4P3KA

Structure of ancestral pyrr protein (plumpyrr)
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
178
structure length
178
Chain Sequence
QEKAVVLDEQAIRRALTRIAHEIIERNKGVDNCVLVGIKTRGIYLAKRLAERIEQIEGKPVPVGEIDITLYRDDLTVTSNKEPLVKGTDIPVDITDKKVILVDDVLYTGRTVRAGMDALMDLGRPSQIQLAVLVDRGHRELPIRADYVGKNVPTSKSERIVVQLSEVDGQDRVSIYEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Evolution of oligomeric state through allosteric pathways that mimic ligand binding.
pubmed doi rcsb
source organism Synthetic construct
molecule tags Unknown function
molecule keywords Ancestral PyrR protein (Plum)
total genus 54
structure length 178
sequence length 178
ec nomenclature
pdb deposition date 2014-03-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4p3kA00
1I5EA 2E55A 1GRVA 2EHJA 4M0KA 1A96A 4P80A 1MZVA 1JLSA 1ZN8A 5BSKA 1ECJA 1XTTA 1G9SA 4LZOA 4S2UA 3OHPA 1I0IA 1P17A 4ZFNA 3S5JA 2H07A 3ACDA 4P84A 1DKUA 1D6NA 3O7MA 1NULA 1OREA 4RHTA 1QK5A 1XTVA 5IAOA 3ACCA 1FSGA 1U9YA 4X45A 2JKYA 5BQPA 2PRYA 4RHYA 1L1RA 1PZMA 1A97A 5HIAA 4FYMA 3LRTA 4RADA 3HVUA 2HCRA 1O57A 1QK4A 1DQNA 4QYIB 3DAHA 1ECFA 1UFRA 4M0PA 2PS1A 1ECBA 4P83A 1I0LA 3NAGA 4X44A 1LH0A 1GPH1 1TC2A 5ESWA 4RHUA 4P82A 5KAMA 2PRZA 1ZN7A 1L1QA 1P4AA 1TC1A 4RACA 4RQBA 1DQPA 2C4KA 1CJBA 4P81A 1G9TA 4P86A 5JV5A 2H08A 2WNSA 4JLSA 5BRNA 3GGCA 4RV4A 1U9ZA 4LZNA 1BZYA 1OROA 1QB8A 4QYIA 1G2PA 1XZNA 1JLRA 4RAQA 4RANA 1QCDA 1OPRA 1DKRA 1HGXA 2AEEA 3G6WA 3H83A 1O5OA 3ACBA 4P3KA 4WN3A 1QCCA 1WD5A 4PFQA 1I13A 4M0UA 1UPFA 3DEZA 5K51A 1R3UA 1STOA 5JSQA 3DMPA 4KN6A 5EUCA 3QW4B 3MJDA 1BD3A 1Z7GA 2H06A 3MBIA 2JI4A 5BQOA 3OZGA 4RQAA 1VCHA 1ECCA 2GEBA 1W30A 1A4XA 4WMLA 1VSTA 4LYGA 2XBUA 4LZAA 3KB8A 4LYYA 4MB6A 5IPFA 2DY0A 4RHXA 4TWBA 1ZN9A 4PAWA 1J7JA 4RAOA 1XZ8A 4Z1OA 4QRIA 2JBHA 3GEPA 1P19A 1BD4A 1Y0BA 2IGBA 3EFHA 2VFAA 2YZKA 5KAPA 1QK3A 4IJQA 1V9SA 4JITA 5ESXA 1P18A 3M3HA 1AO0A 3N2LA 4OHCA 2P1ZA 4F8EA 5E38A 1A3CA 1QB7A 1IBSA 1HMPA 1NONA 2JKZA 4RABA 1A95A 1DBRA 2FXVA 1XTUA 1A98A 1UPUA 1I14A 3GGJA 5HKLA 1G2QA 1YFZA 1VDMA 3OZFA 1ECGA 3LPNA
chains in the Genus database with same CATH superfamily
2UVQA 1PR1A 3G8YA 1EP9A 4YVFA 2OWEA 4BPBA 1KP2A 3C8DA 4LYAA 4P38A 3SY8A 1LRLA 3HCEA 2NYVA 1T24A 2C97A 2QF7A 2OCIA 1EVIA 4JP3A 2AEFA 4ZOCA 1II8B 4GI5A 4LY6A 5E2BA 4H3HB 1KHHA 4IDPA 5GWXA 3U9TA 3WAKA 2AV6A 2M6SA 4BX9A 4D02A 2I1QA 2CXXA 1Q57A 2J9RA 2OFPA 2PUJA 2B8NA 4RPJA 1YVUA 4XARA 4ZOLF 4YV7A 5B5SA 3ACDA 5L3QB 1XCGB 4ARAA 4Q16A 1H65A 3A1TA 1N75A 2J6BA 4AWBA 2WFLA 4TTVA 4UMFA 2FU5C 3V7FA 4D81A 2WC1A 4DNPA 4Z51A 1LSSA 10MHA 3R9XA 3SNKA 1ULHA 3ACCA 4G8DA 4MWOA 4HGYA 3W7VA 2BE7A 3EZLA 1L1RA 3HXQA 5DMHA 3MMXA 5EAIA 5CDFA 5DCWA 1NBMD 5BOVA 3VNSA 1CNEA 5ARDA 3V6LA 5HIAA 4O5AA 1NVVQ 2PSSA 3IIKA 1SEVA 1Z75A 1H5QA 3PUZA 2X0EA 2R6HA 4EY8A 3I2FA 5BT8A 1FEZA 4OBWA 1FS4A 1GG5A 1QH1A 3CX7A 4GICA 2IX9A 1E9BA 3FTQA 1H9CA 2IUTA 3QMVA 1UXJA 3I1JA 3VR6A 2NXNA 3T3MB 2Q5IA 5T6MA 3QV1A 1XMSA 2E4VA 3IRUA 3O3NB 3QU2A 3CMCO 4UZEA 4MJ7A 4ZCSA 2IWRA 5E1BA 2O05A 1OXMA 1XDZA 1IN7A 4HFRA 4UZSA 2O3TA 3KAJA 4L16A 2Z3WA 1VL8A 1T6XA 1OC4A 4HLCA 3A4TA 3QLVA 4I1RA 4RV5A 2PMBA 3U3RA 3JWJA 5JE8A 1Y8RA 3G68A 3B53X 3JALB 4KIUA 1IULA 3TZKA 4RVDA 1HT1E 1P73A 1JQEA 1Y1PA 2AX3A 1KEEB 2WV7A 1OZFA 1Q6YA 3QG5A 2O2HA 1FSFA 2JGDB 4TZ0A 3EA4A 2C9CA 1DC3A 1Y4AE 1O94C 2WOOA 3A26A 2YJNA 4CM8B 5C81A 3F6RA 5F1PA 3LHDA 1YB4A 3EPJA 1A7AA 3Q12A 1DAGA 3ICPA 4HEA1 1J8QA 1T91A 2OZVA 1GFZA 2ZG6A 2DB3A 4AKIA 2HMUA 2NIPA 1V8OA 1E3JA 1XD2A 2BHRA 3IEIA 4LXQA 2FE1A 3D4LA 1U2EA 5ERXA 2LCQA 4URHA 3EEOA 3A6EA 1V5WA 4JT2A 3SYLA 5AW5A 5FJIA 3VPHA 3F0TA 3KVNA 3KOXA 4D8YA 2VQFB 5J5VA 1HKUA 3KT3A 3OE7D 2REQB 2GERA 3GFTA 2ATXA 2R00A 1ULTA 4DQUA 2B30A 5BW8A 1TQ4A 3UAOA 4YTEA 3CNNA 4L95C 1R2QA 4Z86A 5EGSA 2YCLA 2QTRA 1N1GA 4B3TB 2C9ZA 1E32A 1HKHA 1LBIA 3IA2A 5CDHA 4IJQA 3G17A 5EHQA 5AVJA 5JVDF 5KYXB 1EVQA 2B2XA 1JKFA 3G3EA 4MA0A 3I45A 3T61A 2VK2A 3WBJA 3G7SA 2Q4TA 3AP1A 2CNWA 3QUSA 4KLZA 3A1VA 1X39A 3MHPA 3P0JA 1H2BA 4B87A 4UOEA 5DV9A 2Q0HA 2NYAA 2YTZA 3N76A 2PUEA 2OXFA 3JZFA 4L74A 5FOQA 2IUSA 1QRDA 3NDPA 2YXDA 2VBGA 1T0JB 3PXEA 3UK2A 3KAKA 4FXPA 4JN6B 1MX3A 3LXMA 4N5DA 1F1JA 1KFEB 2IYOA 2WZQA 3CLSD 1DV2A 4JJGA 5EJAA 4EO7A 4LRUA 1Z12A 2AF4C 3MT0A 4PR3A 2B4QA 1Q0ZA 5TPWA 5IH7A 2VZEA 3IOEA 4RK0A 5C53B 4C4TA 4GZLA 4ZZ0A 3NIDB 4XGIA 3TIVA 5JFOA 4LJKA 3U0VA 4C88A 2GNPA 1UBGA 4R2LA 1UZAA 4KVZA 4M55A 5FO1A 3NW9A 5DLDA 4Z0PA 4QFCA 1MB0A 2C29D 1JLLA 5BRJA 3T7KA 4HGOA 2JGMA 1E1NA 4K28A 2PWZA 4NYMQ 1OCEA 5JS7A 3JQQA 2PM8A 3UTDA 4E5SA 1SD1A 1NV8A 3C8HA 4J6FA 2ZT7A 4XLTA 4DMHA 1JDBC 3NHFA 5ALJA 3R3JA 1ESDA 3RVQA 1DKOA 2GTPA 2Y1LA 1Z6PA 4W82A 3B6JA 3T34A 5L51A 2CMFA 5T64A 3ZWDA 2G1UA 5IVHA 3C1TA 3F4BA 4X93A 4JYPA 5K0FA 4CEIA 1UK8A 3IO5A 4KDFA 1SHUX 4WK0B 3EIEA 3PEEA 2HJSA 3TLXA 4BNLA 5E2IA 4ENSA 1NSFA 2Y2UA 3RUEA 4DSNA 1LDNA 2GNOA 5EZSA 1KJZA 1A27A 5ELMA 4W6ZA 1L1QA 5AJHA 5LZ2A 1FSPA 4XZ3A 1Y5IA 2CFIA 3FJOA 3D43A 3VR4H 2WFAA 5I9NA 1KZ1A 3M33A 4BB0A 4WNCA 1DX6A 3N74A 3ROTA 1ZK2A 1PEAA 4JGBA 3VX3A 4H7HA 1U2GC 1X7DA 3FFWA 1BX1A 3AY3A 5ICFA 3RASA 3FDFA 2WHRA 4GX2A 4X8LA 4DEVA 4EWLA 4RTKA 1Z82A 2EVWX 3K1YA 4FGSA 4QFBA 1BS1A 3KUDA 1Q0HA 2ECFA 4G4SO 1U3DA 4M0UA 4Y0VA 2IITA 5DX8A 1ESEA 1O03A 5JZOA 5KWSA 1UBCA 4HQRA 3SZUA 1W4ZA 2I6SA 2WY2D 3P2KA 5E4JA 2DFVA 2NUTA 4BN5A 4HNVA 2A1UB 2C8VA 1GGHA 3U3ZA 2HSDA 4DDTA 2E89A 1SUBA 3LQFA 4A2QA 4BB6A 2R60A 5ALSA 2GN0A 2JLUA 4L72A 2P27A 3RTGA 4DUGD 2A5FA 2HXYA 4WA8A 5ALEA 3PGMA 1KQNA 4BRZA 4B2LA 1QJ4A 3D3NA 2J7PD 2Q7XA 1JB1A 1ZLXA 3IUEA 1NJSA 3SD7A 3WWDA 9ABPA 1JDNA 5IT0A 4D9GA 4QKQA 1D4AA 2XMGA 1KEVA 1XQ1A 4TZTA 4GW3A 1TK3A 3EQ6A 4C7OB 1V71A 2M9MA 3I53A 2G71A 2PV7A 2R47A 2XE4A 3DP9A 4X1OA 4Z9BA 3FKSD 1EUCA 1EK0A 2BRUA 5H59A 1CZOA 3BAZA 2BJHA 1DV1A 3D8NA 4RPCA 3WICA 2BHNA 1QK3A 3V7UA 1N6OA 2VF4X 1PL6A 3NORA 3EJ6A 5FOTA 2VHQA 2WAMA 3D2BA 3ORRA 4JNKA 2D1SA 2ZE6A 4N5IX 4TTSA 1WZ2A 1XEXB 3ZQKA 4DJFC 1X9HA 1R8JA 3ZHOA 1Z2OX 3FNRA 3G88A 2GSWA 2V59A 4LJLA 4KUGA 4WY2A 2YWJA 2C20A 1KJ8A 4EB0A 1P0QA 5JBQA 5HSGA 1I14A 3D2LA 2IU6A 4JJ7A 3WMWA 2YXBA 3LT4A 2R1TA 1E6WA 4X97A 4AJNA 1X8XA 2OBXA 2VDPB 5AKKA 5HQ3B 5KJEA 1FLVA 1QBKC 2E55A 3P9PA 4YONB 4E22A 4GIBA 2ODEA 4J0DA 3ZS9A 1O97D 1G8FA 2C2KA 2OAGA 3SJAA 3GZJA 3FYSA 3KJZA 3RVLA 1T1SA 4D44A 1B0AA 4DN6A 2DERA 4IG9A 1IAVA 1IC6A 1TCUA 2ASVA 3JD2A 4OL0A 5IJAA 1U6KA 3DTNA 1Q1QA 1LDEA 2P5TB 3C87A 5GM1A 2CE2X 4CT4B 1EIWA 3RS4A 3HU3A 4J0FA 1XZHA 4O2BB 1BHO1 1CJVC 1JIXA 3E1GA 2HV9A 2WWHA 3M2TA 1NJ1A 3PVZA 2LCIA 1AKQA 2GK6A 3BB4A 1VHJA 5FRDA 3NVAA 2HH9A 3UMGA 3NJ4A 1N4DA 1JA0A 5JD3A 2QMOA 1SULA 4XYMA 3G2PA 4H7IA 1ZK4A 3CT4A 4LV6A 3FG9A 4IV0A 1YS4A 2XPCA 5EWLB 1D5WA 4XX0B 4EI7A 2CLFB 3LP5A 1FYEA 3U40A 1IRIA 2QJFA 1KAEA 4HAXA 1V5FA 1QO0D 3LFUA 1H2XA 1KBZA 4FC7A 1BKSB 5EEHA 4X8HA 1FFGA 5JNSA 5DTIA 5JS2A 3QKTA 3I9JA 2NUPA 1KF0A 1CR4A 3Q8WA 4TV9A 5CM2Z 1ZN7A 1IU9A 1SUCA 4TT8A 2GFQA 3VRHA 2ZRGA 5FR1A 3VTKA 3UBTA 1MX1A 1CUXA 4N0DA 1OF1A 2DT5A 2FCRA 1Y7PA 3DLIA 1RWBA 2Q4EA 4BNGA 2D06A 2Y1KA 3JRNA 2AKEA 4PAQA 3I52A 3H5RA 2QTWB 3IT1A 3PTZA 5IVDA 1W4AA 3DDHA 3FMPB 5DNCA 1T9KA 3E9RA 2Z58A 5DGDA 3D8TA 3AH8A 4WESA 2HF8A 4HNTA 2JFQA 4L4UA 3BMOB 4B17A 5L3SA 5G0WA 2HWWA 2CLLB 1TJ4A 2JRCA 5KHAA 2VNHA 3AERB 3CA8A 2BMDA 3VAZA 4LW8A 1I0ZA 1WNFA 1VPDA 2MSDB 1KQGA 3P45A 4G2TA 1VPVA 2QRZA 3T7SA 2VQEB 1P6QA 5DWQA 3Q9LA 2IYPA 2BBWA 3L9WA 3PPWA 5FULA 1TZMA 2BKVA 4DLNA 5K6RA 1U2TA 2R8BA 1TQ6A 1E92A 1CUUA 1JE1A 2QRHA 2CL5A 4ZV4A 1CY1A 3HB0A 5J1SB 1YTUA 1QP0A 1EBUA 3FZNA 3P5SA 2D1YA 5HQJA 2PZBA 4IDAA 5CTAA 4Q18A 3FIJA 3RBZA 3DFIA 4ZZ3A 1JAZA 1WWKA 4DV0B 1GL6A 1NY6A 1KOFA 2X7HA 5ALOA 4JROA 3DZGA 3ER9A 4ZA2A 1P5RA 4M1ZA 2H00A 1BA2A 2JEZA 1NJGA 1RKBA 3OT1B 2PGAA 4CU2A 4TUYB 1T2NA 3J7AC 3F74A 2O50A 1USWA 3FNBA 4DJAA 3QLEA 1ZA2A 5HE9A 4L7QA 3O8RA 3OO0A 4W6QA 4ZIRB 5GY7A 4GSKA 1RWNA 7AT1A 1XU4A 2A4KA 4RHFA 3T4EA 1C3VA 1L5NA 1I7DA 4ZYZA 4ZI2A 3H2KA 4ZC8A 4AIIA 4MVJF 3KEOA 2GF2A 2WB2A 3MWJA 3I1FA 1BGWA 4A9AA 1UXIA 5TMDA 1S89A 1C9MA 1Q21A 2PZ8A 2WM3A 4BX0A 4DANA 4F2HA 3T3DA 4TWZA 2Q3HA 3WO0A 4RSRA 1VLHA 2J59A 2O3SA 2XMSA 4FQ7A 2WVGA 3CZAA 3QNUA 1W8IA 1AD2A 4M0LA 4Q7LA 3LUHA 3S70A 1FFAA 1RCUA 4CG1A 4V1CB 4DDMA 1QFYA 1W5BA 2HWYA 1KOLA 1MO4A 1Y6RA 1QOZA 2A92A 4OKNA 1ZN2A 3MTIA 4UPEA 3MJSA 2FPPA 4YJDA 3H2GA 1E66A 2PDAA 1DGQA 5LL6P 4LHEA 4ZT4A 3T7JA 1B8NA 4LQCA 4WCVA 3LYUA 1PGNA 4Q15A 4JKIA 1IBRA 4UEOA 5SYMA 3M5WA 2IZ7A 4J0JA 2H11A 5H16A 1BWSA 3AY6A 4QU5A 1G0NA 3DPIA 3IUJA 3K8YA 3TL3A 2BEKA 1LD3A 2BDEA 4OXXA 3GT3A 3KDAA 5DRYA 2ZSDA 1TA0A 5BSRA 4NPAA 4RS3A 4EM6A 3UK0A 4NX2A 4QFDA 2Y8EA 4J1SA 4B4WA 3RKUA 5IAJA 4YCSA 3IQHX 2C5LA 2W00A 3ICCA 1I6MA 3JYOA 4I1UA 4DDHA 1B43A 5G1NA 4J7CA 4HP8A 3JZDA 3TPCA 3J80A 1FQOA 2I6XA 5K3BA 2ISCA 3OCVA 1DC8A 3BMCB 3FUUA 4MV6A 4BGEA 4FFSA 2MCFA 1I7SB 1TAHA 2WT8A 5H83A 4US1R 1TECE 3M83A 1RI3A 3OJCA 5A7HA 4PXAA 4RM2A 3RB8A 3NAMA 1QBGA 1PVOA 1YZLA 3GVXA 5FPHA 5HUQA 1A2BA 1ISGA 2Y92A 1OBVA 3A3OA 4DEXA 1SQFA 4EB6A 4CODB 1FYDA 2PSHA 3AUSA 3GAZA 1NW6A 5KOYA 2YRWA 4KTTE 3QLVC 1EWRA 4TSRA 4U2EA 5ESRA 4B4UA 4C89A 4JC8A 1D03A 3TSCA 3CGWA 3OOHA 4F1KA 5LR6A 3B5JA 1A8HA 1PT7A 1RYDA 4LYEA 2AOUB 4OHFA 1ZH2A 2IS1A 4HD8A 3ZLBA 1GKYA 1J21A 1WABA 4E08A 4QRIA 4URUR 1KARA 4BFZA 2MTBA 3CN9A 2NOAA 2BCJQ 2QP4A 3PE4A 4KJZA 5JYEA 4LJAA 4RK4A 2GBPA 3HY4A 1XD9A 4BY9E 2CYBA 2I1WA 1XMPA 4ASUD 4MVYA 2DPHA 5JYCA 1CS0B 1ZCAA 2F1KA 3CRRA 4MUFA 4NPCA 5AK5A 2KS6A 4TM7A 3Q41A 1NP6A 4U0JA 4HUQA 1FL9A 3EASA 2BDTA 1F7UA 2ZPTX 4R1PA 3DLBA 1NNLA 5H3LA 2IE8A 3SIPA 4ARCA 4UNRA 2JS7A 5DN9A 1L5LA 4CDRA 3AUYA 2CB9A 3EIQA 4KXNA 2BBTA 3BL5A 1SHJA 4OI4A 4C0WA 4L4XA 4R2JA 2BSAA 2AOUA 3RAGA 1QHGA 1FJGB 3HBLA 4XFDA 2HJGA 4FE3A 3BF7A 4O0LA 4Q19A 2PE5A 4INAA 1ZG3A 4Q9JA 5HJ5A 2HQ1A 1CTQA 1P33A 2PT7A 3PGXA 4LY0A 3TNFA 3ZD8A 3FLBA 1MXFA 3ZE0B 3S5JA 1NW9B 1I36A 1N6LA 4MS4A 5AVQA 5KNBH 4G37A 4J8PA 3MERA 2PJUA 2A3RA 3UWOA 2E4WA 1EDEA 4GDFA 1V7CA 3GEIA 3NBQA 4MQLA 1Z29A 1U3UA 3C6KA 3HCCA 1ODCA 5D3QA 2W6JA 5EJIA 1VJTA 4FB4A 3U4HA 3N2IA 2B7BA 2PMWB 2X40A 1X1CA 2FZ5A 3KK0A 2FPLA 4ZQHA 1HF3A 3B8HA 3OZUA 3R9KA 3LT5A 4F46A 3ZLJA 1K1EA 1QYCA 2PUAA 1ACJA 4P83A 5EP1A 3HHEA 1K6XA 4BC0A 2PS0A 3AEKB 4DA9A 5AVRA 2C59A 2XYQA 2EG9A 1M3SA 1Z6YA 3T41A 3GH1A 5KAMA 3ICVA 4IMPA 3VHXB 4PG8A 4LJ9A 2HFKA 3SBDA 4WNAA 3AFOA 3V4SA 2P9HA 1KSFX 2I34A 4O8ZA 4P81A 5C5EA 2IF0A 4KITB 2NTJA 5B3AA 4MMYB 2IX3A 1HYGA 3SX4A 3EMKA 4H1WA 2PNFA 4YP1A 4I55B 4PFKA 2Y0BA 3TRFA 4IKPA 3W5DA 4GLOA 3RR2A 3TIXB 3IEKA 4H7DA 2OXIA 1R5OA 1KDZA 2ZRDA 3TVYA 4ZZ1A 1IN1A 4Y2HA 2E4ZA 1R88A 2O6LA 5BR4A 3TX2A 2PUVA 1W5SA 2GJ8A 1GCAA 2I29A 4TKVB 4TN1A 3U7QB 5JYDA 1SBCA 3FUWA 4EHHA 4J91A 2FW9A 1GL3A 2O6HA 3RE1A 5K0NA 1OBHA 4KYUA 2QM8A 4FZ5A 1VCHA 4QTYA 2R8YA 1XAIA 5IJZA 5I4KA 2QA5A 1E6EA 1U2GA 3M1IA 3EZYA 4IQ4A 2QMZA 3I4CA 3KB8A 5AHWA 1DCTA 1I5RA 1QRTA 1QZUA 1M0WA 3V46A 2VAMA 1YZQA 4RK6A 1RADA 4YWJA 1PG5A 3NBAA 4F45A 5ECDA 5G0TA 4B4DA 1QHYA 4YA6A 3VU1A 3B9QA 2WUDA 1GDHA 2P67A 2QG4A 3VC7A 4CM1A 2O7VA 2HK6A 3RUPA 1MGOA 3C7TA 4F85A 4C20A 1NBIA 3GLIB 5IP5A 2HLDA 4ZCTA 5DBEX 3CSDA 1ZO8A 2GZRA 4ZANA 5BN5B 3T99A 3IPYA 1SCAA 3I12A 6NULA 4TLBA 2UZAA 1X13A 4Y2GA 1XT6A 3ES9A 1N6PA 3PKZA 4GYJA 2DUMA 5L6LB 2HU8A 5A5FA 1N1MA 4DC0A 2AL7A 1GR1A 3JR7A 1XMJA 5JEEA 2XQFA 5EQFA 3ZWAA 3VR0A 1VBFA 4WINA 3H1GA 1OZHA 2W6MA 4HH0A 1IM5A 2YMMA 2PZAA 1Y42X 2G1AA 2ZXEA 1P0CA 4IIFA 2ANBA 3TQIA 4HI0E 3O3MB 4WPGA 3GZTB 1SZDA 4JDUA 1G6OA 2F3UA 1EFKA 3JATB 4MO9A 5I9BA 1EK5A 5T6BA 5FX2A 2OHOA 1ZD1A 4GZ5A 4RCZA 1VGRA 3R6WA 2A5GA 5BVHA 4V1CI 1KMCA 5AKGA 1KWGA 4J9UE 4TMTA 5FNVA 1XK6A 4XDGA 1MHTA 2V0GA 4BO4A 3CNQS 2JAHA 4KQ6A 4AY3A 5IJ9A 4TTAA 5E8JA 1JIUA 2G82A 4LXHA 1JNYA 1NVXQ 1C8LA 1CDEA 3NAQA 4PNHA 1AQIA 3DCIA 3DONA 1KPIA 4RULA 3VH2A 2DZDA 2HTEA 3ASUA 1K7EB 3DS8A 3GJYA 4P93A 2QTFA 3TRDA 3GZ4A 4DSUA 1P2SA 4ER3A 1TK2A 1W46A 1YUBA 2OCBA 2ZZKA 3DAOA 3IAHA 3NALA 2DXIA 3DD1A 3T9DA 4XUCA 1T9GS 5GJWC 4DB4A 2IEDA 2GUGA 3NEJA 3QBJA 4BMNA 4C3ZA 1LH0A 3FF4A 3QBTA 5MN6A 4JT9A 3WLLA 1C8VB 1ZESA 3KYIB 3ZPXA 2WQ6A 4DLSA 4KOAA 1OFVA 4H18A 3MPUA 1BKYA 3G59A 3W8NA 1WCIA 2X0NA 4OAPA 5IMBA 4UBLA 4DJDC 2PD3A 3FZGA 4BGIA 3MD9A 1NQXA 4F3RA 1ZNZA 1E9FA 4XB1A 4EENA 1XZNA 3QU4A 4NBRA 1WMSA 1UKEA 2RKWA 2R2GA 4BLVA 3X1XA 4KQCA 4NENB 3C1OA 3GP5A 4M9QA 2ZJ8A 2BTOA 3DE1X 4BFVA 4E2WA 3LH5A 4GUDA 3ZWNA 3NBMA 1E1KA 2W2XA 1NW5A 2FZ4A 3F3KA 2QUIA 2OG1A 1TYEB 2W71A 3FMVA 3JARA 3PU6A 2DETA 2JK0A 4ZXPA 2VEDA 4R40A 4OREX 4CEJB 2HPVA 1VZ2A 1IBMB 2Y0EA 4MARA 3VAYA 1ZA1A 3OH8A 1MH9A 5EESA 1ZVQA 3IVCA 4MAFA 5IBPA 2EARA 4LDAA 3S5UA 1J09A 2DR0A 2X6TA 1CD5A 3K31A 4F5YA 5C35A 1Y8QB 1ZEJA 2VTEA 2P8SA 4FYPA 5JFTA 3U44B 1E9DA 3B82A 1K68A 4J4HA 4RZUA 3DEIA 1DBQA 4UBNA 5JARA 1O95A 1XWFA 3RJZA 1AT1A 4HADA 4ZVRA 1FYWA 3CVJA 2QGFA 2ADFA 1S1CA 3A06A 1DADA 1PJ4A 1PUJA 4G1BA 1VA4A 4IIJB 5AW9A 3NHMA 3ZIAA 2R65A 3U4QB 2PBFA 3DEFA 1AZTA 4IUCS 1X1DA 4CM4B 3GP8A 4MKGA 1HFKA 1JQKA 1N5DA 1MGPA 2WKSA 2XSZD 4PCLA 4ZQCB 2X15A 3SJZA 1VKZA 5C37A 2O06A 4PVDA 5DGIA 4JX8A 1H2FA 1XWWA 4KL8S 3W34A 2QTGA 5G4LA 3GBVA 2ZRMA 5JC8A 5EMJA 1I5EA 1ZRSA 1GRVA 1H2AS 1J2EA 2FR1A 1F2TA 1M1YB 2WAXA 1Y5LA 3AR3A 3MJRA 4QQ8A 5A4IS 2BSXA 2JIMA 1SK9A 3R5JA 2X0DA 3V8BA 1DNPA 2H51A 2QR5A 5DYWA 4R9NA 5A2GA 2WG1A 4DQLA 2HA0A 3OZBA 4JSTA 4EG1A 5L40A 1QQ7A 2CFRA 3A4YA 2XI4A 3FWZA 4UPVA 5LZ5A 4BL5A 3SG0A 1TVKA 3VUFA 2BH9A 1DLIA 2Q0XA 3FCYA 3KQYA 2EWVA 4QQFA 3ZQ6A 1MFZA 1LPBB 1PT8A 5E7JA 3HJTA 3RC7A 1QTIA 1FW8A 4DY6A 5ES4B 1QPBA 2WTXA 1Y1SA 2FLVA 3C16C 4N3NA 2NUTB 5SY4A 3GGPA 3O8BA 3U3XA 1QGOA 1AKRA 4IDOA 5I9IA 5LXTB 1AQNA 2NNWB 3WGIA 4RVCA 2O0MA 5BPHA 1RIFA 2IHYA 4DCUA 1DARA 2VTVA 4I2VA 2A86A 3BWYA 5E6UB 4YAFA 1WZCA 3RVDA 1WPGA 3ZWYA 1BN7A 4UAGA 1ZVMA 4X71A 3VC1A 3WBKA 3WGUA 5A02A 1GAWA 2B4TO 5B6IA 5I3CA 1E1CB 1PV4A 1L3IA 1S4MA 1G7SA 1K88A 4E2XA 1VZ3A 2FFAA 2YRXA 3CZQA 2NXCA 5F7ZA 3S81A 4MVJI 1OU4A 5MGNA 2BF7A 4MUAA 4N01A 1EIZA 2IY8A 4AMVA 1KZ6A 1TCVA 3UJAA 3QVGB 1PHPA 3RG2A 2VRCD 2QX8A 4TYNA 4ZVNA 1Q1EA 1MO6A 5BR7A 2DHQA 1JPUA 4UAVA 4Z4EA 3U7RA 1K5DA 3DR5A 3Q6MA 1NW3A 3X2SA 2EJTA 1JLRA 7GPBA 5I47A 2ZS8A 5C8YA 4KHZA 4QUKA 1MOQA 1DKLA 1ZKDA 2ZRLA 4V02A 3EPLA 1KHTA 4LGCA 4MKFA 4G56A 4IIJA 2VP4A 3IHTA 4CXMA 3HNPA 2IUFA 1O95D 3JYQA 2X9GA 2X3UA 4IOJA 2GYUA 3ROKA 1JG3A 4B79A 4FHCA 2W98A 3OU2A 3R0VA 2FWAA 4G24A 4NZZA 1ZGCA 4UREA 4DZRA 4ARSA 1BOFA 1BMFD 1USUA 1GG2A 1GGVA 1GT6A 1I4TD 4IIUA 4X3OA 1M6EX 5ALKA 1I3CA 4A2WA 2C07A 4EKGA 1AHNA 4PLZA 4AJPA 1OV6A 2PLRA 3W8DA 2BTEA 1PFKA 3HWX1 1I51A 3QLTA 3GXOA 2C1ZA 2FV8A 3VUEA 3R24A 4QVGA 4UTNA 5HKKD 1DOZA 1KKMA 1P2TA 2Y76A 1ZIPA 3PR3A 4I4NA 2X42A 4KKXB 1AKTA 1EX9A 3HMKA 3OD5A 2WYUA 3IDQA 3ZWKA 4B3GA 3KUXA 1H22A 4QA9A 2IK8A 4ZKDA 1JDZA 2P2YA 3M6FA 1I01A 4JITA 1Q0UA 2QNRA 5KKNB 4PGFA 3V1LA 4A03A 4OATA 4R8RA 5FUYA 2B1IA 1Q1ZA 5M5BA 1E6MA 4M83A 4P0QB 1V11B 3WMGA 1HMPA 2DQKA 5KJ1A 5JISA 2YZNA 1XXHE 1AE1A 3HCWA 1E6LA 2G5CA 3CLTC 4N6OA 4JBWA 4TWRA 2PQ6A 2IYUA 4Y9DA 1QZZA 4GOXA 4DCVA 5DNYB 1FFYA 3BC1A 2IT1A 4R5MA 1SBHA 3SXUA 4Q0MA 3N8IA 3K71B 4Z4HA 1YS1X 4HB0A 1YBAA 5IT9A 2OEPA 3OEWA 4EUKA 4K1LA 1O5TA 1Y9ZA 4AD8A 5HX7A 4P8RA 5A3JA 4EG6A 4D3DA 4H4DA 2FN7A 1GFSA 1NDQA 3KYJB 1FXUA 2B35A 5E95A 3IDOA 4E09A 4DR4B 2ZKIA 4JI2B 3B7PA 1S9DA 3ASYA 3P97A 2B94A 1T1GA 3EUEA 4DLYA 4BNXA 2X2FA 2YIJA 4ZAGA 5LN1A 1ML3A 5IS2A 1Q1NA 1WQ1R 2X8JB 4LBZA 4GOND 4RSHA 4YQZA 1J1IA 2NPFA 4M88A 3SK0A 4E7PA 2O8BA 5AI5A 1DZ3A 3ZQ4A 1NBAA 4HDMB 3AZQA 3KSUA 4DARA 1U4OA 2N3ZA 3GJ7A 2HY7A 1XJ0A 4WOKA 3K2QA 3UOWA 4CMJA 1VBMA 3HN7A 3Q87B 5E6SB 2JNWA 4F97A 2VKQA 4IIGA 5LYYA 5LUAA 2B5OA 3MK31 4IFBA 1NTRA 1SUWA 1Q7GA 4XWKA 1E60A 5BN3B 5EKUA 4XYLA 5DX0A 1TYDE 1AQJA 2JD2A 3O74A 4KFRA 4KQFA 4U2FA 4DSAA 4XSHA 4NDNE 4D74A 4XWWA 2JHAA 4DKJA 2IDJA 1BCRB 1YZHA 3GD7A 2RBGA 1DUIA 4EJ6A 5ELXA 5BRNA 1I2CA 1YHZA 1CU1A 2GMWA 2O3RA 3AR2A 3FKSA 3X2FA 1KXZA 3FVQA 1FNMA 4UQOA 3E3MA 3HSSA 2P41A 4EG8A 4NIMA 3EF3A 3NGMA 4BO1A 1NXTA 1YQQA 1UKAA 2V65A 1ZGHA 4GMFA 3UAWA 2Q45A 2FQYA 3MJVA 3B6MA 3E1KA 3KV3O 1W52X 1XEAA 1YE5A 2GD1O 2XMZA 2Y68A 1M66A 2Q0QA 3M6VA 3RS5A 5CCEA 1P9WA 1UBEA 4ID9A 1OH7A 2H1VA 2WIGA 3I9V1 4OQDA 3WKDA 1ATIA 2ZAMA 4PC7A 2XCRB 3A37A 3IUSA 2YKGA 4IUBS 2ZE7A 4QUHA 3W4KA 3G2OA 4IW3B 1UQRA 2JI4A 3K9FC 1JKJB 3CSSA 5FNVF 4YCMA 2V6FA 2X4IA 4WMLA 1I3KA 1X9IA 2OAQ1 3QFHA 2WYWA 3IOMA 4GGPA 1P7PA 2B92A 1ZUD1 3GRVA 4ND7A 4XQ0A 2A1IA 2RGXA 1M0SA 1H4SA 3U09A 4MVJM 5EZYF 3C7CB 5B2ZA 3TECE 3P4XA 1M2JA 4L27A 1ML4A 4PGHA 1R5BA 1RPNA 1UKCA 4BO9A 5K0EA 1ZAKA 3LGXA 3SN6A 6GPBA 5HKKA 2G9VA 4PTZA 3ZDEA 3WIEA 4OP1A 2HQRA 1PUIA 1VLLA 1YD7A 3L6EA 1O95C 3PT9A 4B3DA 4C0KA 1SG9A 3RRJA 4CM6A 1AO0A 2OD7A 2P1ZA 4URFA 2CZQA 4JAVC 3F9CA 2O8CB 4JOCA 2H3HA 3OZTA 3H0CA 3LSYA 1HLGA 4CIDA 4LXXA 3MWGA 2YYSA 3RJ5A 2P6UA 3W05A 3PNPA 2ZM5A 1YGYA 3D1JA 2XDWA 3TOXA 1NVFA 5CDUA 2C0PA 2G5TA 4RENA 4KXYA 2VH5R 2I0FA 3AHIA 2SNIE 4OQEA 5B2FA 5K7SA 2P30A 5A71A 1RM4A 2Q07A 3EDOA 2VRWA 1C41A 3NYQA 3MUFA 9LDTA 3NKLA 3W5BA 4QGGA 4OKSA 3OJEA 3RBXA 4BZQA 1ATZA 2ERXA 1G8HA 1ZQ9A 3UWMA 3AHHA 3CUWA 5KWEA 2HMAA 3L6RA 4TLCA 4FMBB 2ZWMA 4JUBA 1JJAA 1IVYA 5IFLA 1DP4A 3VSDA 3OPVA 4LY3A 3WXMA 3ZC3A 3O84A 3L46A 4A8PA 4C30A 4KN8A 5AXAA 3EDRA 3ZYCA 1JJ7A 2BM8A 1CDDA 1KYWA 1JAXA 1RQ2A 5T5QA 3SYNA 2ZYTX 3M9LA 4WAUA 5GMOA 4ZKEA 3ZXXA 1OREA 4BEJA 1ZZGA 3QOXA 5ANRB 3SPXA 2Z6AA 2CY0A 3CLTD 4P2GA 1JEYA 3M9XA 2QL9A 3I8XA 2XJ9A 5JD4A 4CUJA 1HK7A 1PYDA 2CB0A 4UTRA 4URXR 1TFUA 2DY1A 1RAHA 4LOKA 4OMCA 4Y2PA 1BRMA 1U63A 1R12A 2EFYA 2JLXA 1XTRA 3WJAA 1JSZA 4JBLA 1FFBA 3KOYA 2OFOA 4QDJA 5DWVA 2OXEA 1XMIA 2R6R1 3L6BA 4TVOA 4YJ3F 1EA5A 1XEXA 3WFIA 1W47A 1ZK1A 2XXJA 4C9BA 3PHIA 2AW3A 1YKSA 1TMOA 5C8VA 3R44A 3ZWMA 3OIUA 4I8XA 3TLAA 4HOYA 1S96A 1XNHA 3IX7A 3NBXX 1YC2A 2IPXA 3EEIA 1WF3A 2NU7B 3MM4A 4JWTA 3TFOA 1JILA 1U3VA 3R2JA 1V39A 4YX9A 1Z73A 1DIRA 5KYUB 3PUWA 5BOSA 1ADCA 2B4AA 1ZYUA 4QPNA 4F4JA 2GHTA 2I2WA 3L8ZA 2XB2A 5HCUA 1Z4OA 2H9AA 4C4ZA 2RD2A 1IJEA 3FPBA 4ZD6A 2C0QA 4UNPA 1CUBA 5K3AA 2PGJA 2VNKA 1JKJA 1Q74A 4X7RA 5K51A 5FAKA 3B6EA 2WJAA 3H0KA 4HPXB 3DMPA 5LU9A 3QF7A 4OF4A 2XSZA 2K2QB 2IOQA 1F2DA 3K5WA 3PT5A 4KXMA 3DCJA 1NZFA 3L8CA 3QVKA 3R3WA 4H1HA 3UJHA 1R16A 2QNIA 2QAGA 3KKEA 2DFPA 4Z9AA 2Y77A 2QD3A 3QELB 3ZGZA 3TXYA 1OWOA 1JQLB 5P8WA 2B8JA 2VUHB 1N92A 4DNXA 3Q8MA 4WUVA 5LOVA 2PG3A 1KZYC 1LTHR 2DLNA 4EY6A 3UHPA 5JWOA 4QAJA 5HJ7A 1XU7A 2OGZA 3BQ9A 1KMHB 1QAOA 1YBHA 3K9BA 3MA0A 4YMSA 1WB5A 3BYZA 3PQ5A 4LG1A 3WY9A 4J49A 4YRQA 5FFFA 1ZJZA 3TMYA 3ZIDA 3AUAA 1K92A 3CZ9A 3I04M 5T57A 4BV9A 1LUAA 1TXGA 3U3DA 1EM6A 3GLUA 4L4SA 4EZBA 2F3SA 4D43A 2H4HA 2HMYB 1GLNA 5EXTA 1HLPA 5BMVB 3UAXA 4AK9A 1F12A 2FK8A 2NNLD 2O2YA 2REBA 4ME6A 4X8MA 5CFZA 4MDYA 1A98A 3DTYA 4LNHA 2UUBB 4HLQB 2QT0A 3GJSA 1NQWA 4MAMA 4UHCA 5EC8A 1BDHA 2OLJA 2DFKB 1PS9A 4R2MA 1ECGA 3I09A 2P9ZA 4NAVA 2EF0A 5ALPA 1GN9A 2VHEA 3ROGA 1P9OA 5F2KA 3DM5A 2MR5A 3E0XA 3T0GA 1Z4KA 3WGZA 2O8BB 2EBFX 1DBIA 1YVRA 2A30A 5JJBA 4GM4A 1OIXA 4YK7A 1Z0IA 4LC1A 3DOJA 2YC4C 1EFTA 1P2UA 1DXQA 1U9JA 1WF6A 2Q49A 3G5TA 4FI3F 4PZPA 2V7TA 1XC7A 4IJUA 3RUFA 4K9LA 3KR1A 4XIYA 2G76A 2OUIA 4X65B 2BGMA 4L6AA 3FDJA 3QK7A 4Q37A 4QICA 5JBIA 4ENTA 1QYXA 5CTJA 4NOKA 3JAKA 5EWMA 4GPZA 2A9FA 3UCFA 1VKNA 1WZNA 2FI1A 1C50A 1L8LA 1ZU5A 3FTDA 4MRSA 5AYVA 4AB1A 1PN3A 1Z47A 1K08A 4AULA 4EBFA 4F8JA 1DIOB 3IRVA 3N0RA 3ZVKA 4M7RA 1GSAA 3IPRA 5F3RA 4G0PA 2FPMA 4BQPA 5TB5A 2D4AA 3CUSA 1OJLA 1Z8DA 2N75A 2JGLA 3A28A 5LB4A 3R09A 1B3RA 1OQAA 4KAAA 2NQ8A 3KP1A 4HDQB 2GM4A 1DBWA 1Z0KA 3K0CA 1B41A 3GFFA 3N0VA 4DJ5X 4XW2A 4EA6A 1SUAA 5E7IA 1TF5A 1GQRA 3NTQA 3E0QA 2XQIA 2R7AA 2W11A 5GJCA 4MRMA 3PTAA 3D0KA 4NZNA 4HWSA 4HXGA 5ER6A 3KKLA 1O54A 3LZ6A 4KE7A 2X5XA 2FSUA 2QHXA 3TLZA 4CMGA 5E1MA 3C3DA 1SU8A 2P1RA 4UASA 1EVJA 1G8PA 3L6OO 4LGVA 5HGJA 3SC2B 3SF8B 1IEWA 3R6DA 3WQHA 5A9SA 5MFPA 5JH7B 3ZK7A 3C0KA 2QN2A 3FNIA 2AEEA 3LBHA 2W9XA 4DRZA 1M1ZA 4NCHA 2H7YA 2DFDA 1QRAA 2O2GA 2PXHA 2ZKLA 3F3MA 4KGXA 2GLUA 1ZJ5A 1NVMB 2CCJA 2NU9A 2Q3MA 3LK6A 4L51A 4M1TA 1DG9A 3RPEA 3FBTA 4IDFA 3VZDA 5C1BA 3S0JA 3HFSA 3PNQA 3HJFA 4XEUA 1XD2B 2AW5A 1NMYA 2ODTX 3MT9A 3OECA 4IEEA 2JCVA 4KRYA 3LC0A 3QWIA 2ZIVB 1RJ9A 4WCFC 1D7AA 1TCBA 3EFOA 2VTDA 3AETB 3KB6A 4PG4A 1UM8A 3S28A 4G25A 3I23A 1TLLA 1VRWA 4RJTA 1V8FA 2OD9A 4QPZA 1F5SA 1WEHA 1Z7WA 2ZBEA 3R0XA 2ZRPA 4OSEA 1CZUA 2QTLA 1IXZA 1N2CB 1ZUHA 1DT5A 2Y67A 3U1TA 4Q47A 4Z3DA 4OJKA 1E2DA 2XGJA 3EXAA 4MLPA 1GU1A 4FWBA 1ODSA 1Q50A 3EEFA 1L5VA 5CYOA 4RA6B 4UTVA 2JFWA 1W6UA 3TUZC 3EGXA 4LJ5A 1EE2A 1F4VA 1NNI1 2AGVA 3E81A 1PGJA 3TZQA 1WPRA 3INGA 3NPAA 1M7BA 4EX7A 3BH7A 2P0AA 1P6XA 1QYRA 3DWGA 3PC3A 5ARCA 5CURA 1V16A 3EUAA 1EAMA 3NUZA 4EH1A 1GR0A 3QFCA 3S2GA 3IIJA 4F38A 1NIPA 3ZXUB 4FCWA 4TV9F 3P9QA 1KDPA 1C1XB 1IOZA 2QLBA 1T29A 4Q4LA 3V7NA 2FEOA 3ZZNA 2HDWA 1BYIA 4ZOLB 1OXTA 4KFUA 2X5NA 4X84A 2PSEA 3KQNA 1XYVA 1NYRA 2D4HA 1XTUA 3B52X 3FFTA 2NU7A 4JHXA 4C4PA 3T5PA 4ZI7F 2ZSFA 5DE3A 2QMUA 5AD1A 1QLWA 5FWYA 4C7MA 4NNOA 3PEWA 4E4TA 1I1QB 2DYKA 3ND9A 3HC7A 2OORA 1SGWA 3G8BA 1A5TA 3FY4A 2OO7A 3GB9A 3I4FA 4FE7A 4I8DA 3ZV7A 1WY7A 2AXNA 1Y4UA 3KWMA 3W5SA 3HEAA 5D87A 1ZGAA 1ZN8A 1TPYA 4ZHQF 1KEKA 3C41J 1D1QA 2FPOA 2OM2A 2P6MA 1B74A 3QA9A 4DIBA 3G2KA 1E94E 1G6HA 1JX6A 4B7UA 4BQSA 2O8VA 1TVKB 5CG1A 1GTJ1 2GCIA 3MOGA 1U2DA 5BSEA 1EFLA 3G23A 5C5CA 1UBTS 1D6NA 1Q3KA 1MQAA 2Q28A 4JOSA 4AQYB 4CKEB 3A1UA 3L43A 1AUXA 2C54A 1YRQA 3IULA 3QWAA 3RYIA 3GR6A 2ETXA 2OCGA 1N8TA 1EDDA 4GO1A 3L7BA 1W5TA 2F8MA 1UK7A 3KQQA 4JC0A 2VJPA 1AMUA 3JQAA 2FZVA 2HPHA 3IKMB 4UHKA 2WYHA 3KTFA 1AU9A 3P9KA 3UMVA 3SI7A 4G4JA 1KYZA 4ZI3A 1KTVA 1V7ZA 2GZ1A 1U04A 2XMQA 3AVWA 2GGSA 3A27A 4FR2A 3QVWA 3GHHA 5CHEA 4BLWA 4F86A 2X5JO 1BCSA 4A5SA 4EHKA 4CQJA 1GQYA 1PWYE 3AHJA 4I6GA 1JXOA 1T2DA 2CHEA 1WMFA 4KRXA 3O83A 2R2AA 1JKMA 1V3QE 4BTEA 1XZFA 2Q3FA 1PCXA 3PFIA 2F8TA 1C9EA 1H2HA 3AF2A 1YCGA 4BE7B 4DCCA 4JL5A 1NLYA 2IW3A 3AEKA 1PLJA 4LVUA 2QYSA 4RJLA 3SHTA 2EW1A 3U4DA 4C0AC 5EWJB 3PD0A 1P1FA 3H3JA 5F7XA 3QU5A 2XMRA 1F3LA 1IE3A 4JEMA 3T1VA 1FTGA 2O8FB 1XEWX 1Z18A 5JPIA 1S3GA 2Z5LA 1G7TA 3N1UA 2VZ9A 2FHPA 4MV8A 2ON6A 4ETMA 1QKJA 2DBQA 4MCAA 2IUUA 5ICEA 3U37A 3VR5D 1VL2A 2PL5A 5JI3E 1EUCB 3BAFA 3QMPA 4ZZ2A 4EW2A 1WLSA 4XIIA 4XTRA 4ZVOA 3JRXA 4MKRA 4JEUA 4CJXA 1JSLA 3X3HA 5HCNA 1AURA 5ALMA 2LDBA 1YS7A 4B3FX 2CDAA 3WVNA 1SA0A 2XWSA 3OQ6A 2JA1A 2DX7A 2GBIA 2AR0A 3E70C 4P36A 4DDKA 4Z5XA 3LY7A 2AJDA 2DHDA 4QOHA 1B6RA 4ZCQA 3WKEA 3ANYB 4KIWA 4PAWA 2EDAA 1VBNA 4AP5A 1WRBA 1UKVY 4O0MA 2EJVA 4H15A 1JHXA 1L7BA 1GGKA 2R1VB 4UFNA 4YWHA 4XLLA 3WWCA 2FZEA 2JLWA 3NBKA 3S7ZA 3U7EB 4EJFA 3B2NA 3GEMA 5FL7D 2P4EA 5DNAA 1QHSA 1COWD 3PXXA 3ANLA 2LP4Y 1I7LA 4D98A 2F7SA 2RB5A 1NZDA 1PQYA 1UJBA 2PX5A 2X8LA 1J2UA 2YWEA 3VR4D 3GQBA 4ATNA 3CWZA 4OHVA 1L5ZA 4C6RA 2P0YA 2P9GA 1PJQA 2PS9A 4OQYA 4DXAA 1N7GA 1AOXA 3F71A 2OP0A 4UATA 3BIOA 4QOFA 1WB4A 2QXTA 1T0IA 2HTFA 4DLTA 2DLDA 2OUKA 4FD3A 1DKMA 2Q6KA 2ZR8A 4MWEA 3BG5A 1EHCA 3L7CA 1FVHA 4ABTA 5FBVB 1HDOA 1NE2A 3RHSA 3HGTA 3SEQA 3N7TA 3TQHA 1SKMA 1PT6A 3LI2A 3VNVA 4IRXA 2Z4RA 1ECLA 5FTKA 1VHLA 1I3OA 4RVGA 2QY9A 1J22A 4OGFA 1PL8A 4C2BA 4QZVA 4UMVA 2LCFA 1AS0A 3WMFA 1IJFA 1RHUA 1JDBB 4ND1A 1OYVA 2QRLA 3C97A 3H2ZA 1SZJG 3BGDA 4RTPA 1J70A 2H07A 2XECA 1QGZA 5JSYA 3JATA 2UXBB 3PQ4A 3TZEA 3X1YA 1I2BA 1WDMA 4OMUA 3R20A 4FMDF 2OSVA 4JUIA 3KL4A 3SZGA 3V3KA 1DTWB 2HRCA 3K7EA 1W73A 4PLPA 3D81A 4JGIA 3LV8A 3JYNA 3FYUA 5KHLB 4QXAA 1RYNA 1YKGA 1EWVA 1G3QA 4AQDA 1X80A 8ADHA 3CH4B 2ZYVX 2OZLB 4PZUA 4RFSA 2DWPA 5CLHA 3W6NA 1NQ5A 5K2MA 3T9FA 3V7WA 3FSRA 1SHZA 3C4QA 3L07A 1LLUA 3Q5GA 1E79A 2HNKA 1YC5A 3SHOA 2IIBA 3JQ9C 2EZUA 4BZPA 1MUUA 4XGNA 5EVJA 2I71A 3OY2A 4X24A 2P4SA 2XJ4A 2OT3B 1GUBA 1IOVA 2KQUA 1N9ZA 4G5FA 4TLEA 3SLRA 3WWEA 4PICA 5C8ZA 3SDZA 4P3NA 1C9JA 3FH0A 1ZW1A 4HLDA 3TOZA 3I2HA 1KAOA 3TL6A 2QM3A 3IUQA 3KV1A 3BWVA 3ZHQA 4BFYA 4D57A 4ZJPA 5KQRA 1K6EA 5FUMA 2FRXA 2HU5A 4OHWA 2XYPA 3PXGA 2QYHA 3FRJA 5JRJA 4X60A 3EVCA 4Q03A 2DG2A 5F77A 3RARA 1HUQA 3VQTA 4IDDA 4JLMA 5C34B 1TB4A 3MAGA 3VDQA 1GILA 2CDNA 1VIYA 4A0SA 4X95A 2VF7A 4V0SA 2MHCA 2VJMA 4U7JA 5DN6A 5TDHA 1MCZA 3GAAA 3MYYA 3R23A 1VLVA 5JCJA 4P4SB 2Q7DA 2VCHA 1U0TA 4G0MA 5JCPA 1EB8A 3IERA 4JUAA 3WIBA 1CY8A 4WBNF 1ZIYA 1AX9A 1ISHA 1DAHA 3OTOB 4CKBA 1NLUA 3HDTA 1KH1A 1JKIA 4Z0TA 2XXBA 4IXNA 3S1AA 1PNVA 3C14C 3L0IB 1OX4B 2BFFB 3WZMA 3LD9A 2E7ZA 3BHIA 4OMDA 5IRCD 1ODJA 1P2FA 3HDGA 4KMMA 1UQUA 4B3HA 4C5BA 2EBHX 1UC8A 4GYWA 4EPWA 5FBQB 3CONA 1A82A 2WHYA 4RVHA 4A91A 3Q2OA 3N2EA 5T8KC 4HFNA 5U9CA 1P0MA 2DFLA 2Q5QA 2AMJA 3AEZA 3OFVA 3PNKA 4K26A 2VZ0A 4MCJA 4W1QA 2C5AA 1SA0B 1CIPA 1YZYA 2C4VA 2ZRBA 2A94A 3L49A 1G20B 2GYVA 5HM8A 3TR6A 3LMKA 2D0PB 2R8EA 3GIDA 2X0IA 4KFSA 5K1ZA 2VJCA 3TPFA 4EI8A 3DNMA 1XRNA 2HSJA 1JHAA 5JLAA 5LZ9A 4KR6A 1QF7A 1NN5A 1M1NB 3VPCA 1HE1C 2L17A 2JIBA 3ANSA 4JFAA 3VPGA 4URWR 4WKNA 5KU1A 3QKSA 3DZHA 3OESA 5FV4A 4FHGA 2AB0A 1TKAA 2QSUA 3A2LA 3HG7A 3TBFA 4FVTA 5EWMB 4HSGA 5C7YA 4XGQA 4YT2A 4WL0A 1DC7A 4CMAA 4KQKA 5LYJF 1XHLA 3ANNA 4ZMBA 3QKIA 1RM3A 4I19A 5EYPA 4EPXA 5JMOA 5BV7A 3CH7A 3FPLA 4I1OA 3HXMA 3W77A 2BIFA 3JYLA 4XUEA 1UQTA 4G26A 3TM4A 2H4YA 5C7LO 1RI1A 2W43A 3AR8A 1EZ4A 3I2KA 3PE6A 1U9IA 4DS3A 5EIWA 1DJMA 5TXGA 3HDQA 1D2GA 1GNTA 2PS3A 2QN3A 8MHTA 1GU0A 5IEJA 3VC2A 1FXWF 1J8MF 1S5PA 3ZNQA 2JFPA 4YJFB 3DE5X 3E3NA 3LAWA 3OCZA 4KEAA 2NXJA 1PQUA 1ST2A 4N4AA 3SF0A 4XSVA 1M2NA 2FLKA 4NRDA 3V8PA 3RTEA 3W1VA 2YV5A 2YNMD 4IJMA 4AX4A 4RXMA 1OFUX 1Z0UA 4JXJA 3UB2A 1WPXA 4ND8B 1SU4A 1NBEA 2XDAA 1PZFA 2R6AA 2C2WA 4QX6A 5AKJA 1Z25A 1ZM9A 6CHYA 1UM9A 2ZB7A 2WLSA 1TX4B 3ZE8A 4PZCA 3OIGA 3LL7A 3GFPA 1IQRA 3SM3A 1I33A 1PQPA 2HDHA 4YCAA 1W29A 3WDKA 1M2VB 1SKYB 5LOVB 1C3JA 1BVYF 4YRMA 1AM4D 3OJOA 2ASEA 5TV2A 4C03A 5IM4A 3QX3A 4A36A 4UOZA 1G98A 3E8XA 4M2LA 4QASA 4J76A 3MS2A 5KB3A 3KSMA 3K5HA 4HWKA 4UCFA 4LJ7A 2AMLA 1XJ5A 1C3EA 4OBXA 3R8CA 5BV0A 1ONSA 1RVDA 1KFKB 1ABFA 3EOBI 2GFHA 4FNGA 4TXMA 1X7YB 2JCGA 2V98A 4BAZA 2F43B 4YMLA 4MITA 5TEVA 3PITA 3SHWA 3H7IA 4KSBA 4ZDWA 3HDHA 2WWRA 2Z57A 4Q1CA 5KMGB 3A2MA 2YBDA 3LQKA 2XKKA 3OF2A 4JLDA 2KYRA 1WNTA 5BYKA 2XCTB 1CYEA 2OLKA 3A25A 1G5IA 4YN3A 4TYWA 2BLLA 1BD3A 3CW9A 3P9SA 1X7ZB 3C3KA 2CVOA 3MGKA 3WRYC 1NVUQ 4NS1A 1K0UA 2WTUA 2EGHA 4HL6A 4OHRA 1WM1A 2OM6A 3AP2A 3QXCA 4J2HA 4R8SA 4MVJH 5BQFA 5IC4A 2F1JA 1HNZB 1JWLA 3QPUA 5BVGA 2AUMA 1MW8X 5H81A 1UWVA 2W6OA 2ZJAA 3CH6A 4JJ6A 1QU2A 4FYWA 1PUXA 2UZ0A 2WU8A 1MO3A 3NKVA 1AB6A 1SXJB 3GEGA 5I6DA 4YHHB 3GCWA 5BUSA 4E4RA 4BRSA 2BMAA 4PYKA 2G6BA 2HSWA 2ZBRA 3VGJA 2JAUA 3UMBA 5BN4A 3AVXA 2PRKA 4MSUA 4OGWA 2ZI6A 3CUTA 1KZ4A 2Z95A 2VDWA 4RGVA 4PG7A 2XCUA 4L7VA 3RAPR 3UC5A 4LE1A 3PKIA 2IWHA 3DXYA 4OUDA 1B8OA 3REFA 2MYTA 4NECA 3WDLA 5DSXA 3T1NA 1K6JA 4X1IB 1PJLA 3SXPA 5IYZF 1GL9B 2BF4A 2FUNB 4KN5A 4R7TA 4MS1A 3FPFA 1WKVA 4D9BA 2M1ZA 3NAZA 3O1IC 1Z4JA 3LVBA 4NZYA 2W70A 5JTUA 2XXAB 1YZFA 4FGKA 4WERA 3WKCA 2VT6A 3EZNA 2ZM6B 4G0YA 3PEVA 4K9KA 1JXQA 2CC2A 2WTNA 3OTGA 4OYLA 3GYGA 4Y3UA 4ITRC 1I1NA 1TAGA 4Q7EA 3ABRB 4M8SA 4R16A 5D5PA 4C7OA 1GKUB 3NR2A 3SQDA 1NHGA 3T3OA 1BQEA 3HEBA 1UBUS 1RHJA 4MQMA 3UHJA 3DT9A 4Q3KA 3CPSA 2FPIB 3KEGA 3PYMA 4KPUA 2ZULA 1EFVA 1LQ2A 4MQFA 4RWEA 2O0KA 4XVRA 4KXVA 1GVNB 5ED0A 4MRMB 4AJKA 4JI5B 4QOEA 1CQPA 2AWOA 2QZZA 3AYXB 1EP2B 2C9DA 4GXQA 2DBZA 3W5VA 1RHKA 1QVWA 4HDOB 1S9HA 3GU3A 4HDSB 2AEMA 1AS3A 3OOJA 2AA3A 1JDJA 1II9A 1CUGA 3NTXA 3LBFA 3O03A 4X20A 4F2GA 3WRVA 3EA5A 5BVHB 2I9KA 2FZCA 3C4JA 3EOAI 3GO4A 4M7OA 3TXXA 2QJTA 1RKVA 3B1KA 1J0BA 3EVDA 4J16A 4DFDA 4YLYA 2BFPA 3C7DB 1LK7A 1SVSA 2X9NA 3QLUA 4JQYA 2PX8A 3QUBA 1QVRA 2FPWA 1D0VA 3ICOA 4F4IA 3JWPA 1E2KA 5KSYA 4AG3A 2BC9A 4JKYA 1Z16A 1K3UB 2EDCA 5FI3A 3AKDA 3EWIA 1XVUA 3GFQA 4PYLA 4TLMB 4R9UC 5DGHA 2Q3EA 3W3ZB 3ZCQA 3Q3VA 1G5HA 4WCDA 5JSHA 3ZGNA 3NGLA 3GGOA 1O89A 1EVKA 4S1PA 3V9PA 2VXCA 3G9UA 3FSGD 1U8FO 3QVOA 4P58A 5CFRA 5CFLA 3TXAA 2XMBA 1M5RA 4RCYA 3RW9A 2ZS9A 1FMLA 3F6BX 3SHVA 4P5PA 2H5EA 2PYZA 1J99A 1JHUA 2ROQA 4J0HA 5FL7A 3SMVA 2E0IA 1AQYA 2WT4A 2C3MA 3H5IA 4IDNA 3GLFE 2UYOA 2QMHA 2BGUA 2EKBA 2MSWA 2WNHA 4IEFB 1ORHA 4HRVA 4X92A 4LI3X 4W7IA 3AU8A 4NHEA 4HDMA 2ONCA 1SU6A 1B6SA 3VSEA 1QR6A 2K7ZA 4RTOA 4I5IA 4HQKA 5L3SB 3D8UA 5AKXA 1AQLA 4IX9A 1BS2A 1YGPA 1TEVA 2YOGA 3ZJ5A 4X1KB 4IQ0A 3FDIA 3PC7A 3VISA 2XMPA 3ZY6A 2B3DA 5IANA 1MU0A 1LF5A 3OWOA 3I30X 4OYRA 5AVKA 1PZEA 1TU0A 1AY0A 3ESCA 3FOBA 2V9ZA 4WE3A 4MIYA 1DXHA 2XGMA 4ND5A 5GV7A 2Q5CA 3H5NA 4K6HA 3VYRB 4LYFA 4EHJA 1GPBA 4RSGA 1OYYA 2XA2A 1JTVA 5MGBA 2XZTA 1QQAA 2V4ZA 2QTTA 3DHVA 4Q9NA 3V4RA 3DKIA 1H6BA 1E5QA 1M2VA 2PXAA 3E05A 3FI9A 1IHXA 3MSCA 2GA9A 4LQDA 5BNFA 4L5CA 821PA 3MZ0A 3ECAA 4OK6A 4JI1B 3OX1A 1EMDA 1UM9B 1FUYB 1EGAA 4KXFB 4F1JA 1TT5B 5JVDA 4QIHA 4MV5A 2LUOA 2V8BA 1K8RA 2W2LD 4QPDA 4R01A 1FP4B 1HDZA 2ET6A 2YN2A 4M1WA 4R8LA 2YVAA 3TBHA 1G21E 1MO2A 4CZ2A 1XPJA 2R79A 5GZ6A 2GPAA 1J07A 4RTLA 3KXIA 1N8KA 1XI2A 3C3XA 5KI6A 2HNAA 2XUPA 4FJ2A 2WSBA 2CLIB 4A15A 2WUWE 4Q3BA 4IMRA 4OFXA 3T5AA 3DE3X 1K2VN 2VI5A 4B6GA 2C2HA 2YQ5A 4WBNA 2XQVA 3W1WA 2WA2A 1HY3A 3UT6A 1B14A 5K8JB 3FVVA 1G291 3KHSA 4ZK6A 4DOMA 3JQPA 2GXUA 2VVTA 2YWHA 4WTOA 3I6QA 5CPBA 1GZSA 4DR3B 4ER5A 4FEAA 5IK2D 3OPMA 1B7GO 5JXJA 1XZCA 5FJJA 2HEIA 4HATA 3VNRA 1KI7A 1ZL0A 4CQLA 2D13A 3H19A 1YCFA 3D1LA 3WSWA 1QFMA 3ZDBA 2GN6A 3GI1A 3SEAA 3THYA 2RCNA 3H9BA 3I9V6 3M4YA 3PL1A 5H1YA 3L93A 5BN4B 2L42A 1GRQA 3EGEA 5K8LA 5MN5A 1BH2A 4BLSA 1NFRA 4XVHA 1VL6A 2HCJB 2YFYA 3FZQA 4FPXA 4D82A 1U8CB 3IE2A 3IKJA 2PX6A 4BCDA 4C29A 2GB4A 1BHJA 1DC6A 1MOZA 3HFGA 3OZEA 3ITKA 1GKKA 2R96A 5C7OO 3K96A 1AO3A 3QVGA 4PPYA 5JV5A 2E87A 5GP1A 4E5PA 5AO9A 1C8KA 3U7HB 1P1JA 5EKXA 1N6IA 3DO6A 3P2IA 3T3EA 1V6AA 3TEMA 3PXDA 1M2OB 1OVGA 3OCWA 1CRQA 2Z2XA 4RANA 3UJBA 3AWIA 4QD3A 3ZV6A 4DVGA 3NC1C 2RGAA 5IZCC 3CFYA 4W5OA 2C4NA 1T9GR 3KR9A 1U4SA 4B33A 4AY2A 2RK4A 2JBWA 3TSAA 1EXNA 1PRYA 2H2FA 1U0BB 1EGVB 3TRHA 3UKOA 1R0BA 4LSGA 4PQFA 2I4RA 5GINE 1P6UA 4XUGB 1ZI9A 4GOLD 1ECCA 3BWMA 2HHHB 4Y2VA 1ID1A 1QV7A 1Y63A 1RWWA 4C3VA 4R3NA 2ESRA 3E7PA 1NPTO 1UDRA 4GMKA 1CJKC 4ZRNA 4HR7A 4P53A 3TAHA 5CD9A 3NBYC 4P08A 4DR1B 3OI7A 5FQOA 3LIPA 4G9EA 5AHRA 1SBNE 1T5IA 3E9YA 4MQ6A 1FYVA 4BV8A 3C5WP 1FSSA 2RI6A 4FEYA 5H82A 4ZDKA 2Z8YM 3PPVA 3F73A 5JCXA 2NZUG 3KBBA 2FN9A 3N6VA 3ENQA 3HJNA 3I61A 2QUKA 4L78A 3GFGA 4M8KA 3F7MA 4MV1A 4D6PA 1XYGA 4RCVA 1SU7A 2O5EA 4K81B 5A04A 5E4FA 3CUYA 1X1BA 5KTYA 1IBSA 3QEBZ 1J33A 2L69A 3ZWPA 5JJIA 4W1RA 3B6KA 4QEDA 4RD0A 4XEHA 1F1BA 4F2DA 3ZXIA 3OA0A 4BNNA 3QTLA 2OFXA 2QKYA 3JTMA 4TMKA 4QGHA 1Y8AA 3LP8A 4MKZA 1LPSA 2OKCA 3IQDB 4DWOA 2VYFA 1COWA 3FYUB 4JP5A 4ILKA 4ZEWA 2ZYUX 5ILGA 3TSOA 1L7QA 1MF7A 4K05A 4TMZA 4CTOA 2J30A 3AM3A 2GM3A 4I1SA 2JD1A 3V8NA 1GGNA 2QI9F 4RSMA 4UC0A 1P3JA 2XADA 3P2EA 1MB9A 4CT5A 4EX6A 4TS4A 5TX7A 3NTOA 1DEKA 2D2IA 4G23A 4AMUA 4ALKA 3DCYA 1A8PA 4TRRA 1NDUA 3AMVA 1L5QA 2YMLA 2JRLA 3V33A 3BRQA 4EW1A 1COZA 4QYXA 2CDBA 2HU7A 4CKCB 1XLTA 2QSYA 3E7DA 3H2HA 4QHSA 4M8LA 1M8GA 2EKPA 3O9ZA 1E79D 2G06A 5DHQA 3WLRA 3HYNA 621PA 2NYUA 5FA6A 4DNOA 2FFRA 1DWPA 1FSGA 3KSAC 1QZXA 4R9SA 3SQLA 2X14A 1GUZA 1UMBB 3JWHA 2ILVA 1C9NA 2VNSA 3H9EO 5FEMA 3ZW8A 4BKQA 4C1BA 2W2KA 1BHQ1 1D2HA 3STYA 3QBDA 1H1TA 2NLOA 4LK3A 3ROPA 5AXDA 5ICMA 3RYFA 4O4LB 3NIBA 2IBSA 5HKAA 2BZ0A 1GG8A 1WXQA 5LP6C 3QA3E 1FLNA 3UFBA 1R4MB 4IQGA 2AC7A 3NAGA 3I2YX 3CX6A 2AD5A 3CHYA 4ASUA 4CN8A 5M29A 3A6ZA 2WMYA 4GKAA 3Q88A 1B2RA 1MENA 1L0BA 4ETWA 1LDGA 4MAAA 3ZKWB 1JR3E 5A4DA 4XIFA 5JAUA 1B76A 3CYFA 2W2VA 1W36D 1GFWA 2MWMA 3DWEX 3FRHA 1AQUA 3CV3A 3ICEA 1E2UA 5GONB 3VAAA 1DRVA 3EFBA 4LMAA 4B4VA 2Z2JA 4Y9TA 3ZE6A 3BWBA 4JB2A 2O0JA 4O2BF 3MINB 1RQXA 1I2MA 3BD6A 1GTG1 2REQA 5H02A 1VHTA 4ZDIA 3K0AA 3LCVB 3JQRA 4G85A 4OFZA 3ROEA 2FMHA 4DQ0A 4DZTA 4BS9A 3TG8A 2FW1A 4GR4A 3SXUB 4HGPA 2OBBA 3FSGA 2X19A 3CRQA 2OAP1 1BMFA 3ZHXA 5BV2P 5LWHA 2PZJA 3BBPA 4XVQA 3CF4G 2D1FA 2G5PA 4E03A 1IMJA 2O3UA 1P1RA 1RSZA 4I46A 3S2SA 4XM1A 4TKZA 3U56A 1LZLA 5JG7A 1CRZA 2JPDA 1XZIA 2QRVA 4OJQA 5KJFA 5DCUA 2JGDA 1QVAA 5EWJA 5F2OA 2P77A 1R8XA 1CCWA 3T5GA 3AEUB 1E58A 1QS0B 4AJ2A 3B38A 3NBUA 5YASA 2Z08A 4MUHA 2X1MA 3TLJA 3L7AA 5JR3A 6PFKA 1GTRA 3FB1A 3DZIA 2XZLA 4Y8VA 1P19A 2X0KA 3BXXA 1IQ0A 1UIMA 3ZW9A 2IL1A 1N32B 2BYTA 1R00A 2B5VA 2VXBA 2W6IA 4EYKA 1NA5A 4MHOA 4JP1A 2HSEA 4URZR 1XRRA 1VJDA 1MVOA 1U7TA 4PSCA 4QTZA 4YUYA 4YYZA 4DTIA 3M6WA 4AO6A 4OIMA 4JI0B 1MABA 4AJLA 3ZVLA 3D0RA 2FPGA 3UHOA 3AVQA 4PC2A 2PIAA 4ZT3A 2D5BA 4MUBA 4YRJA 5JAOA 4CEHB 4AKHA 2P9YA 4B6EA 1GWNA 4YAKA 2AVNA 5DBHX 4PZ0A 4KSCA 4XDYA 4I3HA 3N7UA 1Z7BA 1W4LA 3QMWA 1H6AA 3RYIB 1L8OA 1NUHA 4X7MA 3R8XA 2YINC 1F06A 3ZHBA 4CMHA 1FTNA 1X2BA 2F90A 2XOKA 2H57A 2Y1XA 3L0OA 4FDLA 1KORA 4GF5A 4LX8A 5DFAA 3STHA 2G7MC 1JVNA 1GQOA 1VP9A 1XXHB 2GBLA 4GWKA 2Q6OA 1R0XA 1PJ2A 4MPTA 4LEIA 4NG4A 5HJ2A 1YZ3A 1YDFA 5FYQA 2HSGA 5LDHA 1MB3A 1JG1A 2F9LA 4M6WA 1CUVA 4UE2A 1U28A 3R5XA 4BJ3A 3B3FA 3KQUA 1PVDA 1SCQA 4ZEVA 2IHNA 2ORWA 3TCNA 3I4LA 4FBMA 4FZ3A 5FTLA 2PUWA 1C1DA 1JG4A 2Q4OA 2CMHA 1PV2A 4KG7A 4D8TA 2YN0A 3C3JA 1ZEMA 3FUXA 4J0CA 2Z8YA 4YXWD 1U7PA 4NPHA 1A4RA 5KX5B 5G3YA 2K2WA 3PCTA 1NMZA 4MWZA 4QJIA 5EKSA 5FDFA 5CCBA 3GLIA 1OGJA 1UCFA 2C84A 2AQ8A 2ZRNA 2OG2A 4GLLA 4H1UA 4YRTA 3GWZA 4JQSA 2IKQA 5DYTA 2G5GX 1KS9A 2CYCA 2EKZA 4KPGA 5CH3A 3IFSA 4DY4A 4MJXA 1GCGA 1TC2A 4FT2A 1LJLA 3KEQA 3T54A 5JANA 1ZISA 1N2SA 5SICE 4MR9B 1PR9A 3LLUA 1FE8A 3A6JA 3VV2A 3X0DA 4OQNA 5DHPA 2JH8A 1JEJA 1SBYA 1E1RA 1YA4A 4TL7A 5KVSA 3HU1A 3RHTA 4LK2A 3J81k 2OHVA 4Y2YA 4BPRA 1LGYA 2Y1OA 1D1TA 2GN4A 4BLTA 3EEYA 3A10A 1MTZA 2BZGA 3H5AA 4G1VA 5EG5A 3VHQA 3RIEA 4QG3A 4LDNA 1ICIA 4ID3A 4HB2A 4XCQA 2K6GA 2HA7A 5KTOA 1TLFA 4KLAA 4L5BA 1M7GA 4J1TA 4QRDA 3MFYA 2ZE5A 2HADA 3K09C 4G89A 1Z4PX 3RC3A 1GNRA 1IZ0A 2I5PO 4WZBE 3GJ6A 3N70A 2WK1A 2EXXA 3EF0A 1P0PA 4Q12A 1IVSA 4FKZA 2J9XB 4Q01A 2LW7A 4BKUA 3VDNB 4ZC1A 3JX9A 2Y1WA 2VUSA 5ERGB 1HNWB 4KPYA 4KHPB 2QYOA 3DHWC 3KDPA 3NHWA 1T1IA 1ZIOA 1Y3DE 2NVWA 4PBSA 1YONA 2HWKA 3NWJA 1OXBB 2PTHA 3DHEA 1CEQA 4M37A 3V8VA 4YMGA 5LMCA 2X13A 1L1FA 4YRFA 2P91A 3RK1A 3FMOB 3V00A 4CW7A 5CPFA 1DC5A 4JX9A 1BCSB 4ESOA 4C01A 4ZTBA 5FEUA 1SKUA 2Q4DA 4ESVA 5DN6D 5FFMA 4EABA 3IIEA 3CGGA 3N3BC 3PXAA 2VHYA 2FKAA 4WFQA 1Y3BE 2VK1A 4MGZR 2HK8A 2QQ0A 4O4JA 4GZ6A 3MCAA 3RVRA 2CJWA 5IKEA 2R7MA 1LSOA 1RLOA 4W8GA 3RVSA 4EMUA 5KOHA 1VMEA 1RRCA 1HDRA 4GRIA 1XDBA 1YZTA 4P2BA 1TJ3A 2JGRA 3CEHA 1DBVO 1ECPA 1ZUNA 4X7BA 3FFBA 3LNTA 3WZLA 3T7EA 1L7RA 1HE2A 1XZBA 2ONYA 3OE7A 2RGYA 2J6IA 4F1WA 2ERCA 1MC1A 5IDVA 3UHAA 1HRKA 1MDBA 2WG0A 4JA2A 2GZ3A 4EJSC 2EL9A 1K4MA 4ZVTA 1Z2EA 1VMIA 1IDN1 3UJNA 2PKRA 1EFCA 5LQDA 3MINA 1GN8A 1LU9A 1V1JA 1FBTA 5TR9A 2Z2YA 2WIFA 1QNLA 3THYB 1B1CA 4RX1A 3FNGA 3FZYA 5EZ6B 2IP1A 5F33A 4FDMA 2JLYA 4GL2A 1FOEB 3U4AA 2XKBA 3FVRA 4XB2A 4RTSA 3QVTA 4GPTA 5FOSA 3OIVA 2JLAA 3NHRA 1AN9A 3EAFA 3OHPA 1EGHA 1MV8A 1PT9A 1JPNA 3NT4A 3AK4A 3D3QA 3ITNA 1JECA 3PF8A 1GSHA 2OFWA 4KMRA 3AFMA 3GVIA 4FLFA 3KXLA 2BGJA 3ZNPA 4QXQA 1TZBA 4TXLA 4PSDA 1EK2A 5B1IA 1G7RA 3PS9A 2VNAA 2PRYA 1KSGA 1W9HA 2P2LA 1VCOA 4LRQA 5LOVF 2ZWIA 4E12A 1TQDA 2I3DA 4ZAYA 1N2GA 1QRUA 1Q1GA 2DFNA 1NXQA 1WXIA 3WA6A 4BEBA 4N03A 3BMCA 1U5BB 5A5VA 3B89A 1JU4A 3CZCA 1VKHA 2IYEA 4D9CA 1U2ZA 1P0IA 2CN1A 4GUAA 1L4BA 2Q3JA 2XNDD 4BZXA 1HURA 2IELA 1KMHA 3HUDA 2C96A 3OUTA 2I7TA 4LXGA 1G9TA 2QSZA 2IUEA 1XZGA 1YQUA 3V1KA 3KLOA 4BJ1A 1NFFA 4CVNA 3P1JA 2UVDA 1EE1A 2DJIA 2IEBA 1PX2A 2YHBA 3S2IA 4QPPA 3PLAE 2XQKA 3RYCA 4I50F 3HPQA 3QFRA 1E69A 4IJ6A 4D3FA 1I32A 1NC3A 4WXRA 5GAJA 1NSTA 4IFTA 5HFJA 2C2OA 2SKEA 4I5DA 3X1WA 2VG8A 1M54A 3IVRA 2XOKD 2BGNA 3PHJA 3H0EA 3MCUA 1ZJJA 5TARA 3UHFA 1KQPA 1SXJE 2KM1A 4MI9A 2FN4A 2AYYA 3RUDA 3SHQA 3KQWA 5AK3A 3EFEA 3IILA 2FUKA 1NN1A 3NHUA 4XGRA 1V4VA 1MQSA 2CLMB 2YUTA 1NR5A 1CR0A 1JAHA 2SCUB 3ETHA 3FPHA 1GQ2A 1H93A 3H1FA 3KX2A 1IUOA 3OZWA 2AJTA 1AC5A 2PKQO 3STUA 3DW1X 1VDZA 5DW3A 5CEFA 4WXHA 5D7NA 4ZEOA 1FMFA 3F98A 1I4OA 4R69A 2X4GA 4IWYA 2SICE 2ZTVA 2JFFA 3ELWA 4CN9A 2OHHA 3HR8A 3O95A 2ZE8A 4IP0A 2IYLD 2XA1A 4TRNA 3EY4A 3RLIA 1E7SA 1NI4A 3U26A 1WV0A 4NE9A 5LNK1 5DXAA 2C95A 1UMCA 1ZSYA 3NFYA 2Z6VA 5J58A 3K1AB 3WWZA 3VYVA 4CYMA 1Q0LA 2QLLA 3I5XA 4GH5A 4H77A 3WYFA 2ECPA 4TTTS 3E1SA 2CNLA 1TAUA 1OE0A 2H7XA 2HJVA 2NQ2C 1KI8A 2VDNB 3Q9UA 1A04A 4G0QA 4P3XA 4XD2A 2IH2A 2XUIA 3PNOA 4C76A 2F62A 4P5DA 4UBJA 2R5FA 1RI2A 2EKDA 3IAS6 3OBBA 4BKRA 3VMFA 4DCNA 1C2YA 1HQYE 4Q9AA 2IZ6A 2IXAA 2J4DA 3IEPA 4KQIA 1B93A 2A9PA 4O4JF 4RF3A 1FJ2A 5LZ4A 4MS3A 4EMTA 2ZROA 3ELYA 1MPTA 1AGPA 1TNDA 3ET4A 4DJTA 3R0QA 4J2OA 3W5UA 3EQ7A 2VTBB 3DOFA 1A96A 1PL0A 3VNQA 1J90A 1LI5A 3WLAA 5B64A 1NBHA 5FOWA 1ZICA 4OSOA 2CLCX 4TT3A 2JLZA 1JP7A 4HS9A 2C7OA 2I66A 3GMTA 1KRHA 3A31A 3LLSA 5IXSA 4DBLC 3GGDA 2OXCA 4DG5A 2CJWB 2VYQA 3STXA 3G7NA 2BFAA 1RHMA 1N6KA 2RHTA 3DFMA 4G36A 4YACA 4YJ2F 2YV4A 1L7MA 3E82A 4G0ZA 4GE3A 3RRBA 1T36B 3N86A 3DEJA 4PYRA 5FT9A 3DZBA 4FLMA 4J94A 3BULA 3L1HA 1A9XB 2I4LA 1D9ZA 1VKRA 2GCOA 2R86A 3V8EA 3AERA 4CFSA 1PFWA 1T3GA 5L3QA 2HF7A 3MMPA 4WJKB 3I5AA 3SKYA 5HBGA 1HNNA 2H31A 4D0GA 4AAYA 3SQWA 1KS2A 1T8SA 1U0FA 4KJXA 2DUJA 4A92A 4HQOA 2V55B 2F43A 1YDEA 2C5GA 3CB4A 4MPJA 1GUAA 4HN4B 5F5XA 2BI7A 4HNAB 4F6CA 1BXGA 2Y3IA 4NJEA 4R3UC 5C9ZA 5JADA 2XNDA 1TQHA 5AI4A 3KB1A 1IEVA 1Z6ZA 4G6ZA 1NASA 1DJOA 1P44A 2XZOA 3RAEC 1XLTC 3TSZA 1EFAA 4WBNB 4NEHB 1J8YF 4N49A 3JQ7B 3O7WA 2ZXUA 5HDQA 3CUVA 3GJ3A 2RKBA 4O08A 2PLWA 3ZBPA 4PNEA 1KP3A 1IHPA 3HXPA 3QUTA 2UYGA 3FTCA 1E77A 1U3CA 3UCEA 3ZVMA 1ZWLA 1P61B 4IJVA 1DC4A 2Q1UA 4KTVE 4RJ2A 4C22A 2ZZNA 2V9PA 3AR7A 1D04A 4UUNA 3CEAA 5KVVA 1YSCA 3MTAA 1OZGA 2L0XA 4H3SA 4BIIA 1HEUA 1BYUA 1SFRA 5TVKA 2V97A 4OU5A 2ZXFA 1T4BA 3GLGB 5IX8A 1CJCA 4I4LA 3L8EA 2EIHA 2XYRA 2J3HA 1REQB 3A3NA 4MYHA 3WI7A 3OPYA 2AQKA 4L8YA 1GNQA 2ZRJA 3A4VA 3SC4A 1ZAYA 1AG9A 1WQ4A 4AZWA 3KLBA 2J5QA 1HSOA 2LTAA 5EMMA 3SBXA 5GTDA 4ZOBA 5CFPA 4YMVA 1F9EA 3BERA 4J7XA 1JHYA 1NQTA 1YHNA 2OGTA 3HV2A 4U7WA 4W9RA 3RGWS 4D25A 2AI1A 1BAPA 1GTVA 3TO5A 1OILA 5JZ9A 5F76A 1RJDA 3SIRA 4NHOA 1HDYA 5TQ2A 1ZUIA 2Z8ZA 3LIIA 2RFLA 3LCMA 3O8NA 1K6IA 1QRRA 2PWYA 4PZEA 4RIFA 4UVIA 1G41A 1XU9A 4FOOA 5E4YA 2IHVA 4RHEA 1NYQA 1T1RA 3GEDA 5EZYA 2V6IA 3H1PA 4XX0A 5I4IA 3LWNA 4OL9A 1JQAA 1XEFA 5IM4F 1A95A 3TM5A 1YQEA 2GCOB 4DIDA 5BN1A 3EE6A 4RLHA 2PSDA 1AKNA 3WGOA 3C48A 1Y4ZA 3I9FA 4GPEA 1UK9A 4BRWA 2C42A 2N9UA 4PQYA 4ZQIA 2OQVA 4E2FA 2Q2VA 4ZYYA 1Z0AA 3DMGA 3OICA 1CRWG 1MJGM 5CNMA 5HR5A 2GQ0A 3UJ3X 3R74A 3VH4A 3WHIA 4EDHA 2PA3A 3PUVA 3VZBA 1M1XB 2PLAA 1PJZA 1GAXA 4GKKB 4IIJF 3PQDA 3OLZA 3GYBA 4D6XA 4DR2B 2XBLA 4EHNA 4M1KA 4QDTA 1E2EA 2OV8A 3G5AA 3WFJA 4TMVA 4DRYA 5BURA 3ESZA 3HCFA 3C70A 3QIVA 2WWXA 4AXXA 5LLDA 3L0CA 3RVKA 4QT0A 3DT6A 4FZRA 3AM4A 1NY5A 3K0FB 1NP3A 1LKZA 2HI0A 4OTZA 2CFTA 3BN3A 3QMMA 3LT1A 3LHKA 1QVZA 2BEVB 2H54A 5M04A 1XTKA 1ENPA 1JR3D 3ILXA 4A0GA 4DBVO 4ERXA 4BNTA 1J0CA 1NRXA 4XM0A 1LLQA 3KPJA 1DXOA 4AF6A 1USVA 4UHJA 3TLBA 1XF1A 1Y80A 3A9RA 4WN9A 4Y18A 5E4TA 4J3NA 3IBCA 3ON5A 3GLFB 1E2LA 3WIOA 1SUFA 3HGQA 4M0DA 1U1EA 1DAMA 2FJPA 2IY9A 1L3CA 3WYNA 1XX6A 2D00A 3HCOA 3QUAA 4OQLA 4NXMB 3COSA 4NOJA 4WGFA 4EEKA 2NPIA 4C6HA 2CWDA 2Z4SA 4ZVSA 4B8ZA 4QT4A 4B7AA 5HKOA 1M2EA 2A0FA 1UPAA 2RJOA 5DLPA 4LQLA 3DTVB 2I4OA 3QI7A 2VPPA 1RJEA 3FA2A 2A9JA 2WSMA 2ZU0C 4JZYA 2CDCA 3TB4A 4MQEB 1E1QD 3WLIA 1B6GA 3T15A 1LPNA 2X3YA 5KNCA 1VG1A 4HS4A 4CMEC 4RQUA 3HYCA 4YJ3A 4AY5A 3DDOA 3TD2A 4D9EA 1F6BA 4DSZA 2IEAA 3IA7A 4KKVA 2HLDD 3UUEA 5CB8A 3WQQA 2TRSB 1XFDA 1XF9A 2I4IA 1NURA 4JL6A 1FSZA 1XRLA 2IYSA 1RWKA 4HAVA 1BIFA 4XDZA 1QGDA 4E51A 2EFCB 4JASB 4R7ZA 1C4WA 5AVYA 3B13B 1KY3A 1R9MA 1Z5WA 3R9WA 3B7GA 4IJKA 3U3OA 3HBAA 3MG9A 1WG8A 1CK4A 1JQ3A 3H8VA 3OLYA 3PUIA 5K4AA 3RIMA 4DDWA 4RGYA 3FHTA 5CU7A 1JGTA 1QO7A 2ZJBA 1VXRA 1IUKA 2RGDA 4FIZA 3DV9A 3QNMA 5AUOB 3IAAA 4ZGGA 4CIWA 2Y4OA 3KWLA 1UJ4A 4AF7A 1DAIA 2VUUA 1ZL2A 3FHOA 4PY2A 3HA3A 4TWBA 1Y6ZA 3SQOA 4ISBA 2OBMA 2Y9MB 3AF4A 3EVEA 1MEOA 1PZGA 4JOQA 3RSCA 2AOWA 1QV6A 3U17A 1KFJB 1WD7A 2WB4A 3D4BA 5HILA 2XRZA 3S2ZA 1M10A 5I51A 4F06A 3T1TA 1PG2A 4XSGA 4LYJA 1G64A 4L57A 3F67A 3T0FA 1PGPA 3VX4A 4D8WA 1GGJA 2VWQA 1CEEA 3C5HA 4HQNA 4CHTA 3B9BA 4ACBA 4NS4A 1WUKS 5CB6A 1MD9A 2AZDA 4RORA 5B58C 2JGKA 2IS6A 3GGJA 5LA6F 4QU8A 1LLFA 1WDTA 1UC9A 2UYCA 2G1PA 2CL6X 4EY3A 3D0QA 4EY5A 1QF6A 2WINI 1USKA 5LQCA 1IATA 3Q8XB 2NP7A 1TZCA 3DHYA 3GA0A 4WD3A 4DA7A 3WB9A 5HUHA 5IASA 3NJRA 1VYHA 1LF0A 3GUVA 2NT3A 1O96B 4GOMD 1OASA 1P7ZA 3I6MA 5HIIA 5JAIA 3W3AA 5BWOA 2NSLA 3H1EA 3QHPA 4NAUA 4D8UA 1Q7CA 4MJLA 2YJTD 3ROFA 3T94A 4E6EA 5TPWB 1EXVA 1GXSB 1WLYA 1SIWA 3M2PA 1ORWA 2DBRA 2VKTA 1L5MA 1IJBA 3H4TA 3QXGA 4YJ3B 5JRDS 2QR2A 2GLXA 3RRZA 1YBFA 4BC1A 1BEEA 3RFXA 1UXGA 2DBYA 5CW2A 3A1NA 3KKNA 3PB3A 3B8EA 3WSVA 1F2TB 1M1YA 2GD2A 2OZPA 4QNNA 4DXHA 1U6JA 2AKYA 2WUGA 1I30A 3P0EA 2GVDC 3I05A 1UFOA 1MKYA 1EG2A 1RYBA 5KOHB 3K30A 4J16C 4CM8A 1YRAA 3LLCA 2HN9A 2E4XA 4LCJA 1E1RD 3B1ZA 2QE7D 3HUEA 3I2JA 4LCEA 4TN5A 5D84A 3WZ2A 3QXXA 1J1UA 1GCUA 2QX4A 4R8VA 3GV0A 4EQZA 2OMKA 2E3JA 2P9TA 2VCEA 4C04A 2J0SA 4JMPA 4JYCA 4LY9A 2CNWD 4D1YA 3W7AA 4DT1A 5IVKA 4H1VA 3WGHA 3OJ0A 3WOVA 4GNKA 4D4LA 2PVSA 3NCHA 3KT8A 4NKR<