3E82A 2GAFA 3O1JC 4MUBA 1GLNA 1XLTA 1LKZA 3C7AA 2HMTA 3L7YA 4YRGA 4B35A 3TOVA