4P33A

Crystal structure of e. coli lptb-e163q in complex with atp-sodium
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
235
structure length
235
Chain Sequence
ATLTAKNLAKAYKGRRVVEDVSLTVNSGEIVGLLGPNGAGKTTTFYMVVGIVPRDAGNIIIDDDDISLLPLHARARRGIGYLPQEASIFRRLSVYDNLMAVLQIRDDLSAEQREDRANELMEEFHIEHLRDSMGQSLSGGERRRVEIARALAANPKFILLDQPFAGVDPISVIDIKRIIEHLRDSGLGVLITDHNVRETLAVCERAYIVSQGHLIAHGTPTEILQDEHVKRVYLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lipopolysaccharide export system ATP-binding protein LptB
publication title Decoupling catalytic activity from biological function of the ATPase that powers lipopolysaccharide transport.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 80
structure length 235
sequence length 235
chains with identical sequence B
ec nomenclature ec 3.6.3.-:
pdb deposition date 2014-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF12399 BCA_ABC_TP_C Branched-chain amino acid ATP-binding cassette transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4p33A00
1NVWQ 1QHHA 1E0SA 1ZBDA 1GAJA 1TU4A 2P67A 4LJ6A 2HCJB 4X8HA 3TBKA 4Q9HA 3KZ1E 1N5JA 2JEOA 2Q3MA 4V0ME 4DWJA 1G7RA 4ERNA 3RS7A 3BH6A 3B85A 3CNOA 2QP4A 4RD0A 1Q0UA 4XTCS 3FKSA 3AB3A 5TDHA 1OFHA 2C04A 2F9LA 4HLCA 4PO9A 2IUUA 2O8FB 4JVLA 1DTSA 4II7A 4LI0A 2ZJYA 3R7WA 4JLKA 3VR5A 1JPNA 1E9BA 4MKIA 3SFVA 4EJSA 2HYDA 1N5IA 4H9GA 4E09A 3S1AB 4WZ6A 1II0A 2V1XA 2ZVPX 3RS2A 4LBYA 1JEDA 3AVYA 2JDID 4LJ4A 3I8XA 5DO9A 2R6GA 3OEEA 3CF2A 2R9VA 2WJHA 4MGIR 1GFIA 2IYWA 5CLQA 5G41A 5EP1A 4TMTA 1XPUA 2J46A 1IJEA 1JECA 4OQMA 4D82A 3LAWA 1DAMA 5FL7D 3CNLA 4YMUA 4JMPA 2GAAA 4XD7D 1ZCBA 2QEQA 2WJGA 4Q9LA 4IRUB 2CLCX 2C2HA 2XTMA 5KSPA 1YR9A 4HDCA 1AK2A 4WW0A 5L3SA 5FUXA 2XB4A 2WKPA 3MSXA 4XIGS 4M9QA 2C77A 1G21E 1KO8A 1WBBA 1P9RA 3L0IB 5L3VA 2RGCA 4QBIA 1A4RA 1G18A 2W6JD 2NG1A 4I1SA 821PA 5K8IA 3IPXA 1NBME 4PFSA 4Z1MA 4Z51A 3CIOA 4JKYA 3QIAA 1ZU5A 3N70A 4U7DA 1U0JA 2O8BA 2GNOA 4CIDA 2BWJA 2YYZA 4XOIA 3FKSD 4JIMA 3TIFA 3T35A 1W7AA 4AURA 3EWAA 3FFBA 2RCNA 1UKVY 2IBMA 1N6IA 5HZKA 4A8JC 5FOWA 4D6PA 2ZS9A 1UEIA 3W3ZB 3ADDA 3QXHA 3VAAA 1SQ5A 1NKSA 2QNRA 4M9ZA 1M7BA 4Q21A 3OEED 2F43A 1JPJA 1YZQA 3GQBA 4LHYA 2P6RA 3TH5A 5KNCA 2GEDA 1EFRA 1RPZA 4IFBA 2PCJA 2PMKA 3BD9A 4IOJA 5F9FA 1RIFA 3FMPB 2BVNA 2FZLA 2FX3A 2PH1A 4PZZA 4OI2A 4ZIRA 2A5JA 1I4TD 1QHYA 1W4BA 3OEHA 4C0JA 4YDHB 1W4RA 3QSYA 1F5NA 2NO7A 5DE3A 2WJIA 2GEUA 4X8LA 3V4FA 3WYFA 3MUFA 4M9XA 4ZCIA 1HUQA 1TMKA 1OH8A 5FI0B 2ZRNA 4TQ9A 2DPXA 5H70A 4P31A 1OFUX 4DCSA 4XWOA 3K70D 3EPJA 3LDAA 4GL2A 1VHTA 2JLSA 1RRCA 1U94A 5EXXA 5JJIA 2AD1A 3UPUA 1Z07A 4IOLA 2VH5R 1KO1A 2R2AA 4CF7A 2ZSDA 1LFDB 1II8A 1DE0A 3OHMA 1HE1C 1G8PA 2R8RA 4LHVA 4YC7A 4MDEA 1R2QA 3CPHA 4Q9IA 2Q3FA 3IHLA 2GCOB 3MWYW 1IJFA 2ASEA 4Q4AB 5BYJA 4B47A 4DSUA 2P5TB 3NH9A 4K8OA 3TUIC 1E2DA 5FTNA 3GLIA 3THXA 1NY5A 2FGKA 4RD3A 4QJ4A 5H1YA 4EDHA 3TAUA 4B32A 5TY0A 2GETA 3GP8A 1J8YF 1CKEA 2VBCA 2ZJBA 4A4DA 1DOAA 2HF8A 4JJKA 5CIQA 4KLZA 3LLUA 4FWTA 1EFRD 5SZKB 4DIDA 2WKQA 2KJQA 5B58C 1MABA 2ZRIA 1FNNA 3HR7A 5LPNA 1OH7A 1IY0A 1F48A 1HURA 2BMJA 2YHSA 4HZUB 1RYFA 5KTYA 2XXAB 1YKSA 4LHXA 5JSZA 2ZE7A 2D06A 1XTRA 2XJ9A 4MKGA 3IQWA 3ZS8A 1GL7A 4MUBA 2VP6A 1VCIA 1XU4A 3AP2A 2NZJA 4Q47A 1KKMA 1N5LA 4EAQA 1ZNXA 2RGXA 3CR7A 5E4FA 3I5YA 3T1QA 3B7GA 4URZR 5JWOA 1X8JA 3WP0A 3UG6A 3LFUA 2VHCA 1R0ZA 3KKQA 4BLPA 4DLTA 1U0HC 2G0TA 1Z83A 1JR6A 1HEIA 2UZIR 3VKWA 1CBUA 1BYIA 4ACBA 3F8TA 1Q1BA 3KQKA 1OXVA 5FBLB 3WMFA 3CW2A 3HYTA 3IIJA 2QMEA 3DVLA 1GRQA 1XD2A 3FMIA 2HXSA 1IY2A 4TLCA 2VSOA 3N2EA 3B5JA 5KPJA 5D3QA 4BRUA 1OSNA 1F2TB 1OW3B 1P9NA 2ZEJA 4CT5A 2XGJA 1P72A 3CNNA 3DMDA 3EZ6A 3V9PA 4AI6A 1H8EA 1SKYB 4M1YA 4TN1A 5BN3A 1SXJA 1W36C 4HUQA 3J81k 3X1ZA 4ZCMA 2ZRCA 2ZUCA 2Z83A 3Q85A 4E07A 3U6KA 4QXAA 3VHXA 1SVIA 1U9IC 1AN0A 1JR3A 3BS4A 1C9KA 1UF9A 1Z0IA 3MMPA 1NMYA 2W0SA 1DO0A 1NI3A 4MKFA 2ZI6A 1ONBA 3LY5A 4EFLA 1RFLA 1SXJC 3PG5A 4U00A 4B3BA 5B30A 1Z47A 2ZM5A 4Y0VA 1OH6A 3HDTA 5EXSA 1N0WA 2IYXA 2A2ZA 4XVUA 2ZAMA 2N1BA 3PXGA 1YRAA 3DM5A 1FMLA 3X1XA 1IN8A 1JBKA 1Z0KA 3CKLA 3FMOB 4C30A 2WKRA 2PCLA 4TWZA 3GD7A 2FFAA 2Z4SA 2GWHA 2WVJA 4M1KA 4JLAA 3W6PA 4EPWA 3FYHA 3NXSA 2DR3A 4LPSA 4DCNA 4F4JA 2G6BA 3AF0A 1Q3TA 1Z22A 1XEXB 2ZU0C 5FBRB 2EFCB 1ZVQA 1XEFA 2ZUDA 3QI2A 3BGWA 4XWAA 4DEYA 2A30A 1F3OA 4GMDA 1MOZA 4GSYA 1XX6A 3VU9A 4PTLA 4U02A 2HV8A 1Q44A 2O5VA 1D5CA 2G3YA 1WQ1R 1N6HA 1YZUA 3GFTA 4LBZA 1P4SA 3F5FA 3GCGA 4RZ3A 2N42A 1P2SA 4B48A 3LX5A 2DHRA 1KI1A 5DHAA 1JR3D 4UNQA 1IAQA 3O47A 4IFEA 1GKIA 3I72A 5EE3A 5EE5B 4BASA 2OLKA 3PUZA 4L15A 4OHWA 5D3MA 5HE8A 1JEEA 3W6NA 5F98A 2PL3A 2Q9BA 2NO0A 4FW9A 1NLFA 3ZD7A 2OUKA 1FUUA 1XFAA 3CLVA 3KFVA 2OHFA 2AHOA 4CEHA 4IVQA 1PLKA 3BFXA 3A58B 4S35A 2NO6A 4Q5IA 1VCNA 4KBFA 3DEFA 3OIWA 4OK3A 4M1WA 2RKOA 3WY9A 3FPAA 1IN5A 4LOAA 2JLRA 4MKHA 4ZKEA 1OYYA 3KKOA 2P65A 4JLBA 3WRXC 3E5HA 3EZ2A 1X6VA 2GA8A 3BK7A 3U7GA 3ADBA 4Q1BA 5BN5A 2NIPA 1GIAA 1YU9A 1G8YA 3ETLA 1R8QA 3I92A 4TYWA 1WBDA 2YC4C 2ODEA 3CWQA 1KAOA 1XCGB 1UKZA 2JJ1D 5FPTA 4Z54A 1HY3A 4FMDF 1QDEA 3MCAA 4C0AC 4B3XA 4QM7A 3X2SA 1QZXA 1P9WA 5CM9C 4WZAE 1T4GA 2JLYA 4DT1A 4KSBA 5AUNB 3NC1C 4RJLA 1KK0A 2F9MA 2WICA 1OPXA 3ZVNA 1XXHB 3UWOA 5IT5A 2CCKA 3AM1A 2EFEB 2WBLC 4DBLC 1DAGA 2CL0X 5AJWA 2RAPA 2V6JA 3OZXA 5HCNA 1KK2A 4DDVA 5TXGA 1E32A 2GHIA 4I4LA 4TTPA 2F55A 2J5XA 1LF0A 4Q7KA 3VR3A 2AN9A 4N0EA 2OEPA 1PJRA 1S9HA 4JYCA 3U6BA 2WAXA 5KU1A 4D81A 5JZVA 3B1ZA 4HAXA 3EG5A 4PQRA 4WVFA 5CM8B 2HDNB 4LX0A 2VSXA 2EQBA 2QP9X 2V4ZA 3SQXA 1OLOA 1TAGA 5C4GB 4B71A 2YOFA 2V1UA 1E2JA 3AKCA 3EARA 2XOKD 1M8PA 1Z6AA 2XX3A 4NYIR 2EWWA 2X77A 4RSGA 2GAOA 2FSHA 1R0WA 2FMXA 2ZE5A 1D2EA 2H57A 1DAIA 3EXAA 5JEDA 3A37A 1Q1EA 4G5RA 4YDSA 4DIEA 1BYUA 3IBYA 1DAHA 2ERXA 2WWHA 1KY3A 5FTKA 3KJGA 4WXRA 1NBMA 1FQKA 2I3BA 3SU8A 4D0GA 2DY1A 2QROA 1GRNA 3NBFA 2GF9A 1IXSB 1SVOA 1RRPA 1GG2A 5EJEA 4JT2A 4HSEA 1QHNA 1R8SA 4B6EA 1CTQA 4YQFA 1G19A 4H1VA 4LK2A 2OCYC 2RMKA 1EGAA 3QKSA 2WPDD 5FI1B 5KPDA 1KO7A 3B9QA 2OG2A 4JZKA 4P0TA 1GKYA 1PLLA 2DFKB 1G7SA 4Q00A 4NYJR 5J40A 1NY6A 2C78A 3CZQA 3IEUA 4MYUA 5J5CA 5TV2A 4D2IA 1A1VA 3DZDA 1KNXA 2DCUA 1A2BA 1SKQA 1OJLA 1KI2A 3AF3A 3D31A 4IDHA 2YINC 1CS4C 1RW4A 4F7WA 2QTFA 2CXXA 2RGNC 1R0XA 4AG6A 5F3WB 1MR3F 3RAPR 1CRPA 1LNZA 2GVDC 3PCRB 2FOLA 2ZR7A 2O8DA 4DSOA 4MITA 4RZ2A 2ZS7A 2WSMA 3QBTA 5SZJA 4QG7A 4AD8A 2F1RA 4C0BA 4KODA 2CNWA 2HF9A 3M6AA 1HT1E 1KDTA 5AUQA 4PPFA 4GOJA 1KYIA 3AF2A 3AVPA 3QNUA 1Z2CA 1VHLA 3ZQ6A 4Q1CA 3RRZA 3WXMA 3BH7A 3U4QA 2R6FA 5FOTA 4ILEA 4BFVA 2KE5A 3RVBA 4PO1A 5KSZA 2J0SA 1ZUIA 3HR8A 3QF4A 4NONA 2ZUBA 5JWHA 3KXLA 3TGPA 4DLXA 1N6RA 3BORA 3I4LA 4Q18A 1NBMD 3EZFA 4ARZA 2ZRPA 4BLSA 2XTNA 4LCBA 3PEWA 1YRBA 3ICQB 1CULC 2YOGA 3W6OA 5K8TA 1OIWA 3Q9LA 4LYJA 1KDPA 3GLIE 1R5OA 4CEIB 1SGWA 3HWSA 4UNRA 3EC1A 2WTUA 3W8NA 3H0KA 1OB2A 4EPTA 1G5PA 2BM0A 3QKUA 5LDDC 3R7WB 5LB4A 4JLJA 2QM7A 3AUXA 4G5QA 2OV2A 1PV4A 2ORIA 2OFXA 1XEWX 2J45A 2QQEA 1NIPA 2MSDB 1R5NA 1BO6A 3TVDA 2ZETA 3KKMA 1KO4A 4CDGA 3QXSA 2C96A 4M2LA 4L16A 4Q1DA 2IK8A 4NCKA 1U8YA 4YMSA 3SNHA 2CNWD 3SOPA 5FUYA 1ZC3A 4GP6A 4IDQA 1Q20A 1MKYA 4B43A 2ZRAA 2R6CA 1OF1A 2W83A 3SBDA 2AK3A 2QZ4A 1X8KA 3E1SA 1HV8A 5J4LA 5J47A 4A2QA 5B57C 2WM9B 1OKKD 4KHZA 2PX0A 4LPKA 4JL5A 4JSYA 3VR2A 3QKTA 3GLGA 4QBGB 1MT0A 3CRQA 4DEXA 1XP8A 1JJVA 4YMWA 3EPHA 5JRZA 1E0AA 3H86A 3I73A 4EPRA 3EIEA 4A8JB 621PA 4IOKA 2O52A 4JLVA 3EIQA 1VIYA 3IBGA 2C9YA 1AM4D 1HE8B 2ZRHA 3A1TA 4M1MA 4D4JA 4BFXA 3CRVA 2IEZA 4KI0A 1KK3A 4TT3A 1S96A 3UG7A 2GEVA 2VHUA 1EESA 4OQXA 1I2DA 2IF0A 1VDZA 1Z6XA 3BB4A 3D6TB 2OE2A 5CDFE 2CCJA 5KDOA 3PFIA 4UJ3A 2GK6A 4DC9A 3SQWA 2FZ4A 4XVRA 4PPNA 4UNNA 2C5LA 5EZ6B 4AY2A 4FCWA 1JR3E 4W9MC 4MQBA 3ZVMA 1M1YE 3X1YA 4FCVA 2BBTA 5FR2A 2BKEA 2QGZA 4EKDA 4DLVA 4I1UA 1KMHA 1YHNA 1IOZA 4FMBB 1CF4A 2ZQ5A 1KHTA 2WIBA 1CR2A 1NLYA 1G3MA 2OXRA 1LB1B 3K0FA 2GKSA 2WOJA 4QJ3A 4A6PA 2H8KA 2QN6A 4ZO4A 3P32A 1K5GA 1KI7A 3AEZA 1E3MA 4BWYA 2ECKA 3QXCA 4EPYA 2BHRA 3VNUA 1Z29A 3AV0B 1HTWA 2F1HA 4LJYA 3AKDA 4BEBA 4RCYA 4TT3D 4B33A 2XSZA 1F6BA 2FPMA 2V6IA 2NPFA 1XCMA 3PV0A 3U3JA 1GWNA 2ERYA 5GJBA 3QOFA 4YMVA 4M22A 5G3ZA 3MAAC 1XMSA 3UWKA 5SZIA 1QG2A 4OI0A 1ZMXA 5DHFA 4GOKA 3KDSE 1XPOA 4LDJA 1XEWY 1E96A 1M74A 3I8SA 2OAP1 3PEYA 4Q1FA 4XWKA 1FFHA 5KHOC 1ZP6A 5GVSA 1J2JA 1G8GA 4QL3A 5A0FA 2ONJA 2ZRMA 1JXMA 3U3OA 3VHLB 4AKGA 3VQTA 4TL9A 1S2MA 4MGKR 5JI3E 3BC1A 1Z6TA 3ZZTA 3O8BA 2FNAA 5FL7A 1JAHA 5JSZB 2FWRA 2OXCA 4UQOA 2JAQA 4NYIQ 3VR6A 4GDFA 4JL8A 3HYRA 3QQ5A 1KGDA 3GLHA 5KDLA 2HT1A 4UXHA 3SDZA 4C0LA 1RKBA 1G16A 5CK4A 1KJZA 1UBCA 1UEJA 5DYIA 1NN5A 2KBFA 4HLUC 2CBZA 1LW7A 2RGEA 4GI7A 4NPHA 3ZYCA 3R20A 1W0KD 1N6NA 2VEDA 2W6JA 2AK2A 5JJKA 4NYMQ 5DI3A 2Z43A 1FTSA 2XSZD 2GJAA 1KDOA 3ASYA 3RRYA 3QVUA 4CT4B 1W36B 4HAUA 1IN7A 4US0R 2Z5FA 3BH0A 4V0KA 2JATA 1XD2B 4NYJQ 3ADKA 2QL6A 2ZJ5A 4RZUA 3LD9A 1G291 1HH4A 1TQ6A 1L4YA 1UPTA 3QEOA 4F92B 2QSYA 4S2EA 3LA6A 2FA9A 2GXQA 1AQYA 5KUTA 1UBEA 1NL3A 1SXJB 5BW8A 3CH4B 4R2IA 4D4MA 1PLJA 4PAOA 4TQUS 3KB1A 4C0HA 2QENA 3THWA 3QXJA 5CB6A 3L0OA 4Q4JB 2REBA 2LWIA 4WAUA 3TVTA 2OFWA 4MYCA 4EJSC 1S1MA 1TUIA 4I1OA 5JHHB 3KTAA 1S3SA 2QY9A 2W58A 1G5TA 1PZNA 4JVSB 4XTRA 3A4MA 2WWGA 2QE7A 3AVWA 4XVQA 2IYUA 3R9WA 3IIMA 1KZ7B 2IS6A 1R6BX 3KQUA 2A3RA 3H1TA 4N1AA 4B74A 5L3QA 2IHBA 2ZRDA 3KXIA 2PEZA 1RVDA 2RB4A 1ZJ6A 3NDPA 2ZI5A 4OI1A 1NVXQ 1NVVQ 4DUGD 4UKDA 2ZPTX 4BRWA 5FPSA 3QJYA 1Z0JA 5DH9A 1OFIA 1E2PA 3TUJC 4EFNA 3PUYA 2P3SA 4PHHA 3AVUA 2QRNA 5JCPA 3SE0A 4QBHA 5EUQB 5JRJA 3CB4A 1E0JA 4IXNA 4KLNA 4KYUA 1II9A 521PA 3K70C 4W5JA 4BLTA 4P4TA 1E6CA 2D4HA 2ZI3A 3R8CA 1RJ9A 2XJ4A 2H7VA 2ZRBA 2GJ8A 2IL1A 2N46A 4Q4HA 4TL7A 3PUWA 4BUJA 2IXFA 1P62B 2ZI4A 2PEYA 1QBKC 4DVGA 4O2RA 3GEIA 3PVSA 4PC2A 5GJVC 2O0HA 4G01B 4QBFA 2VP5A 3BXZA 5D3MB 5DI9A 3AH8A 2O8CB 1N6KA 1W0JA 3FE2A 1A82A 3T06B 1E9CA 2GILA 4WXPA 1KIMA 3ZJYA 3QUSA 2JLXA 2QE7D 4TLDA 4RKEA 3C15C 1DEKA 1GVNB 1KZGB 1XD9A 1U2RA 2DFNA 3QEJA 4UJ5A 5KYKA 1JAIA 1KK1A 3AF4A 3LBIA 1J70A 4I81A 4EUNA 1DAEA 2SHKA 2ZYWX 5FR1A 1E1RD 3B13B 3IUYA 1NJFA 2IYYA 1V43A 2VP0A 2WJYA 3QXXA 3QPUA 3LW8A 3RSLA 2HLDD 3D3QA 1DELA 4ZI3A 1JQLB 3TUZC 2PJZA 5C2JB 1E2EA 2J0UA 4TYNA 1JJ7A 1F2UA 1JI0A 1KAGA 1US8A 4TZ6A 5AWFC 2VF7A 1QVRA 4PQYA 1W2HA 3GJ0A 2BKUA 2ORWA 3B9PA 1VG1A 4LYAA 721PA 1FTNA 3B78A 4G1UC 1U99A 1T8UA 3SYLA 3CUEF 2D7DA 2B7BA 4P4SB 3AGQA 3PENA 1ESMA 1EFCA 3NWJA 2C98A 4B34A 3M4YA 1YQTA 2JGNA 5LBIA 1XTKA 4AKIA 3U7EB 2GK7A 4BGDA 1E79A 1RE0A 1L7VC 2QSZA 3HU3A 2C9OA 1QHXA 2FSIA 3I61A 4PSAA 4J0QA 3EAQA 4LJ9A 1H65A 1W0JD 5JMTA 2G83A 2FSFA 4TTQA 1U90A 1AKYA 1GL6A 2ZJAA 3ZIAD 4BLRA 5H8WA 1TQ2A 1ZNZA 4FWIB 4LBWA 3GLGE 2GCPA 3FHCB 5FL3A 4OHZA 1V5WA 1G3IA 3KXKA 3A1UA 3UXMA 1DAFA 3NHAA 5JLJA 2QAGA 2D2FA 3WHKA 4M21A 3EIHA 3GLFB 3EZ7A 1ZNWA 1FP6A 2G0NA 2YVUA 2WJVA 2PT5A 2NTYC 3P1JA 3LBNA 2VIIA 1VTKA 1KI4A 3NEJA 4A2WA 1XB2A 4Q1AA 2I4IA 3FTQA 3T1OA 2EFDB 2WWWA 1CLUA 3T1TA 2WOOA 1ZM4A 1E9AA 1QRAA 3QPWA 1XZQA 2YZ2A 5J4YA 2Q9CA 1P3JA 2IYVA 4Q01A 2KBEA 1N3BA 2BM1A 2UZ3A 3KJHA 4K81B 4O25A 3REFA 1Z08A 4L5BA 2CLSA 4A9AA 121PA 3RSOA 1QF9A 1VMAA 2E87A 2A9KA 2AKAB 4ZDKA 2FEOA 2QORA 4C4PA 5CDFA 4JLPA 5DISB 1G3RA 2IT1A 1G6OA 1Q1QA 1E79D 4FMCF 4KJZA 5KO2A 1Z28A 2B21A 4ITRC 3AVTA 1MV5A 1NG9A 2JJ2A 2BBOA 2ZJZA 4Q66C 4GP7A 1KJYA 2O8FA 3DDCA 2CK3A 2O8DB 1CJMA 4I99A 1CJTC 2DWQA 3TQFA 2Q21A 2X1VA 4EFMA 5B64A 4TMZA 1QVAA 2D62A 3AF1A 4XJXA 5TARA 2F7SA 4IEIA 2A5FA 1A5TA 4M1SA 1FUKA 1ZINA 1ZD8A 1KDRA 3X1WA 1XTIA 4LC1A 1N25A 1T9HA 3K9GA 4XSHA 2REOA 4RCZA 3R9XA 1AS3A 1TF7A 5G3YA 1CR0A 3OE7A 421PA 1T0HB 2YC2C 2F6RA 3MJRA 2ZRFA 3THYB 3CF0A 4DDWA 4UXJA 1ZUNB 3TSZA 1U0LA 4FMDB 1KO5A 2NQ2C 3AVOA 2HUPA 2QPOA 5KNDA 2J0VA 2FV8A 3CONA 1P60A 3QF7A 4OHVA 4TLEA 4B73A 1CEEA 3TNFA 3KQNA 3DMNA 2JJ1A 2WIAA 3OAAD 2A78A 2QTVB 2ZS8A 4LJ7A 2DFTA 3KKNA 2RGGA 1TQ4A 3MJHA 1MO5A 1COWD 2AFIE 1R7RA 1S4QA 2PZGA 1VCMA 1W1WA 2ZSAA 3EZ9A 3GEEA 3LV8A 1Y3AA 5FFMA 3DKPA 4CEJB 2CJWB 1E0KA 3CRMA 5IDVA 1UKYA 2R6AA 3W5JA 2G77B 1KSJA 1T3HA 4W7SA 2I1QA 3NIBA 1S9DA 1C1YA 5BXQC 2JJ2D 5UKDA 3UMSA 2J7PA 3K0AA 2R44A 1YE8A 1Z0FA 2CK3D 4TLBA 4LBVA 3DPUA 1M34E 4MRNA 2IC5A 1S8FA 2F3TA 3Q5EA 4TZ0A 4DSNA 4CYMA 1F60A 3GLHE 3VX3A 4CVNA 3UMRA 1OXSC 4Q9JA 3D7MA 1D9XA 2CMKA 3VKHA 3OE7D 1P75A 2XOKA 5G40A 5TB5A 2CCGA 1RC8A 1C4OA 4KFUA 3UIEA 1VYTA 2YWFA 3I32A 3IKJA 4LYHA 1XRJA 2CE7A 1NLZA 1VG8A 3FFAA 1SULA 4AYXA 2BBSA 1Q21A 2C9CA 2K5UA 3DHWC 3GJ6A 2EFGA 3U3KA 1SVSA 3NKVA 5AK0A 3TJZA 4MGZR 4F93B 1XTSA 3R9IA 3A6PC 4JBWA 3MG9A 4OBEA 3F0TA 2C03A 2AWOA 4M4SA 3FMFA 2ODWA 2WPDA 1J7KA 3SEAA 3K0SA 6Q21A 1JQJC 3CO5A 4JVMA 1UAAA 4JLDA 3TE6A 2IXEA 5IF9A 4MRVA 2BMEA 1AS0A 1RRFA 4G5GA 2J7PD 1Q57A 4QGGA 1ZM9A 2FDCA 1VPLA 2A5YB 3RC8A 2CHQA 2GCOA 3A1WA 5FBWB 2AD5A 2GF0A 5JS8A 4OI4A 5HE9A 1ZYUA 2JCSA 2BBWA 1Z5ZA 1UADA 1E9EA 1OIXA 3HU2A 3B82A 1EFHA 1YR7A 1TF2A 5FUVA 1E9DA 4A2PA 2IA5A 3GMTA 2VF8A 3K0FB 3OIUA 2BJVA 4HI0E 4V02A 4BFTA 5CIWA 4DLYA 2C99A 3WMEA 4GT1A 1E69A 4A1FA 1G7TA 4BZXA 2H5EA 3WP1B 4HZUA 3TKLA 3CR8A 4B44A 5BWMA 2XXAA 1XWIA 1JNYA 3JVUA 3AP3A 2CEAA 4V0NA 1GILA 2CE2X 3UANA 4URVR 3TMKA 2ZR9A 3VR1A 1G3UA 3FHTA 4A82A 4AG5A 1XMJA 3LWNA 1IXRC 4WBSA 3I5XA 3QKRB 4NYMR 4C9BA 2CHVA 2ZU6A 2WMNB 4GRAA 2HJVA 2VYFA 2I1VB 2VL7A 3L2OB 3NG1A 1UJ2A 2ZSEA 5C4MA 1LY1A 2ODBA 2QI9C 4GPTA 2ZTSA 3FGNA 1NMXA 2IYZA 2PJRA 4PHTA 3LO5A 1LF5A 4CZ2A 1G1MA 2GZDA 2GJKA 1AKEA 5EZ5A 4ZI2A 3ZZ0A 1XJQA 2R6DA 2GRJA 1F2TA 1X1SA 4Q7LA 1N6PA 4EPXA 3GPLA 3VNVA 1Z63A 3ECCA 3DO6A 3DM9B 4IKEA 4BPBA 3G0HA 3IIKA 1E2GA 2VRWA 1W44A 3NH6A 2ZROA 1XTQA 1P2VA 3RABA 3ND8A 3QENA 3IILA 5FUWA 3EPLA 1GNQA 3TR0A 1KI3A 5E95A 3RNLA 1OKKA 2WV9A 3E2IA 2GVZC 1QHHB 5HR5A 1LS1A 1AJEA 2G1KA 4W5HA 2W2TA 4EIWA 2CLDX 2NO9A 3P4YA 4AKHA 4TLAA 1W4AA 4C2TA 4LJ8A 4LY6A 2W00A 1TX4B 5DI3B 4FINA 3ICEA 4NDZA 2JJ8A 3B1YA 5EXTA 4BQSA 3Q72A 1NVVR 2X8AA 1EWQA 4E03A 1T0JB 3BJIC 4Z8YA 3EW9A 1D6JA 4P4UA 2G88A 4HB2A 3RS4A 4URXR 3C14C 4QM6A 3KB2A 4LUCA 2OILA 3B8HA 3SYNA 2V55B 4EJSB 5L8VA 3ZZUA 3GJ3A 2PLRA 5CYOA 4DB2A 4C2UA 3KUCA 2GDJA 3ZVRA 4QJ5A 3CZPA 3CWZA 3K8YA 4FN5A 1Z0AA 2AXNA 4PZLA 1NNEA 4TYYA 3C7KA 1XEXA 3OFNA 5HKKA 3L82B 1ZM2A 3L8ZA 4LV6A 2QT1A 3LH5A 4PHFA 4N3NA 1G9XA 3NC0C 4YLGA 1E2MA 5DSZA 2WWFA 3BB1A 2ORVA 5SZHB 2AL7A 3K0CA 3TW4A 1B23P 1FL9A 3KTAB 3GJ4A 1VG9B 3B1WA 3KJEA 3LRPA 5FTMA 4DB4A 4O2LA 1UBFA 5L3SB 3LQRA 5JCZA 2IS1A 1SZPA 3K9NA 1HT2E 2H92A 1P6XA 5L3QB 1ZD1A 5AR1A 3I3SR 3M0EA 4HB3A 3K70B 4R71A 3P26A 2X19A 4KBGA 1VKJA 2QUZA 3MRSA 3AVXA 2GCNA 4LGMA 4LV8B 4C7OA 4NCHA 2O8BB 4D25A 4OJQA 2GESA 3NBZC 2YJTD 4HAWA 1P73A 2QMHA 4E22A 2KI5A 4JYBA 2PT7A 1DBSA 1IXZA 4NCJA 3A1SA 5B2ZA 2ZE6A 3TR5A 4GMXA 3UK6A 1ODFA 5DGXA 1O87A 5J4KA 3VMFA 4ZV4A 1GOTA 4A0FA 1VG0B 1XMVA 1RJ9B 1YJ5A 3SZRA 2HYIC 5JI2E 2ONKA 1WMSA 2QPTA 1XDBA 2DWPA 4RZXA 3ZD6A 3OFND 5BQ5A 5HKKD 2P5SA 4G5OA 2F43B 2AWNA 1FX0A 2BIFA 2Q6TA 3G82C 4PZYA 4IXMA 5EP2A 3RRMA 4D80A 2E9SA 1XJ0A 2Z6VA 4DRZA 4F91B 3GEHA 2QA5A 2FFBA 2JLQA 2QGNA 3L0SA 4KVAA 2Q0HA 1KI6A 4R9UC 1YZLA 2IX3A 3GJXC 3WMGA 1QHSA 5DYGA 2OBLA 4DDTA 4ZIRB 3B1XA 1WDTA 3ASZA 4L8GA 5CITA 4A6XA 3C4JA 1ZIPA 4Q19A 1E9RA 1IN6A 1XXHA 2MMGA 3EC2A 3T5GA 5KSYA 2J7KA 2VA8A 3WYAA 1JB1A 2W2VA 3FVQA 3LW7A 2GTPA 3EA0A 1J90A 3PEUA 3BWDD 4HEJA 1U98A 4I1VA 3K9LA 3LVQE 3D8BA 1W0KA 4LRWA 4ZDJA 3CX7A 2VSFA 3TSWA 1TQDA 4TL6A 2V54A 1E94E 3B1VA 2VPPA 4JSTA 5LD2C 1AGRA 1II8B 2BJWA 2J0UB 2XEXA 1G41A 1F2UB 2IS2A 1US8B 4LHZA 2OT3B 3SYKA 3NDBB 4KU4A 2F1IA 1CIPA 3GLIB 1GNPA 3U7HB 2ANBA 3THXB 1BH2A 4A92A 2OESA 3NTUA 3SHFA 1MRNA 1E1QD 1E99A 1PUJA 2ZI7A 1NN3A 2LKDA 4BLOA 5JJLA 3TK1A 1OIVA 2B7CA 2DYKA 4JBYA 4OHXA 2QQ0A 1OFTA 5EQTA 2QU8A 1MABB 4AKEA 1NMZA 2ZRGA 2H17A 2ZAOA 1TUEA 1VYVA 4YONB 1O3YA 1G4AE 2BDTA 2EVWX 3QBVA 2QBYA 1WRBA 1XTJA 4X8MA 3KJIA 5TMPA 1LV7A 4B76A 4EQ6A 2PX3A 5BYKA 4D4KA 5FBVB 4TYQA 5AJVB 4D4LA 5P21A 2WWIA 3ND9A 1P5ZB 2AX4A 3SJAA 1Z8FA 2HXYA 4MYTA 1IHUA 4B3GA 5E7MA 3PQCA 4FD2A 4DUGA 1OYWA 3WNBA 1NN0A 2OCBA 3MWJA 1NSFA 2GXSA 5AUPB 2VHTA 3T5DA 1MH1A 1ANKA 2HEIA 3MWKA 1GTVA 1P7CA 1KSHA 2FPKA 1XBTA 1EX7A 4OQNA 1IBRA 2OBNA 1OHHD 1EX6A 5KOYA 1Q22A 3K0EA 4NBSA 4P32A 4BFZA 3GFPA 4E5UA 5FPKA 3THOA 3H84A 2R62A 4ZCLA 3LBHA 5GADl 1G5RA 2W6IA 1GZSA 3U44A 3C5HA 4HUQB 2QMUA 1ZCAA 2IHYA 1Z0DA 2WAYA 1Q3HA 5CLLA 2FN4A 4HDQB 1BS1A 1UBGA 3N5CA 4QNRA 1J99A 4CEIA 3IO3A 1DPFA 4KVGA 4D0NA 5JEEA 2QM8A 4KV9A 1UDWA 2V8OA 3PUVA 3EASA 5JFGA 2OM2A 3Q8XB 4IVRA 2BMFA 5KDDA 2OBMA 2YWGA 1QHGA 3ZDQA 4G0NA 1KI8A 4RD2A 2ATXA 4PQFA 2IS4A 4CGZA 3BOSA 1OT3A 4IHQA 1MO3A 4MH0R 3CPJB 4PXAA 2J41A 4XSGA 5AJYA 5FTJA 3KUDA 2J1LA 3EA5A 1G4UR 4DZZA 2O8EA 2EU8A 3SI7A 2NPIA 1HYQA 1E1RA 3TSOA 4D0LB 4JVNA 3NBYC 1ZD9A 3UKDA 4A0HA 4CW7A 1GM5A 3RWOA 4JT4A 2DFLA 4A36A 3B60A 2HLDA 3KFXA 3QE0A 3GLFE 1ZW6A 2IF2A 2CVHA 4ACAA 2WHXA 2EYQA 3OIYA 1DAKA 3K53A 2B6HA 1KKLA 1Q12A 1W5SA 4PAQA 2O0KA 4PC1A 4MA4A 5GJWC 3SJBA 3VU9B 1HQYE 4EPVA 1KSFX 5CYPA 4LYFA 4RD1A 4A8JA 2W6ID 1KSGA 1CJVC 2UVQA 2VP9A 4PANA 4C3ZA 1E9SA 1GDDA 1N5KA 3RS0A 3U3RA 2IYLD 3B6EA 3AQ4A 3CRRA 3BBPA 3RRNA 3X1DA 3K0AB 4GBMA 2XAUA 1SKYE 4KFRA 2P6UA 2ZRKA 4RFSA 3WYGA 2B8TA 2VHJA 1L4UA 5A5GA 1CXZA 5BN4A 2D3WA 5F9HA 5ELXA 1OB5A 1EFTA 2NOAA 2Z0MA 2ZITA 3ZVLA 3ADCA 1GP2A 3ZIAA 4CEHB 3F3YA 4PSVA 3RC3A 1NKTA 4AC9A 3SC3A 2KSQA 3JZAA 1FMJA 1UFQA 1G64A 1E4VA 2G9NA 1N0VC 2IUTA 4HB0A 4N0DA 2QTHA 4ON9A 2DB3A 2VTKA 3KQLA 3GJ5A 2BEKA 2FGJA 1W4CA 2NMVA 2V9PA 2FF7A 1P2UA 3V00A 1ZM3A 3DKVA 1XJCA 4NKRA 3IDQA 3BRWD 1U8ZA 2IYTA 3CF6R 4BZPA 4F4CA 2ZSBA 4O0MA 2GXAA 3PJRA 3IQXA 4D26A 2GJSA 2J9RA 5FH9A 5FPYA 4PC7A 2J59A 1KNQA 1UKEA 5DIFA 4KXFB 2VP2A 2QPAA 4BFSA 4FMCB 4WOPA 1D2NA 1UDXA 3ONWA 1Z2AA 3WBJA 3A1VA 1E2QA 4DT1B 4Z1MD 1R4AA 1L2TA 1Y63A 5GJCA 4KFSA 3PITA 3NEYA 3PEVA 3H2YA 1NG1A 1T8TA 4OK5A 4B75A 3MFYA 1MRSA 2IWHA 3V4RA 4Q7MB 3SN6A 1E2HA 1K8RA 1N6LA 2HCBA 1B0UA 2JIZA 2OO7A 2FPLA 3CX6A 5IRCD 4MDFA 4US1R 5E3HA 1ELOA 2UKDA 4RFVA 1FP7A 3HJNA 2W0MA 4GNKA 1UM8A 3PR1A 3P4XA 4KFTA 2ZYVX 3SFZA 2ZYTX 2MSCB 2X2EA 3O8CA 5F2EA 1X1RA 1VYUA 1HQCA 1P61B 2WMOB 2D2EA 3H4MA 2HJGA 1DARA 1Q1ZA 2EYUA 4IOMA 4QGAA 3IHWA 4NMMA 2MMCA 1E2NA 1EXMA 2OFOA 1AZTA 1ZRHA 1W48A 4Q7JB 2ZREA 4NZYA 3OEHD 2KB0A 2AKYA 5JS7A 4B3CA 4BLQA 1SVWA 4JKIA 1KTVA 1OH5A 1TPZA 1N6OA 1WE2A 2QAGC 3WNDA 3IO5A 1SVLA 4LWZA 2QAJA 1T5IA 3EPKA 3OAAA 3FOZA 4L9WA 1SHKA 4WIAA 5FOSA 2REXB 1COWA 1NVUQ 4ABYA 3LVRE 1XF9A 3QKSB 3RYTC 1EWRA 4LSGA 4KAXA 2RGAA 4FCTA 2DBYA 5H68A 1XCPA 3GJ8A 4NL4H 1T3LA 4URUR 5AJXA 1GITA 3K9HA 1G3QA 5FOUA 3RDPA 4RVCA 1E2LA 5LB2A 1AS2A 3VFDA 1TTTA 3TW8B 3ZS9A 4PC6A 4LV5B 1D8TA 5G53C 1U9IA 2JIZD 4QRHA 4TMXA 4BZQA 3MGCA 2XNSA 5GVRA 2JLZA 1RRGA 3VX4A 1XXHE 3S1AA 4NH0A 3C5CA 1X3SA 4TQAA 1TEVA 4Q4LA 1FOEB 1XD8A 4FI3C 4LZZA 2ZYUX 1KI9A 2IYRA 3A36A 1X86B 3W34A 4DSTA 2BCGY 4NCIA 3BFVA 3QVVA 1TADA 4FXPA 3QG5A 1W46A 4KCGA 4Q4JA 5C46F 3U4QB 2BOVA 4C0SA 2NZ8A 2HT6A 1IM2A 2DWOA 1K6MA 3QF4B 5CB8A 3N2IA 4M1OA 2WSSA 2GBLA 3KKPA 3U2QA 4MRSA 4ARZB 3W8RA 5J4HA 1G8HA 1WB9A 1P2TA 1R5BA 5DN6A 3CPEA 4PPQA 1W2GA 1AGPA 1ZU4A 2MSEB 3LQQA 4Q1EA 4ZPXA 1AQUA 2H1LA 2XNDA 3GJ7A 2VLIA 2BEJA 5AJZA 4OYHA 4AK9A 3UMFA 2GBLC 1W36D 1NRJB 2IXGA 4BECA 2PMDA 3ZLJA 4DLSA 1DVRA 4DJTA 1CR1A 5HPYB 2C95A 4JLMA 2ZR0A 4OQFA 5IK2A 3RANA 1TF5A 2Q3HA 2OCAA 2RHMA 1QHIA 4HLQB 3AKEA 5HTKA 4B6FA 1GUAA 3MD0A 4US2R 5HCIA 1CRQA 5L3RA 4P33A 3DZ8A 2ATVA 1H8ED 2J3EA 4TYPA 2EW1A 1EG7A 1YZKA 1WA5A 1SXJD 1OV4A 4LC0A 1NSTA 3FB4A 1Z06A 1DG3A 3HP1A 1DO2A 4MGYR 4CRWB 1YZGA 4A0RA 2GJ9A 4IJMA 3L43A 5K8LA 3GLGB 3ZGXA 1GKUB 3CM0A 3T1VA 2IUSA 2JLVA 2O8CA 1KMQA 4DLWA 4IVPA 4PX9A 5FBQB 2VHQA 1NIJA 2WSSD 1E4YA 4QHSA 2YKGA 4QGFA 1YZNA 4C7OB 1VIAA 5JECA 3T61A 1TL7C 4TMVA 1OXTA 1DG1G 1G17A 1ZNYA 1XPRA 3AUYA 4M9SA 3MLEA 5DN6D 3P20A 5EE1A 4QOSA 1CP2A 4HB4A 3EWSA 4JL6A 2XNDD 3TAHA 1W5TA 2O0JA 2ZSFA 4KITB 3I1FA 4ESHA 3O8DA 3DL0A 2QRZA 1MO4A 2ZRLA 4FIDA 1A2KC 2YNMA 1RYHA 5IHPA 4G3XA 4IDNA 4K46A 3BAFA 4NU0A 4UNSA 3C8UA 2V3CC 1TEXA 4M0LA 5IK2D 1GNRA 4L4UA 4V0MA 3NVAA 1FX0B 2CDNA 4HAVA 4DCUA 1XZPA 4HUTA 3KQHA 3C16C 1FPMA 1U8AA 3OIVA 4HATA 4Q4AA 1KMHB 1Z3IX 2GXUA 2ZJ2A 5JWRA 3AVVA 4BFYA 1KI6B 2QMOA 4HLDA 4A0GA 1OE0A 5DNYB 4P4SA 1LTQA 1CR4A 1T5LA 2PZEA 2YWHA 5EE9A 3NHBA 3FDIA 5LD2B 1YVDA 4NTZA 4BFWA 1IY1A 1DS6A 5TVKA 4Q03A 1FNMA 1SHZA 4R98A 1G7CA 2FU5C 3T12A 4P3YA 5DLQC 1FQJA 1IQPA 2YWEA 4KO8A 2C8VA 3WHLA 4DHEA 2XZLA 3U60B 3TLXA 2EWVA 3ZQJA 4BE7B 5J4VA 4AWXA 3LLMA 1CJUC 3T34A 1OXUA 3RS3A 1VCOA 5FOVA 2AR7A 4V03A 4B3FX 1ZUHA 2AFHE 2NGRA 4RKFA 4XH9B 3GLFA 1PVOA 4DLZA 3T15A 2L0XA 1E2FA 3IGFA 3JVVA 4ZDWA 2TMKA 4TSFA 4QHYA 2OSBA 3A8TA 4RY2A 2EFHB 4AIIA 1R0YA 2IYQA 2PBRA 4BEJA 3VTKA 2OZEA 3HU1A 1S0UA 3AVQA 3B2EA 4TTRA 1FZQA 3KL4A 2CL7X 1ZAKA 3IPYA 3LXXA 2RGNA 2A5GA 3Q7QA 4R7ZA 4DXAA 4BFUA 2F3RA 3GFOA 4M53A 4F4IA 4JLOA 4B2IA 3W90A 4G5SA 3G5UA 4H1UA 2Z4RA 5JBQA 1TNDA 1KOFA 4GOXA 2QBYB 221PA 4PHGA 2YOHA 2PZFA 1ZIOA 5CJPA 4UXIA 1I4DD 4EQ6B 4A15A 2VO1A 1A7JA 4IW3B 3GLHB 5EP3A 4C0QC 4JJZA 3VKGA 2D74A 1AA9A 3IEVA 1KY2A 1YR6A 1M6NA 2G1JA 1K5DA 2Q9AA 4PAMA 5HZHA 2FH5B 1XNJA 2LKCA 2OCPA 3SS8A 4RD4A 2GZAA 1KJWA 4PR0A 2XZPA 4WZBE 5ANRB 5E7IA 2F1JA 3LNCA 2VQSA 1AZSC 3RS5A 3P27A 1T3SA 3A4LA 5FOXA 2FE4A 3UATA 4AYWA 2ZANA 2D7CA 4Y0AA 1ESNA 3OF5A 4TMKA 3NBXX 4TSFD 2P0EA 3A4NA 4QKQA 3QY0A 4YMTA 4B35A 3THYA 3K09A 2W2XA 1N2CE 5KNBA 2E1RA 5EE0A 1I4LD 2OAQ1 3CRW1 3M1IA 2XB2A 2ZRJA 2J0QA 2AXPA 3L8YA 4B2LA 3WBKA 3MWLA 4LJ5A 3U44B 4NHOA 1EK0A 1WP9A 4M1TA 1VECA 2ODNA 3U7FB 4QNMA 3THWB 3SHWA 1LS6A 1BKDR 1DADA 3KX2A 1RZ3A 3REGA 1CJKC 3L0PA 1CU1A 2V7QA 1G20E 3K09C 4CEJA 4HZIA 2CVFA 5M04A 1LVGA 2CJWA 1OXXK 4M8NE 1BIFA 1WCV1 3LX8A 3E70C 2B8WA 4MRPA 4DKXA 4JS0A 1S3GA 3PIRA 4MRRA 5CK5A 5FTLA 2ZI9A 2P2LA 3BB3A 3HPRA 1GL9B 1QG4A 1JXOA 3SBEA 1FW6A 4GZLA 3R8FA 2GZHA 3PUXA 2O8EB 2WWXA 4DLUA 3K0CC 3Q3JB 4PO8A 4URYR 2LCFA 4TMWA 4URWR 1JALA 3BIFA 3BERA 2XITA 3SR0A 1Z6YA 3AP1A 2BV3A 3C41J 3W9YA 1G6HA 4OKSA 5CJ2A 3OESA 4QHTA 2WWYA 1D9ZA 1T6NA 3FWYA 2JLWA 2ZVQX 1NN1A 4W5WA 2H16A 3BFKA 2Y8EA 3WRYC 1IN4A 3O8RA 4MYHA 4ASUA 4OHYA 2QP3A 4B3DA 3WNCA 4Q9KA 2H18A 4OK6A 2YV5A 5KSOA 4Q4HB 2PLFA 2RGDA 4NP6A 1E1QA 3W5IA 3DOEA 4Q02A 4QFMA 4ZKDA 1T91A 4LHWA 1R10A 4ZDIA 3I62A 2ZE8A 5K8UA 4V0LA 2RHDA 1BOFA 4RFSB 2V7QD 1E2KA 1SXJE 2FEMA 1XMIA 3SJCA 4PC3A 4YXWA 1H8HA 2JLUA 1X8LA 2IYSA 1SVMA 4F38A 4Z8XA 2BC9A 3RWMB 3U61B 2J87A 3W3AA 2ZJ8A 4KSCA 2BCJQ 4QC2A 5JHGB 3DOFA 2WJJA 3FKQA 4OL0A 3AGPA 1S1CA 2X2FA 3SJZA 3TRFA 4IDPA 3CBQA 3TQCA 3CH5A 1TU3A 1E2IA 4LJAA 4NE2A 4AYTA 3Q7PA 1BMFA 3HPQA 4POAA 1YR8A 1U81A 3QPVA 1G8FA 2XTZA 4HYYA 3U5ZB 5E7JA 4Q48A 1HA3A 2OLJA 2QT0A 1EFUA 4X8OA 3EX7C 4QGHA 1M2OB 4DDUA 4MUAA 2BMDA 1NF3A 3VR4A 1IONA 1Z6GA 2FJUA 4IEEA 4L9SA 1OHHA 3RHFA 4ASUD 4PSKA 1ETUA 2B92A 4OQLA 1WXQA 2IEYA 4WA7A 1W49A 1N0UA 4V0OA 1GSIA 1E9FA 1NJGA 2ZJOA 2VP4A 5EP4A 4ESVA 4NCNA 4RD6A 1L8QA 3K1JA 5EUMA 1J8MF 1ZC4A 1ZM7A 4B2PA 3ZH9B 1PUIA 3RLFA 5FPHA 2RH5A 4HDOB 5A4JA 4UNPA 4PPGA 3QKRA 4OJKA 3CX8A 1NP6A 2FFQA 3U3MA 4JBXA 4DLRA 2JA1A 4YXWD 2RGBA 1H8HD 3FHOA 4IDOA 3AKYA 4DCVA 5AUOB 2FG5A 2WZQA 2KWIA 1I2MA 2IW3A 4U5XA 2P6NA 2QG6A 4HAZA 5C18A 1D2MA 3LXRA 2R65A 2ZIAA 4R2HA 2A7QA 2QAGB 2JDIA 1AIPA 4TL8A 1MO6A 5EXPA 3QG1A 4DCTA 2ZXUA 2FSGA 3JZMA 1W47A 4HLUA 4GFDA 1YZTA 4C0KA 1BMFD 5C1BA 2CL6X 4GZMA 2XZOA 1SVKA 2ANCA 4O3MA 1M7HA 1E98A 4KYIB 3BE4A 4XD7A 1WF3A 4JLNA 2FFHA 1GRRA 2JASA 3Q5DA 2CHGA 4HAYA 8OHMA 2IWRA 1M7GA 2NO1A 2A5DA
chains in the Genus database with same CATH superfamily
5GY7A 1V2GA 1E0SA 1TU4A 4TYMA 4F5DA 1SFRA 4ZT7A 1WXDA 2FAXA 4K3VA 4X90A 2IP4A 1HOTA 2H9AA 1ULZA 3B9BA 3CEHA 4ZEVA 3EIFA 2W6QA 4HYTA 2AN3A 3B5EA 3R5KA 4ERNA 3RS7A 3B85A 4JGBA 1FDVA 4RD0A 1U9CA 1PV2A 5LZ4A 5A02A 3Q9NA 1TK3A 3QJ5A 4BMPB 4LF5B 5AKLA 3WNQA 1AVTA 3A26A 2F9LA 4PO9A 2D1SA 1I3LA 3HB0A 1YA4A 2ZTUA 1E9BA 3II6X 2W93A 1FFCA 5DASA 3RJTA 4DLNA 4H9GA 3BTVA 3N74A 4Z2YA 3S1AB 3C3AA 1II0A 4D8TA 3H5AA 3T9AA 1AX9A 3PF8A 2QN7A 3R0VA 3O8OB 3AVYA 1DTWA 1XLVA 2JDID 4LJ4A 3AHCA 3ANMA 1E3JA 5GIOE 3HCWA 5C1PA 2RHRA 2R9VA 4FNGA 1T2EA 3W5SA 5EP1A 4TMTA 2Q7XA 1O9BA 1PG5A 5BSFA 1JECA 4HFRA 3IE1A 5AOAA 3OZ7A 1E7YA 1P1JA 2GN0A 4YMUA 4MMZB 1AHNA 3ETDA 1PNQA 3DBHB 2GAAA 1I3MA 2WJGA 3NONA 3GFGA 1CR6A 2XTMA 2JRCA 5BV2P 2V6MA 3HXPA 3VJLA 2RHOA 3ZX4A 5AW6A 4DS3A 1CUGA 3ONVA 2XB4A 2VKQA 5KSWB 2Z2JA 4NMXB 5BMVF 4WN9B 5ALEA 1KMMA 4XIGS 4RIIA 1LLUA 1RU3A 4M9QA 2HO4A 2C77A 4MPDA 5LWQA 1R9MA 1WBBA 3L0IB 2QTZA 1R3DA 1N7IA 4I1SA 3AINA 4KLCA 1EFPB 2HIGA 3RS8A 1TA9A 3LT1A 4U7DA 1TK9A 3IQEA 2Q8NA 2Q5OA 3N70A 3ENQA 3IPAA 4FHCA 4MQ5A 5DXAA 1BCRB 4HC4A 3UMGA 4U6NA 2AKEA 4AXXA 4CIDA 3MWEA 4XOIA 3C3PA 5K7SA 3S3TA 1GKKA 8LDHA 3BWBA 4JIMA 4CTMA 4TMFA 3ED1A 2HAEA 1YR2A 3AT1A 1GUFA 1QTNA 3IQFA 5ENVA 3NO4A 4AURA 2WVGA 2XGOA 4H7HA 3VR5D 3PQ5A 4PZDA 3H5TA 4YECA 1UKVY 2AJTA 2VPQA 1KP2A 1PR3A 2DT5A 2IBMA 3COZA 4OM7A 1TB4A 5FOWA 4LGCA 2RGYA 4D6PA 3NC4A 2C8LA 1UEIA 2M6RA 1DHRA 3I9LA 1YZ3A 5CA1F 3N3BC 2PMFA 4IV0A 4RANA 1UWKA 4QPZA 1YB2A 1SQ5A 3DVQX 4JI7B 2H5JA 4M9ZA 1M7BA 3PWKA 1Y7TA 4IGFA 3IVMA 4Q21A 2HK9A 4RO0A 4WERA 1YZQA 3UWMA 1QVZA 3NIWA 3C6KA 4UCQA 5KNCA 1QP0A 4D4GA 3R0QA 1SBTA 2FFRA 1DKUA 2ZIEA 4X1YA 2VDWA 4UZFA 4RTQA 2RIPA 1EK5A 3SC2B 2DULA 4W8OA 1F4PA 3FMPB 4YUAA 2NM0A 5H82A 4C3OB 2FZLA 1X13A 2PH1A 1F5SA 5D5QA 4AF8A 2HA7A 1IWPB 2X1LA 5FLXA 3GRAA 3HA2A 3ZU2A 4YDHB 1W4RA 1Z88A 2A0FA 4K9QA 3QSYA 3FN4A 4JQCA 2DX7A 4PX3A 2INGX 4IIUA 4MVJD 1GCAA 2HDOA 2LNDA 3UH0A 1J7JA 1YXMA 1OH8A 5B1IA 5IVHA 3LPLA 1F9AA 2DPXA 2JLCA 2Q62A 2Q1XA 3PBKA 4P31A 4XARA 3S4YA 3LDAA 4K1XA 4D3SA 3OQOA 1F0NA 1VHTA 1ZR4A 1VPTA 4N5MA 1ECFA 3UPUA 2W7TA 3H05A 4HDRB 5L4SA 2ZBVA 4LXIA 1WSWA 2GD2A 4CETA 1DXOA 3PFGA 4JQZA 1JF8A 2ZSDA 2UVDA 4Q6BA 4XJTA 5CMLA 4MDEA 1XLUA 3W5VA 4YV2A 4YC7A 2IU0A 1R2QA 3L3BA 2BRUC 3VYVA 1B0ZA 1KRWA 3RUFA 4OLAA 4KH1A 2GCOB 4K3UA 1IJFA 1C0PA 1VMEA 2PRJA 4RWZA 1R6AA 2H2DA 1FFXB 2B8EA 5D5PA 3IERA 4KQEA 1KEVA 1MOPA 3THXA 1YZHA 4PYQA 2FGKA 4EDHA 1I3CA 2GETA 4DCJA 5K6AA 3V32A 2NLOA 1JDBB 1J8YF 2VQEB 1DOAA 3WZMA 3PC6A 4ZQGA 2MINB 2B3TA 3LLUA 4UUMA 1K3TA 3D59A 1YJQA 3D8RA 2WKQA 4YJ3B 1GPKA 5B58C 1EXWA 2LIVA 2QRPA 2ZRIA 3GCXA 5ALVA 1OH7A 2PKEA 1HURA 2BMJA 3IB6A 2ACVA 5HJ2A 5BVHB 3K2IA 1KC3A 1Z4JA 5I8PA 2DHEA 4LHXA 4RK6A 1H6AA 2D06A 3FPBA 3MCUA 5DWVA 2XJ9A 3OO1A 5K6AC 2ASVA 1Y6JA 2VP6A 4EKEA 1OX4A 3AP2A 3B9RA 4M49A 5JYEA 2UZ1A 5A5FA 3TI7A 4JYZA 3JAKA 1Y9EA 4UPEA 1MRZA 3ENZA 4JYPA 5DCUA 5CDHA 1XAGA 3P9YA 5IHXA 1ZNXA 2X0JA 3BGSA 3IKVA 1WXEA 4URZR 1X8JA 5JWOA 3I5YA 3DDSA 1QK4A 3KKQA 3LFUA 1E62A 4H2DA 4DLTA 5EJ4A 1Z83A 4YHHB 4B87A 3DNPA 3LGXA 2FZCA 4D1YA 5K9ZA 2NNLD 2UXDB 2Z1DA 1Q1BA 3OOYA 5IXYA 2Q5LA 5IC6A 1XCJA 3WMFA 1GNTA 4QEKA 3HYTA 3E2MA 2O2YA 4QTZA 3DVLA 4FFRA 5EN4A 3JQPA 3OZWA 1YMVA 2QRVA 4J7AA 1QK5A 2HXSA 3WDLA 4JA2A 5CBKA 2MT9A 5CLFA 4OA5A 4UPVA 3C3YA 3QYPA 4WN3A 4J0KA 4F6CA 5KVAA 1GO2A 1A4UA 3C6XA 5FWAA 5HEKA 1EJ0A 3MBKA 1P72A 1SVUA 2BONA 2YHIA 3GDFA 4BB0A 4AI6A 2GTHA 1MV8A 1SKYB 4DE5A 2G04A 4X3CA 3OY7A 5JZBA 1JQDA 4D8VA 2EOAA 4I6JA 5DGTA 3X1ZA 4ZCMA 5K0EA 2ZRCA 6NULA 4D8UA 3ZCSA 4F5YA 3VHXA 4NS4A 1AN0A 1JR3A 3BS4A 2JCXA 2VDLB 3UENA 1C9KA 3MMPA 4O1MA 2CV0A 2ZI6A 3OSUA 2FVYA 3ZU3A 4EFLA 3NM5A 1BGWA 2NYUA 2QUKA 2GFIA 3AM4A 3MF4A 1GLNA 4FFWA 2HADA 1FRVA 5E7QA 1CUUA 4JJFA 3REQB 3H83A 2CL5A 2PH7A 3HVHA 1W9MA 3W79A 2FR0A 4ARUA 1RJGA 1U3UA 3PNQA 4RF4A 2YJZA 3B89A 3DM5A 3EFHA 3CKLA 2CUZA 3A9RA 1QNLA 1VMDA 4N3BA 1IRXA 3DWEX 1MUUA 2Z4SA 2WVJA 3R6TA 2MCFA 4R1QA 2VDKB 1SUAA 1MJGA 3H9CA 3QU4A 1ZUWA 4FFNA 4LPSA 4AY4A 1WV1A 1Q3TA 4W7HA 2XYRA 5FBRB 1P1FA 2P90A 4P7FA 1KQNA 4EG6A 3QI2A 4NICA 3BGWA 3FWHA 4I2NA 3TE7A 2H4XA 2Q2OA 5AVKA 5J63A 1MOZA 1TVEA 1XX6A 1IHOA 2VLBA 5AM0A 3I5UA 5I7VA 1EG2A 2HV8A 4GM0A 3OZBA 4X60A 1WQ1R 1YZUA 3GFTA 4X71A 1IG3A 4BVLA 3K35A 3F5FA 4N7MA 5FV7A 4OU4A 3ZOZA 3DAOA 3PWSA 4MW4A 4WKNA 4B48A 3LX5A 2DHRA 4EENA 2AB0A 3V42A 2QZPA 3CRNA 5DHAA 2E18A 3UHPA 1IAQA 4IFEA 4BASA 5EE5B 2OLKA 3OE4A 3PUZA 2PQMA 4L15A 5D3MA 1JEEA 2H65A 3KWJA 3TWOA 2BZSA 2PX6A 2PL3A 3G02A 2O05A 3QGMA 1GPH1 3VR5H 1NLFA 4DR2B 3CZAA 5CVUA 3L18A 1FUUA 1XFAA 2QV7A 4EA9A 3ZD7A 3K5PA 3ETNA 3IVCA 3N7AA 4JVOA 2AHOA 3ED5A 3MTAA 3AF6A 1RMQA 5AKXA 4IVQA 4BNFA 1WUJS 3ZWYA 2JAXA 3A58B 3H04A 2OCDA 1WBJB 1UBRS 3WZLA 4GVXA 4RFLA 4M1WA 1YJXA 3ZWMA 3BQMB 3R3ZA 3VO1A 2IZ1A 4KIFA 1FYFA 1Y9JA 3FPAA 1IN5A 3WGQA 2JLRA 1YQ9A 2L17A 3KT6A 4GUDA 3GGCA 3KKOA 2P65A 4JLBA 4TROA 3F5DA 4HLNA 1X6VA 2P0AA 2GA8A 3BK7A 1HRDA 4TUYA 1YU9A 2Z3ZA 1WX1A 4LKOA 2JI9A 3FVTA 3BYZA 4N9QA 4WLEA 1XZCA 1I6WA 1KMIY 3QEMA 2JJ1D 3QTBA 4Z54A 2EG5A 5SY6A 1H42A 4R1UA 3NGXA 2J6HA 4BN0A 1MAUA 5JFTA 4KGVA 3BE6A 3HGTA 4K9LA 1QYVA 1QZXA 5ALRA 3ZWQA 3QYFA 4LXHA 4RORA 2I2AA 4ANFA 3T3EA 2JLYA 4KSBA 4DMMA 2PL5A 1BWPA 1O03A 4J49A 4DMCA 4N41A 2QN3A 5TT1A 2F9MA 1FK8A 1PEAA 5CH8A 2ZBFA 4MVWA 1XXHB 3MS2A 2VATA 5LZ9A 1QWSA 4RU1A 2CCKA 2ZFUA 4O33A 1Z3CA 2P4SA 2WBLC 4BIMA 4EABA 1DAGA 3DFZA 1PT5A 2GF2A 5HCNA 3D2BA 3EQ6A 3MINA 4OYYA 4ZYVA 4RULA 1E32A 2GHIA 4ZZIA 3DV0A 2F55A 1CRZA 1F14A 2OP1A 2AN9A 3ODGA 3FZQA 2J6IA 1PJRA 2OEPA 3R44A 2UUPA 2ZBUA 4JYCA 2Q6KA 1V8FA 4RDXA 1RXVA 5JZVA 2AMVA 4ZEWA 3EG5A 3V4SA 4WVFA 1P44A 5CM8B 2EC5A 3WIEA 1DKLA 3L7BA 2VSXA 4S3MA 1RLUA 2QVGA 2QP9X 3N8DA 1NT2A 2QPLA 3DNFA 4G1BA 3NDJA 2ORED 2A4MA 1TAGA 3X1KA 4B71A 4EL0A 3A6FA 3K20A 2PGIA 4ND6A 1M0EA 2V1UA 1H4SA 3EARA 1BTOA 3EPRA 1M8PA 1Z6AA 4RIFA 1JS1X 2X77A 4GX2A 4KXWA 4BV3A 5CBPA 3ZBTA 4PCLA 2ZULA 3LCRA 4DG8A 1Q1EA 2PUBA 2FZVA 1GGJA 2JK1A 1BYUA 4NZMA 2SKDA 5DDIP 1G9TA 3P2MA 1C30A 2YHBA 3DAHA 4EM6A 2WWHA 3O73A 1KY3A 4HNVA 1PQYA 3W2GA 4D0GA 2O5EA 1QRSA 4GHWA 4BJ3A 3NBFA 1ZAYA 2GF9A 3AW9A 4L8LA 1XYYA 1SVOA 3QVKA 1GG2A 4G86A 4F84A 5DWDA 1BZYA 5CXUA 3Q9SA 3BJRA 3H3XA 1R8SA 1ZBQA 3FVRA 2ZIZA 4UTRA 3OFJA 5DCYA 4DNPA 5KPDA 1DPGA 2OG2A 3MT7A 3L6RA 3U9LA 4DYVA 1G7SA 4Q00A 1XR3A 1K0UA 1Z5WA 1WSAA 3OZFA 4J2HA 1SUWA 5JSKA 3EGIA 3TEJA 4QRIA 5C37A 2BY4A 1HI9A 1OJLA 3D31A 2OQVA 5DEIA 1CS4C 1RW4A 1NXQA 4WKCA 2XUQA 4RE6A 2JCYA 4F7WA 4BE9A 3KDAA 1SUSA 4F45A 3UGJA 2EIXA 3U1BA 2FOLA 2ZR7A 3VR3D 1NMQA 2NSHA 2EKBA 4DSOA 1JEQB 4XR4A 4RZ2A 4Y9SA 2ZS7A 1UMDB 2NTEA 4L76A 1HZJA 2Y4NA 3QBTA 1EHIA 4QG7A 4GG1A 4KODA 4ARIA 1RWXA 5FEMA 3MJDA 1GAQA 1E6MA 1HRKA 1VLLA 3EEYA 1ZI8A 3AF2A 1BW9A 3NUGA 3VDQA 4XDGA 2DPGA 4MLZA 1WQ3A 1C9YA 4ALIA 4MI1A 2XD4A 3WXMA 1PWEA 2QE6A 5GZ1A 4Z9FA 3U4QA 4BFVA 2A94A 1ZD2P 1P7VA 2DOKA 1MB4A 2ZK7A 5KSZA 2J0SA 1DCFA 1ZUIA 3HR8A 4CKBB 3OVMA 2ATEA 2NXJA 3PTLA 2GWRA 1QE0A 1JPVA 4Q18A 2J33A 2BMVA 2PGLA 1NBMD 2NPOA 3WTBA 1BQ4A 1ACMA 4NLLA 5F7ZA 4XVCA 5HDQA 1YRBA 4Q3BA 3ICQB 1CULC 4TM7A 4E2YA 2QL9A 2P69A 5HQJA 5I4IA 3FGZA 5KKAA 4UNRA 3E18A 5JCJA 1SU7A 2WTUA 3W8NA 2A9RA 2PUEA 2PZBA 2W11A 2IGTA 3GELA 5LDDC 1SWWA 5LB4A 5KYXB 4JLJA 3R5TA 4ZEOA 5G0TA 5BO5A 1PV4A 4JSRA 2QXUA 4PF1A 3QU2A 2BFCB 2VG8A 3LP8A 1EDZA 1TJ3A 4CM8B 1KEKA 1EJ6A 1BO6A 1R5NA 3SU8A 3URKA 1E61A 2GDZA 1KO4A 3KKMA 4LWQA 3BJZA 4M2LA 5L7WA 1JLRA 5JYBA 1W96A 4CMJA 5E4YA 2AZTA 3H5VA 3OHSX 4JNCA 1XC7A 1QONA 4MLDA 4NCKA 4RGBA 4GI1A 4YMSA 5FWXA 2CSUA 4XI9A 2HQRA 5IASA 5FUYA 4OSOA 1OPRA 1ZK2A 4B43A 4QZVA 2FW6A 2R6CA 4HNRA 1S3IA 4BP3A 2C58A 3NALA 1FRQA 2FFJA 3AR8A 3FSRA 2AK3A 4M7PA 1P4RA 3C39A 1O57A 2PGXA 3ZD9A 4XQEA 1HV8A 3F5SA 4D8WA 1DSSG 3O03A 4A2QA 5B57C 4WKGA 1OKKD 1WD7A 1X7YB 3ENWA 4FJ0A 5K1ZA 1O4VA 1CY0A 3VKUA 2D1QA 2IHZA 3R5XA 3PRYA 2HWKA 1T6ZA 4M7WA 4YNBA 5DMHA 3RFTA 1I2AA 1XP8A 1J8VA 1M5RA 5JRZA 1PR2A 2GHQA 1E0AA 2AFHB 2ABWA 5CH3A 5FX2A 1MD9A 4EPRA 1VSUA 3EIEA 1IDOA 3D7RA 3WBFA 3JASB 3EIQA 3LUPA 1DB3A 5ALWA 4D4JA 4EY7A 1FQOA 3CLSD 3DXXA 3HY3A 5JASA 1WL8A 2W2KA 4KN8A 4BFXA 2COKA 2IEZA 4KI0A 1KK3A 5FUBA 3LL7A 5A62A 2DQSA 4WESB 5EWLA 3UG7A 2VHUA 4OQXA 2VK8A 5JXIA 4DABA 2VWPA 1VDZA 1Z6XA 3K71B 3D6TB 1NXVA 2HWXA 4ZVVA 3R9KA 3L8MA 4GBJA 1W85A 1Y80A 2D4AA 2LV8A 2CCJA 2VJDA 2WYOA 2Y1GA 4ERXA 3QHAA 1FP4A 2Y1OA 4UJ3A 4R1LA 2RK6A 5H4GA 4UVGA 4XVRA 4C7KA 5BY2A 5AVRA 3C3WA 1SBZA 4UNNA 3J80A 4FCWA 4W9MC 3U0VA 4D5EA 9LDTA 3X1YA 1MH9A 5F21A 3H2KA 1O5IA 1ZRNA 2X9LA 1WVGA 2Z3VA 1KYXA 3L92A 4YRAA 4YLYA 4LE2A 3ETCA 4EUFA 3H1BA 3UWDA 1EBUA 1NAHA 1YHNA 1IOZA 3EF1A 1DUSA 4MUEA 3CUSA 1EE2A 2JL1A 1QX4A 4M37A 4AF7A 1TO6A 2Y2UA 3M81A 1IL0A 2HIHA 1L4HA 1YD7A 2OXRA 3K0FA 1RWBA 1J2YA 2BL4A 2WOJA 3C3XA 2BYTA 2P6MA 3VSEA 2DGDA 2ZYHA 4QJ3A 4A6PA 5JVDA 4KNYA 4FGSA 2PKRA 3H6HA 4AF6A 4EX6A 5DSXA 3AEZA 4Y2XA 1YFLA 1MF7A 2IODA 3M6XA 3Q4GA 4NZZA 4EPYA 2EP5A 3L49A 3MEQA 3O0TA 4QQ8A 4G41A 1HTWA 1COZA 4H35A 2YIDA 4JLWA 1RC0A 3R0ZA 4MMYB 1YWGO 3D0QA 1P80A 2H8GA 4BEBA 3OLCX 3GFQA 1U5BA 5JNSA 2FPMA 2C3OA 2P2NA 4YJHB 3AM5A 2EARA 3FBTA 4N65A 1XCMA 1MENA 1UZLA 3PV0A 4R2JA 5GJBA 1FS4A 2VJMA 4C1NA 4K9OA 4QX6A 1HYHA 1KVRA 1XMSA 3IVRA 3MA0A 3C6MA 2H2GA 2ZJ6A 5JQGA 4OI0A 4AMBA 1E58A 3GPBA 1K89A 3QFRA 4WLFA 2VS1A 2VOEA 4GOKA 4RGVA 3ZY4A 4EMTA 2AFIA 5I9NA 2ILTA 4ZMBA 2FVXA 1EYZA 3T7AA 1G20B 4IDBA 4PLGA 4Q1FA 4JP3A 1FFHA 3AUUA 3PQ4A 2UUCB 3TN7A 4D0SA 1ZP6A 1J2JA 1G8GA 3L1VA 4MHTA 3KUUA 4RV5A 2JW5A 4YAIA 3ZI0A 3BMOA 4TV8A 1W34A 5A0FA 4NFHA 3U3OA 1JXMA 2AJCA 2VR1A 3RTDA 3K1YA 3ONFA 3W8FA 4TL9A 1NNUA 5T3UA 2EGHA 1NW3A 4B9AA 1M9NA 3WL3A 3BC1A 3L7KA 4LXXA 2IXDA 1JAHA 5TARA 2FWRA 1TJPB 4E30A 3QEAZ 3VR6A 1DOHA 2ZUSA 4PG7A 3L77A 4JL8A 3NM4A 1NR5A 4KPFC 2YW2A 4C5BA 3GLHA 2HT1A 3DV9A 4UXHA 1DOZA 1A9PA 1RKBA 2JGRA 2ZAIA 3CGGA 3D7KA 4OJMX 2BUBA 1F17A 2KBFA 2XUGA 2CBZA 3OECA 4U6SA 4UUQA 2R0QC 3OH8A 4KREA 4GI7A 1BCSA 4LJLA 4UVEA 1W0KD 5FLYA 4ER3A 1RQRA 1KARA 2O8NA 5ED4A 4DIBA 3HU5A 5DK6A 3R7DA 5JJKA 3AY7A 4YWJA 3S8EA 2Z43A 1FTSA 4OKIA 3GA7A 3ASYA 4P35A 3QVUA 3FTEA 3OQBA 3O91A 1RC1A 4P9NA 2FQWA 1T10A 3ITEA 1W75A 2VJAA 3BH0A 4GPIB 2JATA 4KSYA 4MX8A 4PZUA 2PBFA 4Q4DA 1XD2B 4UBNA 3W9UA 4NENB 1UK8A 3LD9A 4WX2B 2ETVA 4HL6A 3QEOA 3ROGA 4DUZB 3K1AB 2VJLA 4D96A 4DEYA 4NMLA 2EZ9A 2PH3A 4ETWA 5F3RA 3H4VA 4ZOLA 3A7EA 1Y82A 2FA9A 1IUKA 2GXQA 3VDMA 1V1RB 5KUTA 3I9V1 4C0WA 4BQEA 5EZSA 2FZ5A 3ICPA 5KJEA 5BV8A 1VPEA 4R2IA 2CXUA 4CBVA 1NFQA 2Y0EA 4C0HA 3GIDA 2WV7A 3DZBA 3JQFC 3OJXA 4ND1A 3TL6A 2ALJA 5HKOA 5CB6A 3THWA 3IOMA 1W2WB 2JRLA 2ZB4A 1WOYA 3EXHB 2OFWA 3EVZA 1TUIA 1D6SA 4WI1A 1ZL2A 3L01A 3I30X 4I1OA 3KTAA 4YP7A 2QY9A 4ITUA 4KEAA 2HBZA 3ETGA 3S28A 4JVSB 3TLYA 4EB3A 1UFVA 3BGVA 1CUXA 4HBGA 4MWEA 5A03A 1I6LA 1TMYA 3AVWA 1KZ7B 2OP0A 4Z9YA 2JGDA 3IAHA 3D3WB 3O82A 5BW5A 4FC6A 2GK4A 3UJ9A 2A3RA 3FLMA 4B74A 5L3QA 4RS4A 2QX4A 5EIAA 2ZRDA 4Y9DA 2OC9A 4LOJA 5AI0A 4TS4A 2RB4A 3NDPA 4LVNA 2HC9A 4DUGD 1NVVQ 2VUSA 4OG2A 1WO8A 4LDNA 1E9VA 2AC2A 2HZ7A 2ZPTX 4UKDA 1YVPA 2WF5A 5FPSA 3WGHA 4ZTUB 3U56A 1E2PA 3LF1A 4H0FA 4EFNA 3G2HA 4ZO6A 1RQPA 3TQFA 5KYNA 5JRJA 2XCLA 1OU0A 2AQ8A 4X5OA 4S1NA 2WIFA 1T6BY 4IYRA 1D3AA 1E63A 5IVDA 3IKTA 4EATA 1ADFA 1D2HA 5CFMA 2WWVD 1V96A 3TKYA 2Z8XA 4XYGA 3KEFA 4RVHA 4WFKA 5K4GA 1NV8A 1KDYA 2HOQA 3HKBA 1B14A 2ZRBA 3HZHA 2ZZKA 1U4OA 1C3LA 2JVKA 3P5SA 3PUWA 1NBEA 4XD2A 4X61A 3IB3A 4EX7A 5KHAA 1QBKC 2LE0A 5DHRA 4JROA 4DVGA 2AOWA 5JO9A 4YI3A 3STXA 3JXEA 3R7LA 5GJVC 2WSYB 1QH1A 4DL9A 3VHQA 4KX3A 1QFJA 3BL8A 4NFYA 2I0FA 4U2FA 4J6EA 3KPVA 1KBQA 1N6KA 1W0JA 2JFXA 1QHFA 2P9CA 2IDMA 2NZVG 3BHNA 3PVCA 3UCEA 4BL5A 2PX4A 3LX4A 2FXIA 1R5JA 3JR3A 3DYVA 1GARA 3IP1A 3S68A 2QE7D 2IGBA 3OBBA 3A6DA 3ASVA 4EHKA 1KWKA 3C15C 1DEKA 5D8DA 1KZGB 3HADA 3ANYB 2JCGA 3VZQA 1EMDA 2NZYA 4G84A 3UV7A 9LDBA 5HQTA 2H1WA 3MJEA 3FDFA 1ZGBA 3EGCA 5KYKA 1QH9A 5WRFA 1YIOA 4I81A 1UC9A 1DAEA 1OYVA 2Q5FA 2ZYWX 3FOWA 3B12A 4MI3A 1KDVA 3VJKA 3H3FA 1LBHA 1GTG1 5LA6A 3O38A 5ULLA 1O0CA 2PUFA 2PYDA 2JA2A 1T9KA 1EGVB 5ALYA 3G0OA 3QVLA 4RBNA 3LW8A 1P1CA 3SSNA 4IIHA 2JFZA 4CHTA 3D3QA 2Q29A 3NAQA 4H4DA 1X70A 4ZI3A 1LZKA 2F90A 3AHEA 2J0UA 4UUAA 4AZ0A 4ZCTA 3E61A 2JGKA 3NBUA 4XCQA 4AO8A 3B53X 4P2BA 5AWFC 4DF3A 1XTZA 5A3SA 4PQYA 4FR0A 2ORWA 1VG1A 5ALMA 4DUYB 2W2OA 3B78A 4P38A 1RTTA 5F64A 4UM9D 3TLCA 1U2GA 2H4HA 2LZ0A 2PVSA 5JSQA 3NWJA 4A2CA 2C98A 4WNYA 4G1MB 2JGNA 1XTKA 1EGHA 3U7EB 2GK7A 3QVWA 4IV5A 2C9OA 4AB1A 1FW8A 1FXWF 3TTUA 1XWWA 4MUHA 5BNFA 3R3WA 1IZYA 3ROTA 5JMTA 1BWQA 2G83A 3N2ZB 5FWNA 2I66A 2FSFA 1SR8A 5CD1A 1MW9X 1F4LA 3AFNA 1JV2B 4G97A 1J21A 3WKCA 1HDEA 2C2ZA 2RHLA 3KFLA 1ZNZA 1R50A 1U2GC 4FWIB 5E6UB 2XT9A 1ULAA 2YS6A 2E4VA 3FHCB 4RZSA 5EA2A 3ZY2A 1QGZA 5FL3A 2IXBA 1V5WA 4FONA 3H19A 3UXMA 1DAFA 3DDUA 2QAGA 1NC1A 3ESDA 4D7AA 1BG6A 3D7NA 1KQGA 4LF8B 3PYXA 3EIHA 4II2A 3EZ7A 1RQ7A 4R0MA 5B2FA 4YRJA 3T9BA 5LQAA 2X23A 3NU1A 1NJ1A 3DEAA 4OXXA 1K68A 4DA8A 1U1GA 5TPWA 3LBNA 4BWVA 3RH0A 3BXEA 1XB2A 4XJVA 2QD2A 3T1OA 3FTQA 1ZI6A 4EFDA 3IUEA 3ZYZA 1HTBA 1NI5A 1CLUA 3K8OE 5K0NA 3W4JA 1ZK3A 3GH1A 1QRAA 4DJJA 5BR7A 1TUBB 2OZLB 1UFOA 1NW4A 1WV0A 1G8MA 3UKJA 4C6TB 1P3JA 2DVMA 5BNTA 1PGNA 1ZA2A 2BM1A 3EGEA 2H85A 3UGKA 3WQBA 2JFBA 1Q7GA 2HL6A 3KLPX 2W43A 4OXKA 4UMFA 4CQMA 121PA 1LCIA 1VMAA 3D7LA 5KWVA 2V74B 2JI6A 3WB1A 2I1LA 1CJBA 1X80A 2AKAB 1NPYA 3D1JA 3OWOA 2Q5HA 3PNBA 5ADUS 1LDYA 1VJGA 1AA6A 3AFOA 4C4PA 4ZD6A 4JHLA 1RFGE 3AIIA 2JEYA 2XB9A 2IT1A 4OM8A 1Q1QA 4JB2A 4FMCF 4KJZA 2WR8A 3PHLA 1M83A 3DONA 4KQMA 2FY8A 4LZNA 1RBYA 4R6XA 5FPPA 3PRJA 4GP7A 2O8FA 1QVVA 1U3DA 2AXQA 5KKCA 3E2PA 1MB9A 2Q21A 1B6GA 1IBLB 1FSZA 1R6XA 2C0PA 2QK4A 3AF1A 3I9KA 1VE6A 3N58A 4LRYA 3N7UA 1Y5IA 3EMVA 3F5MA 4YAKA 4YRIA 4NQRA 3ELWA 4W8HA 1FUKA 5CT5A 2X2OA 5TSDA 4DGSA 4UDXX 2HLHA 2G0AA 1C0LA 2CLLB 2ZUWA 4LNUB 1DNPA 3G5AA 1NFRA 5G3YA 2YRWA 1CR0A 1MEOA 3QUQA 5JH7A 4W5QA 421PA 1T0HB 2HI0A 3CF0A 4DDWA 1AKVA 1ZUNB 2CMDA 2J07A 4NI5A 3ZIDA 3D5QA 1C3JA 3ELYA 5JNUA 2FV8A 4UU1A 1TCAA 5K0GA 2J08A 4FKMA 2K87A 4OHVA 4XDYA 1HX7A 1Q0TA 2FSSA 2I6GA 1M1UA 2WIAA 2QTVB 2ZS8A 5T4HA 2XGMA 3P9QA 1TEZA 3KYJB 2RGGA 3ZV4A 1GPLA 1COWD 2V7TA 1SCAA 3EZ9A 5K3OA 3GMDA 2AN1A 2QI9F 3DKPA 1H5NA 2DKNA 3RBXA 3CRMA 4UM7A 1UKYA 1R8JA 2VXOA 2XXBA 3W5JA 1CQIB 4IAOA 4U9HS 1KSJA 5D86A 4F9EA 2A8YA 4W7SA 4ECAA 1PZXA 3A1CA 3AETB 4G0XA 4EO4A 2HTFA 4E4YA 3GUUA 2NSYA 1O4WA 5UKDA 1XTUA 1UBJS 3K0AA 4I1PA 4PZEA 1U1IA 4MS3B 1YE8A 3TZLA 2CK3D 1KAMA 4LBVA 1PR6A 3EXG2 3DPUA 3G9XA 4MRNA 4Q7EA 4E4TA 2IC5A 4OJTA 3JQ8B 1X14A 3EQ2A 1F60A 3A4TA 3OP4A 3ESBA 1VBNA 3T9FA 3VX3A 4DAEA 3MSCA 2QGFA 4U63A 1G5QA 1P1IA 4JP8A 4KWTA 3KJXA 1Z7GA 1CUYA 4OF4A 1B6TA 1D9XA 3D7MA 2CMKA 2PX5A 4H3HB 4CMBA 1N9KA 4X7MA 3VKHA 1K2WA 2XOKA 5G40A 4D41A 5JZ9A 1Y7IA 1C4OA 4FBLA 5KU7A 3IKMB 3G1TA 1IHDA 1VYTA 3DFFA 1AE1A 4QUJA 5AICA 1A1SA 3I32A 2O1XA 2BE7A 1HWYA 3BCHA 4GGMX 1MG0A 1VG8A 3G8DA 3FFAA 1SULA 4GZ6A 4R51A 2IHVA 4TM8A 3Q0EA 5JR3A 4KR7A 1J1IA 4LA4A 5ALLA 1Q21A 2R1ZA 2K5UA 3GJ6A 3EGWA 3NX4A 2VC2B 2L69A 3TJZA 5IMBA 4F93B 1JAXA 3SQMA 1VSBA 1P2DA 3BWXA 1SQFA 4TOIA 3QXGA 3HJFA 2CXQA 4M4SA 1AKMA 2ODWA 2DFPA 5REQB 1JUDA 4GQBA 3SEAA 3BPSA 4TRRA 1QM5A 4NJOA 3G68A 3WL6A 4JLDA 2IXEA 1JMKC 4P7BA 1K27A 3G5MA 3H11B 3DXFA 3K92A 4F5ZA 1P0PA 5F2NA 4G5GA 4EKGA 2EJBA 4X3OA 2J7PD 4QGGA 4U7HA 2ZIGA 5IVIA 1WPRA 5FA6A 3RC2A 2HK6A 2CHQA 3M49A 4ZYTA 2LVBA 2OO5A 5JS8A 1GUYA 4OI4A 3SIWA 1OU4A 4LQDA 4Z9XA 5F78A 3ABIA 2AFRA 2I67A 2YQZA 3IP9A 3UBTA 1U65A 5CNKA 1EFHA 3I1JA 3W1EA 1TF2A 1E9DA 1H9BA 1XOIA 4LCJA 8ADHA 3KSMA 3OIUA 3PD0A 1L7AA 3HV2A 4B3RB 1JR4A 3L7MA 4DV7B 5FLKA 4HOYA 2JAUA 4X3PA 1X7XA 3FH0A 4GT1A 3DW1X 4LK3A 5HGJA 3ZE1B 3E5NA 4N8DA 2JFYA 1M1NA 2H5EA 4FE7A 4HZUA 2OV3A 2FSVC 3H42B 4PSDA 1JAYA 5HMMA 2BM9A 1CUIA 3FIJA 4G5XA 3V1KA 3N76A 1EM8B 4BGVA 1WY7A 3VZRA 3VOBA 4I4CA 1T5BA 4EMUA 1G3UA 2FEAA 3FHTA 3VZSA 2HCRA 3O2SB 3V3TA 2FJ0A 3KQOA 4S05A 1G66A 3RV4A 1U1FA 5DBHX 5K3AA 3S8MA 5CIYA 5CUQA 1JSLA 1DKQA 2OA0A 2CYAA 2HJVA 3MRTA 4GPBA 2VYFA 3AEKA 1CJSA 5J2UA 2HDWA 3L2OB 5A4FS 2O19A 4CL8A 2PSEA 4X1IB 2PK3A 1LY1A 3PIDA 1NMXA 2IYZA 1UC4B 2ZJ7A 3C6BA 5LZ7A 1A9YA 1LF5A 2GZDA 4CZ2A 2GJKA 3EXEB 3HUFA 3M1LA 2E82A 2I2XB 5EZ5A 3ZZ0A 1IYZA 2ET6A 2CF5A 3HH8A 2GRJA 4CODB 1QOQB 2XVMA 5BN1A 1X1SA 4F6LA 5TEVA 4I4TF 5K0FA 3SKYA 4YV0A 3L9XA 2WG0A 3DO6A 3G0HA 3BL5A 1J8FA 1I3OA 2P7IA 2VRWA 3RWBA 1YBVA 1NURA 2HGZA 4TS3A 3ND8A 5JY6A 3OF3A 1XROA 4I08A 2OMEA 4D98A 1HFWA 4BMXA 2W6CX 5E95A 4MV6A 2ARKA 3GUCA 5K51A 3PTZA 1T26A 3ZU5A 2GVZC 3ZXIA 3F98A 5IM5A 1T9GR 3V46A 1NW7A 1YI0A 5HFNA 4W5HA 2W2TA 2J8ZA 3SM9A 2CLDX 3PGKA 1GZ3A 2BHSA 4RK0A 3QY9A 1KVTA 1W4AA 2Y6VA 4YFYA 4W5NA 1TX4B 5DI3B 4FINA 2QYOA 5JATA 2YYAA 4NDZA 3LC7O 3B1YA 4BQSA 3M6FA 3NIGB 1QBGA 3OLYA 3NTOA 3UOWA 2QX7A 4HB2A 5IDXA 2GN6A 3FWKA 4WXHA 4QM6A 5DOVA 2VTEA 4YRMA 4XASA 5ERYA 3SYNA 2HWUA 2V55B 2PM8A 3IXQA 4IO1A 5LKAA 4F0JA 1IN1A 4C2UA 3ZVRA 4TS1A 4YP5A 4WZAB 2HHAA 4FN5A 5KWEA 1TAQA 1DTWB 1RBZA 1A8QA 2AC4A 3R76A 2BTEA 3CUVA 3T5BA 1GPUA 1V5IA 2VAMA 2FPSA 2PMBA 4YLGA 1SD5A 1PJ2A 3TTVA 1KZ1A 2B5WA 1S3FA 2H1RA 2BR4A 1QV6A 5JE8A 2R1TA 2H9IA 1O95D 3K0CA 1QIDA 3GPCA 5TGZA 1Y3IA 4MROA 3TW4A 4BVJA 5TS3A 3GJ4A 5JXGA 2ADMA 3S2YA 1ZSNA 4DB4A 5E6SA 1LRJA 5TMEA 4U3JB 3PC8A 2BHTA 2I34A 2W2LD 4JP5A 3T54A 1RJDA 4J6FA 3QE2A 5KWSA 3BHMA 1E1LA 1HT2E 1AB5A 2IQ5A 4PX5A 1P6XA 1PT8A 4UHJA 3BTUA 5AR1A 2AMLA 4H3KB 3WGZA 3PXDA 1YE3A 2EJCA 1IEQA 2IOYA 5BWBA 5MDHA 3T3NA 4MWCA 1A69A 3WSVA 1W19A 3MRSA 4HT3B 3DH0A 1SQ6A 4DMKA 4ZHQA 3IT1A 1PX2A 4LV8B 4LZAA 4NE7A 5TQ2A 5HS4A 2OBYA 4C7OA 1FZTA 3FROA 2CV2A 1DWOA 1M73E 2GESA 3MWEB 3MTIA 1KZ6A 4FNOA 3IMKA 1P73A 2QMHA 4QBKA 2KI5A 1SCUA 4DHWA 1I5RA 3T0GA 3KSUA 4S24A 5C8YA 3KJZA 1CHNA 5KMGA 4JJ4A 4NBTA 3TR5A 4XGQA 5LM3A 4KO4S 1M10A 1O87A 3QU5A