4P3MA

Crystal structure of serine hydroxymethyltransferase from psychromonas ingrahamii
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
422
structure length
376
Chain Sequence
MFNRDMNIADYDPELWQSITDEVQRQEDHIELIASENYTSPRVMEAQGSQLTNKYAEGYPGKRYYGGCEYVDVAESLAIERAKSLFGADYANVQPHSGSQANAAVYQALCAPGDTILGMYNAVQYILDYAEIERLAVEHKPTMIIAGGIVDWAKFREIADKVGAYLFVDMAHVAGLVAAGLYPNPVPFADVVTTTTHKTLGGPRGGLILAKANEAIEKKLNSAVFPGQQGGPLMHVIAAKAVAFKECAEPEFAVYQQQVLDNAKAMVKSFLARGYKIVSNHLFLVDLIAQDITGKEADAALGNAHITVNKNVTSGLRIGTPALARRGVNAQQSAELALWMCDVLDAIKDEAKLATTITAVKVKVAALCKACPVYGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational transitions driven by pyridoxal-5'-phosphate uptake in the psychrophilic serine hydroxymethyltransferase from Psychromonas ingrahamii.
pubmed doi rcsb
source organism Psychromonas ingrahamii
molecule tags Transferase
molecule keywords Serine hydroxymethyltransferase
total genus 134
structure length 376
sequence length 422
chains with identical sequence B
ec nomenclature ec 2.1.2.1: Glycine hydroxymethyltransferase.
pdb deposition date 2014-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00464 SHMT Serine hydroxymethyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 4p3mA01
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 4p3mA02
2CFBA 3B8XA 3RUYA 2OKKA 1QISA 2VGSA 1MGVA 4MKKA 2WK8A 4F5JA 5HDMA 4RIZA 3A9YA 1YNUA 2YKVA 3EUCA 4I8AA 1M0NA 3EZ1A 1U08A 2DKBA 2DKJA 1KL1A 2VMWA 3WX9A 2WK9A 3GR9A 1AY4A 4JEYA 4M2MA 1KL2A 3E2FA 4WYAA 4LNLA 4WXFA 3VK4A 4ZDLA 5HHYA 4F4EA 1OXPA 3ASAA 3BWNA 3R9AA 1I43A 2V0YA 3PA9A 2VMSA 2NMPA 2JISA 1ARSA 3GETA 3QBOA 3QM2A 3GSBA 5TF5A 1ASBA 1M7YA 1C4KA 2CANA 3PPLA 4R5FA 1I48A 4GSAA 2CJDA 2HZPA 3A2BA 3LWSA 3VP6A 4AOAA 1JS3A 1C0NA 1UU1A 4UHNA 4IXZA 3VK2A 2D63A 1OATA 2BWPA 1P3WA 1UKJA 1BW0A 1AHGA 3B1EA 1ASFA 4R2NA 1TARA 1TPLA 2CY8A 1GD9A 1IX7A 1D7RA 4HF8A 2E54A 3NUBA 4RAEA 3W1HA 2DGMA 2EPJA 4E1OA 2BIEA 2JJHA 3WZFA 1SZSA 5DJ9A 2YKXA 3G0TA 3P1TA 4GDYA 3AEOA 3KGWA 1WSTA 3EIBA 3DR4A 1I41A 3A8UX 2BI9A 1MAPA 2JGTA 2JJGA 1ASGA 4UHMA 2AY4A 4JEZA 4F5KA 4LNJA 2VIBA 4OCAA 5JAYA 3FVUA 3EI5A 4K2IA 4WYDA 2CTZA 2W7KA 3FZ6A 5DB5A 4CXQA 4RM1A 1TOGA 3OKSA 1B5OA 2VGZA 4W91A 2HOXA 1IUGA 1AHEA 3MC6C 1CS1A 3MAUA 1OHYA 3W1IA 1GC0A 3K7YA 3WCNA 1LC5A 2JJEA 1ZC9A 2YCNA 5G09A 2VMTA 3P6KA 4OC9A 1M0OA 4JF1A 3DR7A 3NNKA 4H51A 5FT6A 2FNUA 3MKJA 4ISYA 1IAXA 4MQRA 2G6WA 3EI7A 1V2FA 2E7IA 2X8UA 1YAAA 4GE4A 1I29A 1ASNA 4W8IA 5K8BA 2DOUA 3L44A 2R0TA 2HOYA 4WBTA 1W3UA 1ZODA 3FFRA 2HP2A 2GMUA 4A0HA 1G4XA 1AMAA 5M49A 2JJFA 3FCRA 3JW9A 1DJ9A 5EAVA 4KYOA 1JF9A 1BKGA 2V1PA 3I16A 2HORA 2VMPA 1GDEA 1XEYA 1AKBA 2DR1A 1O69A 1BQAA 1IAYA 2BYLA 3NTJA 3G7QA 4DGTA 3KE3A 4ZWVA 3FDBA 3TFTA 5HXXA 3QHXA 2XBNA 4WXGA 5FT4A 4RJ0A 4IYOB 5FT5A 4TMRA 4ADDA 3E2ZA 4WYFA 2C0RA 2GQNA 1W7MA 3EI6A 3HT4A 1AKCA 2BKWA 1V2DA 4XQ2A 3VK3A 2W8WA 4MQPA 1S06A 4IXSA 4Q31A 1B9IA 2YKUA 3FRKA 4BQ0A 1PMOA 4RLGA 1AJRA 1AHYA 3AOVA 2R5CA 4W1VA 3NYSA 2QA3A 4RKDA 1C7NA 2VGWA 2PB0A 4Y0DA 5M46A 3CQ5A 1JS6A 1WKGA 3ACZA 4W1XA 4WD2A 4Y0HA 1D7UA 2D61A 3NRAA 2Z20A 5EUNA 1X2AA 3FVSA 2JG2A 2EZ2A 3LVLB 4EMYA 2E7UA 2VGUA 1LC7A 4FFCA 2CB1A 1PFFA 4P7YA 3PD6B 4LW4A 2EZ1A 4WB0B 1ASEA 2Z9XA 2X5FA 2D7YA 2EGYA 3FTBA 1T3IA 3G8MA 3ELPA 1ZOBA 5EQCA 4EU1A 1QIRA 2Z9VA 3RQ1A 1M6SA 2PB2A 2BWOA 1M0QA 3PAAA 3TCMA 1BS0A 1Y4IA 3JZLA 4RJYA 3WKRA 3PJ0A 3AELA 1GC4A 2HUFA 1JG8A 1S08A 5LHAA 1M0PA 4OYTA 1CZEA 2YCTA 4CBRA 1KKJA 2ZY3A 1O4SA 2W8JA 4CBSA 1S07A 4CXRA 1GEWA 5EAAA 3GZDA 2ZSLA 1BJOA 1ARHA 2YCPA 5C6UA 1LKCA 1X0MA 3EI9A 3AEMC 2ORDA 1AKAA 2YKYA 2YRIA 3LY1A 2Z67A 1ARGA 3GZCA 4IY7A 5M4BA 1AAWA 3FQAA 2O0RA 4J8LA 1MDOA 3AENA 2ZSMA 1CQ6A 3OP7A 5E3KA 2BIGA 1ARIA 2HUUA 1YIZA 2OGAA 1ASDA 2C44A 4B98A 1EJIA 1AAMA 1ELQA 1H1CA 3QI6A 4WYGA 4F5IA 3FZ8A 3QGUA 2VMUA 5EFSA 1O61A 4PIWA 3E77A 4FL0A 4F5FA 1BJ4A 1DJUA 5LH9A 1SPAA 3N5MA 3MBBA 5AX8A 2OATA 2DGKA 4MGRA 1ASLA 2HUIA 1AMSA 2GB3A 4WLJA 1IX8A 3F6TA 4W1WA 1GCKA 3BCBA 4W5KA 1W23A 2X5DA 4RKCA 5EUDA 2ZY2A 3WGCA 3DZZA 3VAXA 3F9TA 1Z7DA 4Q76A 4WXBA 1KMKA 1CL2A 2OGEA 2BI1A 4N0WA 3QN6A 2QB3A 4Y0IA 4ADCA 4F5LA 3DYDA 2W7LA 1AMQA 2BWNA 1GEXA 1BT4A 4E3QA 5DX5A 1DFOA 1OHVA 2VI8A 1J32A 2ZJGA 3ELEA 1SZKA 1RV3A 3N0LA 1RV4A 3I4JA 4R5ZA 1WYVA 1N8PA 3HMUA 1D7SA 8AATA 1IBJA 4MKJA 4UQVA 4UOYA 3GWPA 3R4TA 3LVKA 1ASCA 4Q6RA 1LW5A 4ZSWA 3HLMA 2AY6A 3WY7A 3BCXA 2AEVA 2X3LA 2YHKA 2BIAA 3AEJC 1TOJA 3I5TA 3F0HA 2WK7A 3PDXA 4ZDPA 3WCOA 1B8GA 4WB0A 4IYOA 2AY9A 4OBUA 2BI5A 2CH2A 1LK9A 2VMVA 1AX4A 3WKSA 1CJ0A 2VGTA 5E4ZA 3B46A 4XJPA 3D6KA 3NYUA 1AMRA 1QZ9A 1C9CA 4JEWA 3BCAA 3B1DA 1TOKA 1EQBA 1M32A 2E7JA 2QMAA 4AZKA 4BA5A 1O62A 4F5HA 4ATQA 3ZZJA 1AY8A 1YOOA 4WP0A 1B5PA 4DBCA 4ATPA 1EG5A 1LW4A 1TOIA 2BHXA 4F5GA 5I92A 3JU7A 4A0FA 5F9SA 3FSLA 3PGYA 1W7NA 2C7TA 4M2KA 2FYFA 2Z9UA 2HOZA 1SVVA 2AY7A 2W7GA 3ATHA 3BN1A 3CQ4A 1X29A 1YIYA 1WYUA 1ARTA 3ZRRA 3WGBA 3KGXA 2AY1A 3E9KA 4HVKA 5FT8A 1IVRA 4BA4A 3FDDA 3FVXA 1DJEA 4N0BA 1WYTB 4ITGA 4WYEA 7AATA 4DQ6A 4XJMA 4PVFA 2CJHA 3LVMA 2W7EA 3MAFA 3KKIA 2HP1A 3CBFA 2XH1A 3MEBA 1QJ5A 1N31A 2RFVA 3FD0A 2AATA 4K2BA 3MAFB 2DGLA 4WYCA 4E3RA 5BJ4A 3B1CA 3N75A 4GRXA 1XI9A 1KMJA 4JE5D 4K2MA 2CH1A 3AEJA 1B9HA 2ZC0A 4P3MA 4QGRA 4MY5A 1ORDA 1WYVB 2QLRA 4XJOA 5G4JA 1BQDA 3NU8A 2FQ6A 4OBVA 2R5CB 4J5UA 1G4VA 3K40A 3E2YA 2VMQA 4A00A 2OQXA 2O1BA 3DXWA 4ZM4A 3TATA 2FM1A 2TPLA 3DU4A 2AEUA 1SF2A 3PDBA 1D2FA 3HVYA 5IWQA 2OKJA 3AEMA 2QB2A 1AJSB 3BB8A 3WLXA 2W7IA 1DKAA 1PMMA 4A0RA 1LC8A 2O7CA 4XEWA 2WKAA 2ZP7A 3BS8A 1SFFA 3NUIA 2YRRA 3FQ8A 4ZASA 1IX6A 3RI6A 3CAIA 4BMKA 4LW2A 1MDZA 3UWCA 2BI3A 3IF2A 3PIUA 4JF0A 3A9ZA 3ZRPA 1YJSA 2ZYJA 1DGDA 3MC6A 1BJWA 1B4XA 3NX3A 4ITXA 4XAUA 3ASBA 3BWNC 4TV7A 4AZJA 4CVQA 3H14A 3DRDA 4JEVA 4U2HA 3HQTA 3VOMA 3II0A 3T32A 2PO3A 5EIGB 4EB7A 2Z61A 1AY5A 1CQ7A 1CQ8A 2Z9WA 3GBXA 3AV7A 1LS3A 1D7VA 3BC8A 3BWOA 3FZ7A 1M4NA 2W7JA 1CZCA 1Z3ZA 3L8AA 2W7HA 1MLYA 2VMZA 2W7FA 1G7XA 4NOGA 1GC2A 4LNMA 4M2JA 4AH3A 1YJZA 4WLHA 2CJGA 3AEPA 3E6GA 2CINA 1MLZA 3IHJA 4A72A 1IJIA 4PFNA 1GC3A 3NU7A 1V2EA 3GZDC 5G2QA 2AY2A 4AO4A 1MDXA 2AY3A 3E2ZB 3JWAA 1QGNA 1VJOA 2VLFA 2VIAA 1ECXA 2W8TA 1AIAA 3M5UA 4OMAA 2FNIA 2VYCA 1E5FA 1UU0A 3LV2A 2F8JA 2VMNA 4BHDA 3USFA 1FG3A 4ZLVA 3DC1A 3LVJA 4ZM3A 1AHXA 1GBNA 2YOBA 4E77A 4ADBA 4GEBA 4A0GA 5G2PA 4JE5A 1VEFA 2VI9A 4ZWMA 1TATA 1ELUA 3RBLA 2VMOA 2VMRA 4GE7A 3HDOA 1UU2A 3MADA 4JEXA 1BJNA 1ASAA 3AOWA 3DXVA 4UHOA 4KXKA 5EIGA 1V72A 1WYUB 4RITA 5D95A 3UE8A 3ZRQA 4A6TA 5G0AA 2EO5A 4A6RA 1C7GA 4R8DA 2VLHA 1TASA 2ZUKA 1WKHA 3RBFA 1OHWA 3BV0A 3HBXA 2D64A 1SZUA 4O6ZA 1GEYA 3Q8NA 1H0CA 3TFUA 1FG7A 4ZSYA 2VGVA 5G4IA 4IXOA 3TQXA 3AATA 4OTLA 3RCHB 2ZY4A 2Z1YA 4XK1A 5DJ1A 3JWBA 3ISLA 1C7OA 1AHFA 2W7DA 3QPGA 2EH6A 1S09A 1AJSA 4U1TA 4XJLA 4KAMA 1X28A 1DTYA 3DODA 2R2NA 4ZDOA 4LC3A 4AO9A 3NDNA 2GSAA 2W8UA 4EB5A 2AY5A 1AICA 2D7ZA 3K28A 3EZSA 5BJ3A 4ZAHA 1S0AA 4GE9A 2R5EA 5F8VA 2BYJA 3EI8A 4Q75A 4MSOA 5D5SA 3W1JA 2QBTA 2BI2A 3HL2A 3EIAA 1G7WA 1WYTA 2Q7WA 4MQQA 4OT8A 4F5MA 3PD6A 4PFFA 2FN6A 1MAQA 3GJUA 5EUEA 4EFFA 2Z1ZA 3ZZKA 1YJYA 4B9BA 1PG8A 3ECDA 3FFHA 5E5IA 2D66A 9AATA 2CSTA 1QJ3A 3FQ7A 1RVUA 4A6UA 1ASMA 1BJOB 1E5EA 2AY8A 1VP4A 1OXOA 4L0OA 5J8QA 1RVYA 3COGA 3NYTA 2D65A 3UAKA 2ZY5A 2GMSA 4ADEA 2VMXA 1J04A 1W7LA 3RCHA 1AIBA 4TN4A 3AENB 3FKDA 1QITA 2VMYA 3JTXA 4IX8A 2W7MA 1KKPA 1FC4A 3LG0A 5M4DA 4IW7A 2W8VA 2C81A 1CL1A 1N2TA 1TOEA 3A9XA 3PDBB 3H7FA 1DGEA 2D5YA 3CQ6A
chains in the Genus database with same CATH superfamily
2CFBA 3B8XA 3RUYA 2OKKA 1QISA 2VGSA 1MGVA 4MKKA 2WK8A 4F5JA 5HDMA 4RIZA 3A9YA 1YNUA 2YKVA 3EUCA 4I8AA 1M0NA 3EZ1A 3N7NA 1U08A 2DKBA 2DKJA 1KL1A 2VMWA 3WX9A 2WK9A 3GR9A 1AY4A 4JEYA 4M2MA 1KL2A 3E2FA 4WYAA 4LNLA 4WXFA 3VK4A 4ZDLA 5HHYA 4F4EA 1OXPA 3ASAA 3BWNA 3R9AA 1I43A 2V0YA 3PA9A 2VMSA 2NMPA 2JISA 1ARSA 3GETA 3QBOA 3QM2A 3GSBA 5TF5A 1ASBA 1M7YA 1C4KA 2CANA 3PPLA 4R5FA 1I48A 4GSAA 2CJDA 2HZPA 3A2BA 3LWSA 3VP6A 4AOAA 1JS3A 1C0NA 1UU1A 4UHNA 4IXZA 3VK2A 2D63A 1OATA 2BWPA 1P3WA 1UKJA 1BW0A 1AHGA 3B1EA 1ASFA 4R2NA 1TARA 1TPLA 2CY8A 1GD9A 1IX7A 1D7RA 4HF8A 2E54A 3NUBA 4RAEA 3W1HA 2DGMA 2EPJA 4E1OA 2BIEA 2JJHA 3WZFA 3H9XA 1SZSA 5DJ9A 2YKXA 3G0TA 3P1TA 4GDYA 3AEOA 3KGWA 1WSTA 3EIBA 3DR4A 1I41A 3A8UX 2BI9A 1MAPA 2JGTA 2JJGA 1ASGA 4UHMA 2AY4A 4JEZA 4F5KA 4LNJA 2VIBA 4OCAA 5JAYA 3FVUA 3EI5A 4K2IA 4WYDA 2CTZA 2W7KA 3FZ6A 5DB5A 4CXQA 4RM1A 1TOGA 3OKSA 1B5OA 2VGZA 4W91A 2HOXA 1IUGA 1AHEA 3MC6C 1CS1A 3MAUA 1OHYA 3W1IA 1GC0A 3K7YA 3WCNA 1LC5A 2JJEA 1ZC9A 2YCNA 5G09A 2VMTA 3P6KA 4OC9A 1M0OA 4JF1A 3DR7A 3NNKA 4H51A 5FT6A 2FNUA 3MKJA 4ISYA 1IAXA 4MQRA 2G6WA 3EI7A 1V2FA 2E7IA 2X8UA 1YAAA 4GE4A 1I29A 1ASNA 4W8IA 5K8BA 2DOUA 3L44A 2R0TA 2HOYA 4WBTA 1W3UA 3N4XA 1ZODA 3FFRA 2HP2A 2GMUA 4A0HA 1G4XA 1AMAA 5M49A 2JJFA 3FCRA 3JW9A 1DJ9A 5EAVA 4KYOA 1JF9A 1BKGA 2V1PA 3I16A 2HORA 2VMPA 1GDEA 1XEYA 1AKBA 2DR1A 1O69A 1BQAA 1IAYA 2BYLA 3NTJA 3G7QA 4DGTA 3KE3A 4ZWVA 3FDBA 3TFTA 2A1VA 5HXXA 3QHXA 2XBNA 4WXGA 5FT4A 4RJ0A 4IYOB 5FT5A 4TMRA 4ADDA 3E2ZA 4WYFA 2C0RA 2GQNA 1W7MA 3EI6A 3HT4A 1AKCA 2BKWA 1V2DA 4XQ2A 3VK3A 2W8WA 4MQPA 1S06A 4IXSA 4Q31A 4K05A 1B9IA 2YKUA 3FRKA 4BQ0A 1PMOA 4RLGA 1AJRA 1AHYA 3AOVA 2R5CA 4W1VA 3NYSA 2QA3A 4RKDA 1C7NA 2VGWA 2PB0A 4Y0DA 5M46A 3CQ5A 1JS6A 1WKGA 3ACZA 4W1XA 4WD2A 4Y0HA 1D7UA 2D61A 3NRAA 2Z20A 5EUNA 1X2AA 3FVSA 2JG2A 2EZ2A 3LVLB 4EMYA 2E7UA 2VGUA 1LC7A 4FFCA 2CB1A 1PFFA 4P7YA 3PD6B 4LW4A 2EZ1A 4WB0B 1ASEA 2Z9XA 2X5FA 2D7YA 2EGYA 3FTBA 1T3IA 3G8MA 3ELPA 1ZOBA 5EQCA 4EU1A 1QIRA 2KFPA 2Z9VA 3RQ1A 1M6SA 2PB2A 2BWOA 1M0QA 3PAAA 3TCMA 1BS0A 1Y4IA 3JZLA 4RJYA 3WKRA 3PJ0A 3AELA 1GC4A 2HUFA 1JG8A 1S08A 5LHAA 1M0PA 4OYTA 1CZEA 2YCTA 4CBRA 1KKJA 2ZY3A 1O4SA 2W8JA 4CBSA 1S07A 4CXRA 1GEWA 5EAAA 3GZDA 2ZSLA 1BJOA 1ARHA 2YCPA 5C6UA 1LKCA 1X0MA 3EI9A 3AEMC 2ORDA 1AKAA 2YKYA 2YRIA 3LY1A 2Z67A 1ARGA 3GZCA 4IY7A 5M4BA 1AAWA 3FQAA 2O0RA 4J8LA 1MDOA 3AENA 2ZSMA 1CQ6A 3OP7A 5E3KA 2BIGA 1ARIA 2HUUA 1YIZA 2OGAA 1ASDA 2C44A 4B98A 1EJIA 1AAMA 1ELQA 1H1CA 3QI6A 4WYGA 4F5IA 3FZ8A 3QGUA 2VMUA 5EFSA 1O61A 4PIWA 3E77A 4FL0A 4F5FA 1BJ4A 1DJUA 5LH9A 1SPAA 3N5MA 3MBBA 2G7JA 5AX8A 2OATA 2DGKA 4MGRA 1ASLA 2HUIA 1AMSA 2GB3A 4WLJA 1IX8A 3F6TA 4W1WA 1GCKA 3BCBA 4W5KA 1W23A 2X5DA 4RKCA 5EUDA 2ZY2A 3WGCA 3DZZA 3VAXA 3F9TA 1Z7DA 4Q76A 4WXBA 1KMKA 1CL2A 2OGEA 2BI1A 4N0WA 3QN6A 2QB3A 4Y0IA 4ADCA 4F5LA 3DYDA 2W7LA 1AMQA 2BWNA 1GEXA 1BT4A 4E3QA 5DX5A 1DFOA 1OHVA 2VI8A 1J32A 2ZJGA 3ELEA 1SZKA 1RV3A 1KAFA 3N0LA 1RV4A 3I4JA 4R5ZA 1WYVA 1N8PA 3HMUA 1D7SA 8AATA 1IBJA 4MKJA 4UQVA 4UOYA 3GWPA 3R4TA 3LVKA 1ASCA 4Q6RA 1LW5A 4ZSWA 3HLMA 2AY6A 3WY7A 3BCXA 2AEVA 2X3LA 2YHKA 2BIAA 3AEJC 1TOJA 3I5TA 3F0HA 2WK7A 3PDXA 4ZDPA 3WCOA 1B8GA 4WB0A 4IYOA 2AY9A 4OBUA 2BI5A 2CH2A 1LK9A 2VMVA 1AX4A 3WKSA 1CJ0A 2VGTA 5E4ZA 3B46A 4XJPA 3D6KA 3NYUA 1AMRA 1QZ9A 1C9CA 4JEWA 3BCAA 3B1DA 1TOKA 1EQBA 1M32A 2E7JA 5KTBA 2QMAA 4AZKA 4BA5A 1O62A 4F5HA 4ATQA 3ZZJA 1AY8A 1YOOA 4WP0A 1B5PA 4DBCA 4ATPA 1EG5A 1LW4A 1TOIA 2BHXA 4F5GA 5I92A 3JU7A 4A0FA 5F9SA 3FSLA 3PGYA 1W7NA 2C7TA 4M2KA 2FYFA 2Z9UA 2HOZA 1SVVA 2AY7A 2W7GA 3ATHA 3BN1A 3CQ4A 1X29A 1YIYA 1WYUA 1ARTA 3ZRRA 3WGBA 3KGXA 2AY1A 3E9KA 4HVKA 5FT8A 1IVRA 4BA4A 3FDDA 3FVXA 1DJEA 4N0BA 1WYTB 4ITGA 4WYEA 7AATA 4DQ6A 4XJMA 4PVFA 2CJHA 3LVMA 2W7EA 3MAFA 3KKIA 2HP1A 3CBFA 2XH1A 3MEBA 1QJ5A 1N31A 2RFVA 3FD0A 2AATA 4K2BA 3MAFB 2DGLA 4WYCA 4E3RA 5BJ4A 3B1CA 3N75A 4GRXA 1XI9A 1KMJA 4JE5D 4K2MA 2CH1A 3AEJA 1B9HA 2ZC0A 4P3MA 4QGRA 4MY5A 1ORDA 1WYVB 2QLRA 4XJOA 5G4JA 1BQDA 3NU8A 2FQ6A 4OBVA 2R5CB 4J5UA 1G4VA 3K40A 3E2YA 2QSRA 2VMQA 4A00A 2OQXA 2O1BA 3DXWA 2WB6A 4ZM4A 3TATA 2FM1A 2TPLA 3DU4A 2AEUA 1SF2A 3PDBA 1D2FA 3HVYA 5IWQA 2OKJA 3AEMA 2QB2A 1AJSB 3BB8A 3WLXA 2W7IA 1DKAA 1PMMA 4A0RA 1LC8A 2O7CA 4XEWA 2WKAA 2ZP7A 3BS8A 1SFFA 3NUIA 2YRRA 3FQ8A 4ZASA 1IX6A 3RI6A 3CAIA 4BMKA 4LW2A 1MDZA 3UWCA 2BI3A 3IF2A 3PIUA 4JF0A 3A9ZA 3ZRPA 1YJSA 2ZYJA 1DGDA 3MC6A 1BJWA 1B4XA 3NX3A 4ITXA 4XAUA 3ASBA 3BWNC 4TV7A 4AZJA 4CVQA 3H14A 3DRDA 4JEVA 4U2HA 3HQTA 3VOMA 3II0A 3T32A 2PO3A 5EIGB 4EB7A 2Z61A 1AY5A 1CQ7A 1CQ8A 2Z9WA 3GBXA 3AV7A 1LS3A 1D7VA 3BC8A 3BWOA 3FZ7A 1M4NA 2W7JA 1CZCA 1Z3ZA 3L8AA 2W7HA 1MLYA 2VMZA 2W7FA 1G7XA 4NOGA 1GC2A 4LNMA 4M2JA 4AH3A 1YJZA 4WLHA 2CJGA 3AEPA 3E6GA 2CINA 1MLZA 3IHJA 4A72A 1IJIA 4PFNA 1GC3A 3NU7A 1V2EA 3GZDC 5G2QA 2AY2A 4AO4A 1MDXA 2AY3A 3E2ZB 3JWAA 1QGNA 1VJOA 2VLFA 2VIAA 1ECXA 2W8TA 1AIAA 3M5UA 4OMAA 2FNIA 2VYCA 1E5FA 1UU0A 3LV2A 3N4SA 2F8JA 2VMNA 4BHDA 3USFA 1FG3A 4ZLVA 3DC1A 3LVJA 4ZM3A 1AHXA 1GBNA 2YOBA 4E77A 4ADBA 4GEBA 4A0GA 5G2PA 4JE5A 1VEFA 2VI9A 4ZWMA 1TATA 1ELUA 3RBLA 2VMOA 2VMRA 4GE7A 3HDOA 1UU2A 3MADA 4JEXA 1BJNA 1ASAA 3AOWA 3DXVA 4UHOA 4KXKA 5EIGA 1V72A 1WYUB 4RITA 5D95A 3UE8A 3ZRQA 4A6TA 5G0AA 2EO5A 4A6RA 1C7GA 4R8DA 2VLHA 1TASA 2ZUKA 1WKHA 3RBFA 1OHWA 3BV0A 3HBXA 2D64A 1SZUA 4O6ZA 1GEYA 3Q8NA 1H0CA 3TFUA 1FG7A 4ZSYA 2EYQA 2VGVA 5G4IA 4IXOA 3TQXA 3AATA 4OTLA 3RCHB 2ZY4A 2Z1YA 4XK1A 5DJ1A 3JWBA 3ISLA 1C7OA 1AHFA 2W7DA 3QPGA 2EH6A 4H63Q 1S09A 1AJSA 4U1TA 4XJLA 4KAMA 1X28A 1DTYA 3DODA 2R2NA 4ZDOA 4LC3A 2FKIA 4AO9A 3NDNA 2GSAA 2W8UA 4EB5A 2AY5A 1AICA 2D7ZA 3K28A 3EZSA 5BJ3A 4ZAHA 1S0AA 4GE9A 2R5EA 5F8VA 2BYJA 3EI8A 4Q75A 4MSOA 5D5SA 3W1JA 2QBTA 2BI2A 3HL2A 3EIAA 1G7WA 1WYTA 2Q7WA 4MQQA 4OT8A 4F5MA 3PD6A 4PFFA 2FN6A 1MAQA 3GJUA 5EUEA 4EFFA 2Z1ZA 3ZZKA 1YJYA 4B9BA 1PG8A 3ECDA 3FFHA 5E5IA 2D66A 9AATA 3N4RA 2CSTA 1QJ3A 3FQ7A 1RVUA 4A6UA 1ASMA 1BJOB 1E5EA 2AY8A 1VP4A 1OXOA 4L0OA 5J8QA 1RVYA 3COGA 3NYTA 2D65A 3UAKA 2ZY5A 2GMSA 4ADEA 2VMXA 1J04A 1W7LA 3RCHA 1AIBA 4TN4A 3AENB 3FKDA 1QITA 2VMYA 3JTXA 4IX8A 2W7MA 1KKPA 1FC4A 3LG0A 5M4DA 4IW7A 2W8VA 2C81A 1CL1A 1N2TA 1TOEA 3A9XA 3PDBB 3H7FA 1DGEA 2D5YA 3CQ6A
chains in the Genus database with same CATH topology
2CFBA 3B8XA 3RUYA 2OKKA 1QISA 2VGSA 1MGVA 4MKKA 2WK8A 4F5JA 5HDMA 4RIZA 3A9YA 1YNUA 2YKVA 3EUCA 4I8AA 1M0NA 3EZ1A 3N7NA 1U08A 2DKBA 2DKJA 1KL1A 2VMWA 3WX9A 2WK9A 3GR9A 1AY4A 4JEYA 4M2MA 1KL2A 3E2FA 4WYAA 4LNLA 4WXFA 3VK4A 4ZDLA 5HHYA 4F4EA 1OXPA 3ASAA 3BWNA 3R9AA 1I43A 2V0YA 3PA9A 2VMSA 2NMPA 2JISA 1ARSA 3GETA 3QBOA 3QM2A 3GSBA 5TF5A 1ASBA 1M7YA 1C4KA 2CANA 3PPLA 4R5FA 1I48A 4GSAA 2CJDA 2HZPA 3A2BA 3LWSA 3VP6A 4AOAA 1JS3A 1C0NA 1UU1A 4UHNA 4IXZA 3VK2A 2D63A 1OATA 2BWPA 1P3WA 1UKJA 1BW0A 1AHGA 3B1EA 1ASFA 4R2NA 1TARA 1TPLA 2CY8A 1GD9A 1IX7A 1D7RA 4HF8A 2E54A 3NUBA 4RAEA 3W1HA 2DGMA 2EPJA 4E1OA 2BIEA 2JJHA 3WZFA 3H9XA 1SZSA 5DJ9A 2YKXA 3G0TA 3P1TA 4GDYA 3AEOA 3KGWA 1WSTA 3EIBA 3DR4A 1I41A 3A8UX 2BI9A 1MAPA 2JGTA 2JJGA 1ASGA 4UHMA 2AY4A 4JEZA 4F5KA 4LNJA 2VIBA 4OCAA 5JAYA 3FVUA 3EI5A 4K2IA 4WYDA 2CTZA 2W7KA 3FZ6A 5DB5A 4CXQA 4RM1A 1TOGA 3OKSA 1B5OA 2VGZA 4W91A 2HOXA 1IUGA 1AHEA 3MC6C 1CS1A 3MAUA 1OHYA 3W1IA 1GC0A 3K7YA 3WCNA 1LC5A 2JJEA 1ZC9A 2YCNA 5G09A 2VMTA 3P6KA 4OC9A 1M0OA 4JF1A 3DR7A 3NNKA 4H51A 5FT6A 2FNUA 3MKJA 4ISYA 1IAXA 4MQRA 2G6WA 3EI7A 1V2FA 2E7IA 2X8UA 1YAAA 4GE4A 1I29A 1ASNA 4W8IA 5K8BA 2DOUA 3L44A 2R0TA 2HOYA 4WBTA 1W3UA 3N4XA 1ZODA 3FFRA 2HP2A 2GMUA 4A0HA 1G4XA 1AMAA 5M49A 2JJFA 3FCRA 3JW9A 1DJ9A 5EAVA 4KYOA 1JF9A 1BKGA 2V1PA 3I16A 2HORA 2VMPA 1GDEA 1XEYA 1AKBA 2DR1A 1O69A 1BQAA 1IAYA 2BYLA 3NTJA 3G7QA 4DGTA 3KE3A 4ZWVA 3FDBA 3TFTA 2A1VA 5HXXA 3QHXA 2XBNA 4WXGA 5FT4A 4RJ0A 4IYOB 5FT5A 4TMRA 4ADDA 3E2ZA 4WYFA 2C0RA 2GQNA 1W7MA 3EI6A 3HT4A 1AKCA 2BKWA 1V2DA 4XQ2A 3VK3A 2W8WA 4MQPA 1S06A 4IXSA 4Q31A 4K05A 1B9IA 2YKUA 3FRKA 4BQ0A 1PMOA 4RLGA 1AJRA 1AHYA 3AOVA 2R5CA 4W1VA 3NYSA 2QA3A 4RKDA 1C7NA 2VGWA 2PB0A 4Y0DA 5M46A 3CQ5A 1JS6A 1WKGA 3ACZA 4W1XA 4WD2A 4Y0HA 1D7UA 2D61A 3NRAA 2Z20A 5EUNA 1X2AA 3FVSA 2JG2A 2EZ2A 3LVLB 4EMYA 2E7UA 2VGUA 1LC7A 4FFCA 2CB1A 1PFFA 4P7YA 3PD6B 4LW4A 2EZ1A 4WB0B 1ASEA 2Z9XA 2X5FA 2D7YA 2EGYA 3FTBA 1T3IA 3G8MA 3ELPA 1ZOBA 5EQCA 4EU1A 1QIRA 2KFPA 2Z9VA 3RQ1A 1M6SA 2PB2A 2BWOA 1M0QA 3PAAA 3TCMA 1BS0A 1Y4IA 3JZLA 4RJYA 3WKRA 3PJ0A 3AELA 1GC4A 2HUFA 1JG8A 1S08A 5LHAA 1M0PA 4OYTA 1CZEA 2YCTA 4CBRA 1KKJA 2ZY3A 1O4SA 2W8JA 4CBSA 1S07A 4CXRA 1GEWA 5EAAA 3GZDA 2ZSLA 1BJOA 1ARHA 2YCPA 5C6UA 1LKCA 1X0MA 3EI9A 3AEMC 2ORDA 1AKAA 2YKYA 2YRIA 3LY1A 2Z67A 1ARGA 3GZCA 4IY7A 5M4BA 1AAWA 3FQAA 2O0RA 4J8LA 1MDOA 3AENA 2ZSMA 1CQ6A 3OP7A 5E3KA 2BIGA 1ARIA 2HUUA 1YIZA 2OGAA 1ASDA 2C44A 4B98A 1EJIA 1AAMA 1ELQA 1H1CA 3QI6A 4WYGA 4F5IA 3FZ8A 3QGUA 2VMUA 5EFSA 1O61A 4PIWA 3E77A 4FL0A 4F5FA 1BJ4A 1DJUA 5LH9A 1SPAA 3N5MA 3MBBA 2G7JA 5AX8A 2OATA 2DGKA 4MGRA 1ASLA 2HUIA 1AMSA 2GB3A 4WLJA 1IX8A 3F6TA 4W1WA 1GCKA 3BCBA 4W5KA 1W23A 2X5DA 4RKCA 5EUDA 2ZY2A 3WGCA 3DZZA 3VAXA 3F9TA 1Z7DA 4Q76A 4WXBA 1KMKA 1CL2A 2OGEA 2BI1A 4N0WA 3QN6A 2QB3A 4Y0IA 4ADCA 4F5LA 3DYDA 2W7LA 1AMQA 2BWNA 1GEXA 1BT4A 4E3QA 5DX5A 1DFOA 1OHVA 2VI8A 1J32A 2ZJGA 3ELEA 1SZKA 1RV3A 3N0LA 1RV4A 3I4JA 4R5ZA 1WYVA 1N8PA 3HMUA 1D7SA 8AATA 1IBJA 4MKJA 4UQVA 4UOYA 3GWPA 3R4TA 3LVKA 1ASCA 4Q6RA 1LW5A 4ZSWA 3HLMA 2AY6A 3WY7A 3BCXA 2AEVA 2X3LA 2YHKA 2BIAA 3AEJC 1TOJA 3I5TA 3F0HA 2WK7A 3PDXA 4ZDPA 3WCOA 1B8GA 4WB0A 4IYOA 2AY9A 4OBUA 2BI5A 2CH2A 1LK9A 2VMVA 1AX4A 3WKSA 1CJ0A 2VGTA 5E4ZA 3B46A 4XJPA 3D6KA 3NYUA 1AMRA 1QZ9A 1C9CA 4JEWA 3BCAA 3B1DA 1TOKA 1EQBA 1M32A 2E7JA 5KTBA 2QMAA 4AZKA 4BA5A 1O62A 4F5HA 4ATQA 3ZZJA 1AY8A 1YOOA 4WP0A 1B5PA 4DBCA 4ATPA 1EG5A 1LW4A 1TOIA 2BHXA 4F5GA 5I92A 3JU7A 4A0FA 5F9SA 3FSLA 3PGYA 1W7NA 2C7TA 4M2KA 2FYFA 2Z9UA 2HOZA 1SVVA 2AY7A 2W7GA 3ATHA 3BN1A 3CQ4A 1X29A 1YIYA 1WYUA 1ARTA 3ZRRA 3WGBA 3KGXA 2AY1A 3E9KA 4HVKA 5FT8A 1IVRA 4BA4A 3FDDA 3FVXA 1DJEA 4N0BA 1WYTB 4ITGA 4WYEA 7AATA 4DQ6A 4XJMA 4PVFA 2CJHA 3LVMA 2W7EA 3MAFA 3KKIA 2HP1A 3CBFA 2XH1A 3MEBA 1QJ5A 1N31A 2RFVA 3FD0A 2AATA 4K2BA 3MAFB 2DGLA 4WYCA 4E3RA 5BJ4A 3B1CA 3N75A 4GRXA 1XI9A 1KMJA 4JE5D 4K2MA 2CH1A 3AEJA 1B9HA 2ZC0A 4P3MA 4QGRA 4MY5A 1ORDA 1WYVB 2QLRA 4XJOA 5G4JA 1BQDA 3NU8A 2FQ6A 4OBVA 2R5CB 4J5UA 1G4VA 3K40A 3E2YA 2QSRA 2VMQA 4A00A 2OQXA 2O1BA 3DXWA 2WB6A 4ZM4A 3TATA 2FM1A 2TPLA 3DU4A 2AEUA 1SF2A 3PDBA 1D2FA 3HVYA 5IWQA 2OKJA 3AEMA 2QB2A 1AJSB 3BB8A 3WLXA 2W7IA 1DKAA 1PMMA 4A0RA 1LC8A 2O7CA 4XEWA 2WKAA 2ZP7A 3BS8A 1SFFA 3NUIA 2YRRA 3FQ8A 4ZASA 1IX6A 3RI6A 3CAIA 4BMKA 4LW2A 1MDZA 3UWCA 2BI3A 3IF2A 3PIUA 4JF0A 3A9ZA 3ZRPA 1YJSA 2ZYJA 1DGDA 3MC6A 1BJWA 1B4XA 3NX3A 4ITXA 4XAUA 3ASBA 3BWNC 4TV7A 4AZJA 4CVQA 3H14A 3DRDA 4JEVA 4U2HA 3HQTA 3VOMA 3II0A 3T32A 2PO3A 5EIGB 4EB7A 2Z61A 1AY5A 1CQ7A 1CQ8A 2Z9WA 3GBXA 3AV7A 1LS3A 1D7VA 3BC8A 3BWOA 3FZ7A 1M4NA 2W7JA 1CZCA 1Z3ZA 3L8AA 2W7HA 1MLYA 2VMZA 2W7FA 1G7XA 4NOGA 1GC2A 4LNMA 4M2JA 4AH3A 1YJZA 4WLHA 2CJGA 3AEPA 3E6GA 2CINA 1MLZA 3IHJA 4A72A 1IJIA 4PFNA 1GC3A 3NU7A 1V2EA 3GZDC 5G2QA 2AY2A 4AO4A 1MDXA 2AY3A 3E2ZB 3JWAA 1QGNA 1VJOA 2VLFA 2VIAA 1ECXA 2W8TA 1AIAA 3M5UA 4OMAA 2FNIA 2VYCA 1E5FA 1UU0A 3LV2A 3N4SA 2F8JA 2VMNA 4BHDA 3USFA 1FG3A 4ZLVA 3DC1A 3LVJA 4ZM3A 1AHXA 1GBNA 2YOBA 4E77A 4ADBA 4GEBA 4A0GA 5G2PA 4JE5A 1VEFA 2VI9A 4ZWMA 1TATA 1ELUA 3RBLA 2VMOA 2VMRA 4GE7A 3HDOA 1UU2A 3MADA 4JEXA 1BJNA 1ASAA 3AOWA 3DXVA 4UHOA 4KXKA 5EIGA 1V72A 1WYUB 4RITA 5D95A 3UE8A 3ZRQA 4A6TA 5G0AA 2EO5A 4A6RA 1C7GA 4R8DA 2VLHA 1TASA 2ZUKA 1WKHA 3RBFA 1OHWA 3BV0A 3HBXA 2D64A 1SZUA 4O6ZA 1GEYA 3Q8NA 1H0CA 3TFUA 1FG7A 4ZSYA 2EYQA 2VGVA 5G4IA 4IXOA 3TQXA 3AATA 4OTLA 3RCHB 2ZY4A 2Z1YA 4XK1A 5DJ1A 3JWBA 3ISLA 1C7OA 1AHFA 2W7DA 3QPGA 2EH6A 4H63Q 1S09A 1AJSA 4U1TA 4XJLA 4KAMA 1X28A 1DTYA 3DODA 2R2NA 4ZDOA 4LC3A 2FKIA 4AO9A 3NDNA 2GSAA 2W8UA 4EB5A 2AY5A 1AICA 2D7ZA 3K28A 3EZSA 5BJ3A 4ZAHA 1S0AA 4GE9A 2R5EA 5F8VA 2BYJA 3EI8A 4Q75A 4MSOA 5D5SA 3W1JA 2QBTA 2BI2A 3HL2A 3EIAA 1G7WA 1WYTA 2Q7WA 4MQQA 4OT8A 4F5MA 3PD6A 4PFFA 2FN6A 1MAQA 3GJUA 5EUEA 4EFFA 2Z1ZA 3ZZKA 1YJYA 4B9BA 1PG8A 3ECDA 3FFHA 5E5IA 2D66A 9AATA 3N4RA 2CSTA 1QJ3A 3FQ7A 1RVUA 4A6UA 1ASMA 1BJOB 1E5EA 2AY8A 1VP4A 1OXOA 4L0OA 5J8QA 1RVYA 3COGA 3NYTA 2D65A 3UAKA 2ZY5A 2GMSA 4ADEA 2VMXA 1J04A 1W7LA 3RCHA 1AIBA 4TN4A 3AENB 3FKDA 1QITA 2VMYA 3JTXA 4IX8A 2W7MA 1KKPA 1FC4A 3LG0A 5M4DA 4IW7A 2W8VA 2C81A 1CL1A 1N2TA 1TOEA 3A9XA 3PDBB 3H7FA 1DGEA 2D5YA 3CQ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CFB A;  3B8X A;  3RUY A;  2OKK A;  1QIS A;  2VGS A;  1MGV A;  4MKK A;  2WK8 A;  4F5J A;  5HDM A;  4RIZ A;  3A9Y A;  1YNU A;  2YKV A;  3EUC A;  4I8A A;  1M0N A;  3EZ1 A;  1U08 A;  2DKB A;  2DKJ A;  1KL1 A;  2VMW A;  3WX9 A;  2WK9 A;  3GR9 A;  1AY4 A;  4JEY A;  4M2M A;  1KL2 A;  3E2F A;  4WYA A;  4LNL A;  4WXF A;  3VK4 A;  4ZDL A;  5HHY A;  4F4E A;  1OXP A;  3ASA A;  3BWN A;  3R9A A;  1I43 A;  2V0Y A;  3PA9 A;  2VMS A;  2NMP A;  2JIS A;  1ARS A;  3GET A;  3QBO A;  3QM2 A;  3GSB A;  5TF5 A;  1ASB A;  1M7Y A;  1C4K A;  2CAN A;  3PPL A;  4R5F A;  1I48 A;  4GSA A;  2CJD A;  2HZP A;  3A2B A;  3LWS A;  3VP6 A;  4AOA A;  1JS3 A;  1C0N A;  1UU1 A;  4UHN A;  4IXZ A;  3VK2 A;  2D63 A;  1OAT A;  2BWP A;  1P3W A;  1UKJ A;  1BW0 A;  1AHG A;  3B1E A;  1ASF A;  4R2N A;  1TAR A;  1TPL A;  2CY8 A;  1GD9 A;  1IX7 A;  1D7R A;  4HF8 A;  2E54 A;  3NUB A;  4RAE A;  3W1H A;  2DGM A;  2EPJ A;  4E1O A;  2BIE A;  2JJH A;  3WZF A;  1SZS A;  5DJ9 A;  2YKX A;  3G0T A;  3P1T A;  4GDY A;  3AEO A;  3KGW A;  1WST A;  3EIB A;  3DR4 A;  1I41 A;  3A8U X;  2BI9 A;  1MAP A;  2JGT A;  2JJG A;  1ASG A;  4UHM A;  2AY4 A;  4JEZ A;  4F5K A;  4LNJ A;  2VIB A;  4OCA A;  5JAY A;  3FVU A;  3EI5 A;  4K2I A;  4WYD A;  2CTZ A;  2W7K A;  3FZ6 A;  5DB5 A;  4CXQ A;  4RM1 A;  1TOG A;  3OKS A;  1B5O A;  2VGZ A;  4W91 A;  2HOX A;  1IUG A;  1AHE A;  3MC6 C;  1CS1 A;  3MAU A;  1OHY A;  3W1I A;  1GC0 A;  3K7Y A;  3WCN A;  1LC5 A;  2JJE A;  1ZC9 A;  2YCN A;  5G09 A;  2VMT A;  3P6K A;  4OC9 A;  1M0O A;  4JF1 A;  3DR7 A;  3NNK A;  4H51 A;  5FT6 A;  2FNU A;  3MKJ A;  4ISY A;  1IAX A;  4MQR A;  2G6W A;  3EI7 A;  1V2F A;  2E7I A;  2X8U A;  1YAA A;  4GE4 A;  1I29 A;  1ASN A;  4W8I A;  5K8B A;  2DOU A;  3L44 A;  2R0T A;  2HOY A;  4WBT A;  1W3U A;  1ZOD A;  3FFR A;  2HP2 A;  2GMU A;  4A0H A;  1G4X A;  1AMA A;  5M49 A;  2JJF A;  3FCR A;  3JW9 A;  1DJ9 A;  5EAV A;  4KYO A;  1JF9 A;  1BKG A;  2V1P A;  3I16 A;  2HOR A;  2VMP A;  1GDE A;  1XEY A;  1AKB A;  2DR1 A;  1O69 A;  1BQA A;  1IAY A;  2BYL A;  3NTJ A;  3G7Q A;  4DGT A;  3KE3 A;  4ZWV A;  3FDB A;  3TFT A;  5HXX A;  3QHX A;  2XBN A;  4WXG A;  5FT4 A;  4RJ0 A;  4IYO B;  5FT5 A;  4TMR A;  4ADD A;  3E2Z A;  4WYF A;  2C0R A;  2GQN A;  1W7M A;  3EI6 A;  3HT4 A;  1AKC A;  2BKW A;  1V2D A;  4XQ2 A;  3VK3 A;  2W8W A;  4MQP A;  1S06 A;  4IXS A;  4Q31 A;  1B9I A;  2YKU A;  3FRK A;  4BQ0 A;  1PMO A;  4RLG A;  1AJR A;  1AHY A;  3AOV A;  2R5C A;  4W1V A;  3NYS A;  2QA3 A;  4RKD A;  1C7N A;  2VGW A;  2PB0 A;  4Y0D A;  5M46 A;  3CQ5 A;  1JS6 A;  1WKG A;  3ACZ A;  4W1X A;  4WD2 A;  4Y0H A;  1D7U A;  2D61 A;  3NRA A;  2Z20 A;  5EUN A;  1X2A A;  3FVS A;  2JG2 A;  2EZ2 A;  3LVL B;  4EMY A;  2E7U A;  2VGU A;  1LC7 A;  4FFC A;  2CB1 A;  1PFF A;  4P7Y A;  3PD6 B;  4LW4 A;  2EZ1 A;  4WB0 B;  1ASE A;  2Z9X A;  2X5F A;  2D7Y A;  2EGY A;  3FTB A;  1T3I A;  3G8M A;  3ELP A;  1ZOB A;  5EQC A;  4EU1 A;  1QIR A;  2Z9V A;  3RQ1 A;  1M6S A;  2PB2 A;  2BWO A;  1M0Q A;  3PAA A;  3TCM A;  1BS0 A;  1Y4I A;  3JZL A;  4RJY A;  3WKR A;  3PJ0 A;  3AEL A;  1GC4 A;  2HUF A;  1JG8 A;  1S08 A;  5LHA A;  1M0P A;  4OYT A;  1CZE A;  2YCT A;  4CBR A;  1KKJ A;  2ZY3 A;  1O4S A;  2W8J A;  4CBS A;  1S07 A;  4CXR A;  1GEW A;  5EAA A;  3GZD A;  2ZSL A;  1BJO A;  1ARH A;  2YCP A;  5C6U A;  1LKC A;  1X0M A;  3EI9 A;  3AEM C;  2ORD A;  1AKA A;  2YKY A;  2YRI A;  3LY1 A;  2Z67 A;  1ARG A;  3GZC A;  4IY7 A;  5M4B A;  1AAW A;  3FQA A;  2O0R A;  4J8L A;  1MDO A;  3AEN A;  2ZSM A;  1CQ6 A;  3OP7 A;  5E3K A;  2BIG A;  1ARI A;  2HUU A;  1YIZ A;  2OGA A;  1ASD A;  2C44 A;  4B98 A;  1EJI A;  1AAM A;  1ELQ A;  1H1C A;  3QI6 A;  4WYG A;  4F5I A;  3FZ8 A;  3QGU A;  2VMU A;  5EFS A;  1O61 A;  4PIW A;  3E77 A;  4FL0 A;  4F5F A;  1BJ4 A;  1DJU A;  5LH9 A;  1SPA A;  3N5M A;  3MBB A;  5AX8 A;  2OAT A;  2DGK A;  4MGR A;  1ASL A;  2HUI A;  1AMS A;  2GB3 A;  4WLJ A;  1IX8 A;  3F6T A;  4W1W A;  1GCK A;  3BCB A;  4W5K A;  1W23 A;  2X5D A;  4RKC A;  5EUD A;  2ZY2 A;  3WGC A;  3DZZ A;  3VAX A;  3F9T A;  1Z7D A;  4Q76 A;  4WXB A;  1KMK A;  1CL2 A;  2OGE A;  2BI1 A;  4N0W A;  3QN6 A;  2QB3 A;  4Y0I A;  4ADC A;  4F5L A;  3DYD A;  2W7L A;  1AMQ A;  2BWN A;  1GEX A;  1BT4 A;  4E3Q A;  5DX5 A;  1DFO A;  1OHV A;  2VI8 A;  1J32 A;  2ZJG A;  3ELE A;  1SZK A;  1RV3 A;  3N0L A;  1RV4 A;  3I4J A;  4R5Z A;  1WYV A;  1N8P A;  3HMU A;  1D7S A;  8AAT A;  1IBJ A;  4MKJ A;  4UQV A;  4UOY A;  3GWP A;  3R4T A;  3LVK A;  1ASC A;  4Q6R A;  1LW5 A;  4ZSW A;  3HLM A;  2AY6 A;  3WY7 A;  3BCX A;  2AEV A;  2X3L A;  2YHK A;  2BIA A;  3AEJ C;  1TOJ A;  3I5T A;  3F0H A;  2WK7 A;  3PDX A;  4ZDP A;  3WCO A;  1B8G A;  4WB0 A;  4IYO A;  2AY9 A;  4OBU A;  2BI5 A;  2CH2 A;  1LK9 A;  2VMV A;  1AX4 A;  3WKS A;  1CJ0 A;  2VGT A;  5E4Z A;  3B46 A;  4XJP A;  3D6K A;  3NYU A;  1AMR A;  1QZ9 A;  1C9C A;  4JEW A;  3BCA A;  3B1D A;  1TOK A;  1EQB A;  1M32 A;  2E7J A;  2QMA A;  4AZK A;  4BA5 A;  1O62 A;  4F5H A;  4ATQ A;  3ZZJ A;  1AY8 A;  1YOO A;  4WP0 A;  1B5P A;  4DBC A;  4ATP A;  1EG5 A;  1LW4 A;  1TOI A;  2BHX A;  4F5G A;  5I92 A;  3JU7 A;  4A0F A;  5F9S A;  3FSL A;  3PGY A;  1W7N A;  2C7T A;  4M2K A;  2FYF A;  2Z9U A;  2HOZ A;  1SVV A;  2AY7 A;  2W7G A;  3ATH A;  3BN1 A;  3CQ4 A;  1X29 A;  1YIY A;  1WYU A;  1ART A;  3ZRR A;  3WGB A;  3KGX A;  2AY1 A;  3E9K A;  4HVK A;  5FT8 A;  1IVR A;  4BA4 A;  3FDD A;  3FVX A;  1DJE A;  4N0B A;  1WYT B;  4ITG A;  4WYE A;  7AAT A;  4DQ6 A;  4XJM A;  4PVF A;  2CJH A;  3LVM A;  2W7E A;  3MAF A;  3KKI A;  2HP1 A;  3CBF A;  2XH1 A;  3MEB A;  1QJ5 A;  1N31 A;  2RFV A;  3FD0 A;  2AAT A;  4K2B A;  3MAF B;  2DGL A;  4WYC A;  4E3R A;  5BJ4 A;  3B1C A;  3N75 A;  4GRX A;  1XI9 A;  1KMJ A;  4JE5 D;  4K2M A;  2CH1 A;  3AEJ A;  1B9H A;  2ZC0 A;  4P3M A;  4QGR A;  4MY5 A;  1ORD A;  1WYV B;  2QLR A;  4XJO A;  5G4J A;  1BQD A;  3NU8 A;  2FQ6 A;  4OBV A;  2R5C B;  4J5U A;  1G4V A;  3K40 A;  3E2Y A;  2VMQ A;  4A00 A;  2OQX A;  2O1B A;  3DXW A;  4ZM4 A;  3TAT A;  2FM1 A;  2TPL A;  3DU4 A;  2AEU A;  1SF2 A;  3PDB A;  1D2F A;  3HVY A;  5IWQ A;  2OKJ A;  3AEM A;  2QB2 A;  1AJS B;  3BB8 A;  3WLX A;  2W7I A;  1DKA A;  1PMM A;  4A0R A;  1LC8 A;  2O7C A;  4XEW A;  2WKA A;  2ZP7 A;  3BS8 A;  1SFF A;  3NUI A;  2YRR A;  3FQ8 A;  4ZAS A;  1IX6 A;  3RI6 A;  3CAI A;  4BMK A;  4LW2 A;  1MDZ A;  3UWC A;  2BI3 A;  3IF2 A;  3PIU A;  4JF0 A;  3A9Z A;  3ZRP A;  1YJS A;  2ZYJ A;  1DGD A;  3MC6 A;  1BJW A;  1B4X A;  3NX3 A;  4ITX A;  4XAU A;  3ASB A;  3BWN C;  4TV7 A;  4AZJ A;  4CVQ A;  3H14 A;  3DRD A;  4JEV A;  4U2H A;  3HQT A;  3VOM A;  3II0 A;  3T32 A;  2PO3 A;  5EIG B;  4EB7 A;  2Z61 A;  1AY5 A;  1CQ7 A;  1CQ8 A;  2Z9W A;  3GBX A;  3AV7 A;  1LS3 A;  1D7V A;  3BC8 A;  3BWO A;  3FZ7 A;  1M4N A;  2W7J A;  1CZC A;  1Z3Z A;  3L8A A;  2W7H A;  1MLY A;  2VMZ A;  2W7F A;  1G7X A;  4NOG A;  1GC2 A;  4LNM A;  4M2J A;  4AH3 A;  1YJZ A;  4WLH A;  2CJG A;  3AEP A;  3E6G A;  2CIN A;  1MLZ A;  3IHJ A;  4A72 A;  1IJI A;  4PFN A;  1GC3 A;  3NU7 A;  1V2E A;  3GZD C;  5G2Q A;  2AY2 A;  4AO4 A;  1MDX A;  2AY3 A;  3E2Z B;  3JWA A;  1QGN A;  1VJO A;  2VLF A;  2VIA A;  1ECX A;  2W8T A;  1AIA A;  3M5U A;  4OMA A;  2FNI A;  2VYC A;  1E5F A;  1UU0 A;  3LV2 A;  2F8J A;  2VMN A;  4BHD A;  3USF A;  1FG3 A;  4ZLV A;  3DC1 A;  3LVJ A;  4ZM3 A;  1AHX A;  1GBN A;  2YOB A;  4E77 A;  4ADB A;  4GEB A;  4A0G A;  5G2P A;  4JE5 A;  1VEF A;  2VI9 A;  4ZWM A;  1TAT A;  1ELU A;  3RBL A;  2VMO A;  2VMR A;  4GE7 A;  3HDO A;  1UU2 A;  3MAD A;  4JEX A;  1BJN A;  1ASA A;  3AOW A;  3DXV A;  4UHO A;  4KXK A;  5EIG A;  1V72 A;  1WYU B;  4RIT A;  5D95 A;  3UE8 A;  3ZRQ A;  4A6T A;  5G0A A;  2EO5 A;  4A6R A;  1C7G A;  4R8D A;  2VLH A;  1TAS A;  2ZUK A;  1WKH A;  3RBF A;  1OHW A;  3BV0 A;  3HBX A;  2D64 A;  1SZU A;  4O6Z A;  1GEY A;  3Q8N A;  1H0C A;  3TFU A;  1FG7 A;  4ZSY A;  2VGV A;  5G4I A;  4IXO A;  3TQX A;  3AAT A;  4OTL A;  3RCH B;  2ZY4 A;  2Z1Y A;  4XK1 A;  5DJ1 A;  3JWB A;  3ISL A;  1C7O A;  1AHF A;  2W7D A;  3QPG A;  2EH6 A;  1S09 A;  1AJS A;  4U1T A;  4XJL A;  4KAM A;  1X28 A;  1DTY A;  3DOD A;  2R2N A;  4ZDO A;  4LC3 A;  4AO9 A;  3NDN A;  2GSA A;  2W8U A;  4EB5 A;  2AY5 A;  1AIC A;  2D7Z A;  3K28 A;  3EZS A;  5BJ3 A;  4ZAH A;  1S0A A;  4GE9 A;  2R5E A;  5F8V A;  2BYJ A;  3EI8 A;  4Q75 A;  4MSO A;  5D5S A;  3W1J A;  2QBT A;  2BI2 A;  3HL2 A;  3EIA A;  1G7W A;  1WYT A;  2Q7W A;  4MQQ A;  4OT8 A;  4F5M A;  3PD6 A;  4PFF A;  2FN6 A;  1MAQ A;  3GJU A;  5EUE A;  4EFF A;  2Z1Z A;  3ZZK A;  1YJY A;  4B9B A;  1PG8 A;  3ECD A;  3FFH A;  5E5I A;  2D66 A;  9AAT A;  2CST A;  1QJ3 A;  3FQ7 A;  1RVU A;  4A6U A;  1ASM A;  1BJO B;  1E5E A;  2AY8 A;  1VP4 A;  1OXO A;  4L0O A;  5J8Q A;  1RVY A;  3COG A;  3NYT A;  2D65 A;  3UAK A;  2ZY5 A;  2GMS A;  4ADE A;  2VMX A;  1J04 A;  1W7L A;  3RCH A;  1AIB A;  4TN4 A;  3AEN B;  3FKD A;  1QIT A;  2VMY A;  3JTX A;  4IX8 A;  2W7M A;  1KKP A;  1FC4 A;  3LG0 A;  5M4D A;  4IW7 A;  2W8V A;  2C81 A;  1CL1 A;  1N2T A;  1TOE A;  3A9X A;  3PDB B;  3H7F A;  1DGE A;  2D5Y A;  3CQ6 A; 
#chains in the Genus database with same CATH topology
 2CFB A;  3B8X A;  3RUY A;  2OKK A;  1QIS A;  2VGS A;  1MGV A;  4MKK A;  2WK8 A;  4F5J A;  5HDM A;  4RIZ A;  3A9Y A;  1YNU A;  2YKV A;  3EUC A;  4I8A A;  1M0N A;  3EZ1 A;  3N7N A;  1U08 A;  2DKB A;  2DKJ A;  1KL1 A;  2VMW A;  3WX9 A;  2WK9 A;  3GR9 A;  1AY4 A;  4JEY A;  4M2M A;  1KL2 A;  3E2F A;  4WYA A;  4LNL A;  4WXF A;  3VK4 A;  4ZDL A;  5HHY A;  4F4E A;  1OXP A;  3ASA A;  3BWN A;  3R9A A;  1I43 A;  2V0Y A;  3PA9 A;  2VMS A;  2NMP A;  2JIS A;  1ARS A;  3GET A;  3QBO A;  3QM2 A;  3GSB A;  5TF5 A;  1ASB A;  1M7Y A;  1C4K A;  2CAN A;  3PPL A;  4R5F A;  1I48 A;  4GSA A;  2CJD A;  2HZP A;  3A2B A;  3LWS A;  3VP6 A;  4AOA A;  1JS3 A;  1C0N A;  1UU1 A;  4UHN A;  4IXZ A;  3VK2 A;  2D63 A;  1OAT A;  2BWP A;  1P3W A;  1UKJ A;  1BW0 A;  1AHG A;  3B1E A;  1ASF A;  4R2N A;  1TAR A;  1TPL A;  2CY8 A;  1GD9 A;  1IX7 A;  1D7R A;  4HF8 A;  2E54 A;  3NUB A;  4RAE A;  3W1H A;  2DGM A;  2EPJ A;  4E1O A;  2BIE A;  2JJH A;  3WZF A;  3H9X A;  1SZS A;  5DJ9 A;  2YKX A;  3G0T A;  3P1T A;  4GDY A;  3AEO A;  3KGW A;  1WST A;  3EIB A;  3DR4 A;  1I41 A;  3A8U X;  2BI9 A;  1MAP A;  2JGT A;  2JJG A;  1ASG A;  4UHM A;  2AY4 A;  4JEZ A;  4F5K A;  4LNJ A;  2VIB A;  4OCA A;  5JAY A;  3FVU A;  3EI5 A;  4K2I A;  4WYD A;  2CTZ A;  2W7K A;  3FZ6 A;  5DB5 A;  4CXQ A;  4RM1 A;  1TOG A;  3OKS A;  1B5O A;  2VGZ A;  4W91 A;  2HOX A;  1IUG A;  1AHE A;  3MC6 C;  1CS1 A;  3MAU A;  1OHY A;  3W1I A;  1GC0 A;  3K7Y A;  3WCN A;  1LC5 A;  2JJE A;  1ZC9 A;  2YCN A;  5G09 A;  2VMT A;  3P6K A;  4OC9 A;  1M0O A;  4JF1 A;  3DR7 A;  3NNK A;  4H51 A;  5FT6 A;  2FNU A;  3MKJ A;  4ISY A;  1IAX A;  4MQR A;  2G6W A;  3EI7 A;  1V2F A;  2E7I A;  2X8U A;  1YAA A;  4GE4 A;  1I29 A;  1ASN A;  4W8I A;  5K8B A;  2DOU A;  3L44 A;  2R0T A;  2HOY A;  4WBT A;  1W3U A;  3N4X A;  1ZOD A;  3FFR A;  2HP2 A;  2GMU A;  4A0H A;  1G4X A;  1AMA A;  5M49 A;  2JJF A;  3FCR A;  3JW9 A;  1DJ9 A;  5EAV A;  4KYO A;  1JF9 A;  1BKG A;  2V1P A;  3I16 A;  2HOR A;  2VMP A;  1GDE A;  1XEY A;  1AKB A;  2DR1 A;  1O69 A;  1BQA A;  1IAY A;  2BYL A;  3NTJ A;  3G7Q A;  4DGT A;  3KE3 A;  4ZWV A;  3FDB A;  3TFT A;  2A1V A;  5HXX A;  3QHX A;  2XBN A;  4WXG A;  5FT4 A;  4RJ0 A;  4IYO B;  5FT5 A;  4TMR A;  4ADD A;  3E2Z A;  4WYF A;  2C0R A;  2GQN A;  1W7M A;  3EI6 A;  3HT4 A;  1AKC A;  2BKW A;  1V2D A;  4XQ2 A;  3VK3 A;  2W8W A;  4MQP A;  1S06 A;  4IXS A;  4Q31 A;  4K05 A;  1B9I A;  2YKU A;  3FRK A;  4BQ0 A;  1PMO A;  4RLG A;  1AJR A;  1AHY A;  3AOV A;  2R5C A;  4W1V A;  3NYS A;  2QA3 A;  4RKD A;  1C7N A;  2VGW A;  2PB0 A;  4Y0D A;  5M46 A;  3CQ5 A;  1JS6 A;  1WKG A;  3ACZ A;  4W1X A;  4WD2 A;  4Y0H A;  1D7U A;  2D61 A;  3NRA A;  2Z20 A;  5EUN A;  1X2A A;  3FVS A;  2JG2 A;  2EZ2 A;  3LVL B;  4EMY A;  2E7U A;  2VGU A;  1LC7 A;  4FFC A;  2CB1 A;  1PFF A;  4P7Y A;  3PD6 B;  4LW4 A;  2EZ1 A;  4WB0 B;  1ASE A;  2Z9X A;  2X5F A;  2D7Y A;  2EGY A;  3FTB A;  1T3I A;  3G8M A;  3ELP A;  1ZOB A;  5EQC A;  4EU1 A;  1QIR A;  2KFP A;  2Z9V A;  3RQ1 A;  1M6S A;  2PB2 A;  2BWO A;  1M0Q A;  3PAA A;  3TCM A;  1BS0 A;  1Y4I A;  3JZL A;  4RJY A;  3WKR A;  3PJ0 A;  3AEL A;  1GC4 A;  2HUF A;  1JG8 A;  1S08 A;  5LHA A;  1M0P A;  4OYT A;  1CZE A;  2YCT A;  4CBR A;  1KKJ A;  2ZY3 A;  1O4S A;  2W8J A;  4CBS A;  1S07 A;  4CXR A;  1GEW A;  5EAA A;  3GZD A;  2ZSL A;  1BJO A;  1ARH A;  2YCP A;  5C6U A;  1LKC A;  1X0M A;  3EI9 A;  3AEM C;  2ORD A;  1AKA A;  2YKY A;  2YRI A;  3LY1 A;  2Z67 A;  1ARG A;  3GZC A;  4IY7 A;  5M4B A;  1AAW A;  3FQA A;  2O0R A;  4J8L A;  1MDO A;  3AEN A;  2ZSM A;  1CQ6 A;  3OP7 A;  5E3K A;  2BIG A;  1ARI A;  2HUU A;  1YIZ A;  2OGA A;  1ASD A;  2C44 A;  4B98 A;  1EJI A;  1AAM A;  1ELQ A;  1H1C A;  3QI6 A;  4WYG A;  4F5I A;  3FZ8 A;  3QGU A;  2VMU A;  5EFS A;  1O61 A;  4PIW A;  3E77 A;  4FL0 A;  4F5F A;  1BJ4 A;  1DJU A;  5LH9 A;  1SPA A;  3N5M A;  3MBB A;  2G7J A;  5AX8 A;  2OAT A;  2DGK A;  4MGR A;  1ASL A;  2HUI A;  1AMS A;  2GB3 A;  4WLJ A;  1IX8 A;  3F6T A;  4W1W A;  1GCK A;  3BCB A;  4W5K A;  1W23 A;  2X5D A;  4RKC A;  5EUD A;  2ZY2 A;  3WGC A;  3DZZ A;  3VAX A;  3F9T A;  1Z7D A;  4Q76 A;  4WXB A;  1KMK A;  1CL2 A;  2OGE A;  2BI1 A;  4N0W A;  3QN6 A;  2QB3 A;  4Y0I A;  4ADC A;  4F5L A;  3DYD A;  2W7L A;  1AMQ A;  2BWN A;  1GEX A;  1BT4 A;  4E3Q A;  5DX5 A;  1DFO A;  1OHV A;  2VI8 A;  1J32 A;  2ZJG A;  3ELE A;  1SZK A;  1RV3 A;  1KAF A;  3N0L A;  1RV4 A;  3I4J A;  4R5Z A;  1WYV A;  1N8P A;  3HMU A;  1D7S A;  8AAT A;  1IBJ A;  4MKJ A;  4UQV A;  4UOY A;  3GWP A;  3R4T A;  3LVK A;  1ASC A;  4Q6R A;  1LW5 A;  4ZSW A;  3HLM A;  2AY6 A;  3WY7 A;  3BCX A;  2AEV A;  2X3L A;  2YHK A;  2BIA A;  3AEJ C;  1TOJ A;  3I5T A;  3F0H A;  2WK7 A;  3PDX A;  4ZDP A;  3WCO A;  1B8G A;  4WB0 A;  4IYO A;  2AY9 A;  4OBU A;  2BI5 A;  2CH2 A;  1LK9 A;  2VMV A;  1AX4 A;  3WKS A;  1CJ0 A;  2VGT A;  5E4Z A;  3B46 A;  4XJP A;  3D6K A;  3NYU A;  1AMR A;  1QZ9 A;  1C9C A;  4JEW A;  3BCA A;  3B1D A;  1TOK A;  1EQB A;  1M32 A;  2E7J A;  5KTB A;  2QMA A;  4AZK A;  4BA5 A;  1O62 A;  4F5H A;  4ATQ A;  3ZZJ A;  1AY8 A;  1YOO A;  4WP0 A;  1B5P A;  4DBC A;  4ATP A;  1EG5 A;  1LW4 A;  1TOI A;  2BHX A;  4F5G A;  5I92 A;  3JU7 A;  4A0F A;  5F9S A;  3FSL A;  3PGY A;  1W7N A;  2C7T A;  4M2K A;  2FYF A;  2Z9U A;  2HOZ A;  1SVV A;  2AY7 A;  2W7G A;  3ATH A;  3BN1 A;  3CQ4 A;  1X29 A;  1YIY A;  1WYU A;  1ART A;  3ZRR A;  3WGB A;  3KGX A;  2AY1 A;  3E9K A;  4HVK A;  5FT8 A;  1IVR A;  4BA4 A;  3FDD A;  3FVX A;  1DJE A;  4N0B A;  1WYT B;  4ITG A;  4WYE A;  7AAT A;  4DQ6 A;  4XJM A;  4PVF A;  2CJH A;  3LVM A;  2W7E A;  3MAF A;  3KKI A;  2HP1 A;  3CBF A;  2XH1 A;  3MEB A;  1QJ5 A;  1N31 A;  2RFV A;  3FD0 A;  2AAT A;  4K2B A;  3MAF B;  2DGL A;  4WYC A;  4E3R A;  5BJ4 A;  3B1C A;  3N75 A;  4GRX A;  1XI9 A;  1KMJ A;  4JE5 D;  4K2M A;  2CH1 A;  3AEJ A;  1B9H A;  2ZC0 A;  4P3M A;  4QGR A;  4MY5 A;  1ORD A;  1WYV B;  2QLR A;  4XJO A;  5G4J A;  1BQD A;  3NU8 A;  2FQ6 A;  4OBV A;  2R5C B;  4J5U A;  1G4V A;  3K40 A;  3E2Y A;  2QSR A;  2VMQ A;  4A00 A;  2OQX A;  2O1B A;  3DXW A;  2WB6 A;  4ZM4 A;  3TAT A;  2FM1 A;  2TPL A;  3DU4 A;  2AEU A;  1SF2 A;  3PDB A;  1D2F A;  3HVY A;  5IWQ A;  2OKJ A;  3AEM A;  2QB2 A;  1AJS B;  3BB8 A;  3WLX A;  2W7I A;  1DKA A;  1PMM A;  4A0R A;  1LC8 A;  2O7C A;  4XEW A;  2WKA A;  2ZP7 A;  3BS8 A;  1SFF A;  3NUI A;  2YRR A;  3FQ8 A;  4ZAS A;  1IX6 A;  3RI6 A;  3CAI A;  4BMK A;  4LW2 A;  1MDZ A;  3UWC A;  2BI3 A;  3IF2 A;  3PIU A;  4JF0 A;  3A9Z A;  3ZRP A;  1YJS A;  2ZYJ A;  1DGD A;  3MC6 A;  1BJW A;  1B4X A;  3NX3 A;  4ITX A;  4XAU A;  3ASB A;  3BWN C;  4TV7 A;  4AZJ A;  4CVQ A;  3H14 A;  3DRD A;  4JEV A;  4U2H A;  3HQT A;  3VOM A;  3II0 A;  3T32 A;  2PO3 A;  5EIG B;  4EB7 A;  2Z61 A;  1AY5 A;  1CQ7 A;  1CQ8 A;  2Z9W A;  3GBX A;  3AV7 A;  1LS3 A;  1D7V A;  3BC8 A;  3BWO A;  3FZ7 A;  1M4N A;  2W7J A;  1CZC A;  1Z3Z A;  3L8A A;  2W7H A;  1MLY A;  2VMZ A;  2W7F A;  1G7X A;  4NOG A;  1GC2 A;  4LNM A;  4M2J A;  4AH3 A;  1YJZ A;  4WLH A;  2CJG A;  3AEP A;  3E6G A;  2CIN A;  1MLZ A;  3IHJ A;  4A72 A;  1IJI A;  4PFN A;  1GC3 A;  3NU7 A;  1V2E A;  3GZD C;  5G2Q A;  2AY2 A;  4AO4 A;  1MDX A;  2AY3 A;  3E2Z B;  3JWA A;  1QGN A;  1VJO A;  2VLF A;  2VIA A;  1ECX A;  2W8T A;  1AIA A;  3M5U A;  4OMA A;  2FNI A;  2VYC A;  1E5F A;  1UU0 A;  3LV2 A;  3N4S A;  2F8J A;  2VMN A;  4BHD A;  3USF A;  1FG3 A;  4ZLV A;  3DC1 A;  3LVJ A;  4ZM3 A;  1AHX A;  1GBN A;  2YOB A;  4E77 A;  4ADB A;  4GEB A;  4A0G A;  5G2P A;  4JE5 A;  1VEF A;  2VI9 A;  4ZWM A;  1TAT A;  1ELU A;  3RBL A;  2VMO A;  2VMR A;  4GE7 A;  3HDO A;  1UU2 A;  3MAD A;  4JEX A;  1BJN A;  1ASA A;  3AOW A;  3DXV A;  4UHO A;  4KXK A;  5EIG A;  1V72 A;  1WYU B;  4RIT A;  5D95 A;  3UE8 A;  3ZRQ A;  4A6T A;  5G0A A;  2EO5 A;  4A6R A;  1C7G A;  4R8D A;  2VLH A;  1TAS A;  2ZUK A;  1WKH A;  3RBF A;  1OHW A;  3BV0 A;  3HBX A;  2D64 A;  1SZU A;  4O6Z A;  1GEY A;  3Q8N A;  1H0C A;  3TFU A;  1FG7 A;  4ZSY A;  2EYQ A;  2VGV A;  5G4I A;  4IXO A;  3TQX A;  3AAT A;  4OTL A;  3RCH B;  2ZY4 A;  2Z1Y A;  4XK1 A;  5DJ1 A;  3JWB A;  3ISL A;  1C7O A;  1AHF A;  2W7D A;  3QPG A;  2EH6 A;  4H63 Q;  1S09 A;  1AJS A;  4U1T A;  4XJL A;  4KAM A;  1X28 A;  1DTY A;  3DOD A;  2R2N A;  4ZDO A;  4LC3 A;  2FKI A;  4AO9 A;  3NDN A;  2GSA A;  2W8U A;  4EB5 A;  2AY5 A;  1AIC A;  2D7Z A;  3K28 A;  3EZS A;  5BJ3 A;  4ZAH A;  1S0A A;  4GE9 A;  2R5E A;  5F8V A;  2BYJ A;  3EI8 A;  4Q75 A;  4MSO A;  5D5S A;  3W1J A;  2QBT A;  2BI2 A;  3HL2 A;  3EIA A;  1G7W A;  1WYT A;  2Q7W A;  4MQQ A;  4OT8 A;  4F5M A;  3PD6 A;  4PFF A;  2FN6 A;  1MAQ A;  3GJU A;  5EUE A;  4EFF A;  2Z1Z A;  3ZZK A;  1YJY A;  4B9B A;  1PG8 A;  3ECD A;  3FFH A;  5E5I A;  2D66 A;  9AAT A;  3N4R A;  2CST A;  1QJ3 A;  3FQ7 A;  1RVU A;  4A6U A;  1ASM A;  1BJO B;  1E5E A;  2AY8 A;  1VP4 A;  1OXO A;  4L0O A;  5J8Q A;  1RVY A;  3COG A;  3NYT A;  2D65 A;  3UAK A;  2ZY5 A;  2GMS A;  4ADE A;  2VMX A;  1J04 A;  1W7L A;  3RCH A;  1AIB A;  4TN4 A;  3AEN B;  3FKD A;  1QIT A;  2VMY A;  3JTX A;  4IX8 A;  2W7M A;  1KKP A;  1FC4 A;  3LG0 A;  5M4D A;  4IW7 A;  2W8V A;  2C81 A;  1CL1 A;  1N2T A;  1TOE A;  3A9X A;  3PDB B;  3H7F A;  1DGE A;  2D5Y A;  3CQ6 A; 
#chains in the Genus database with same CATH homology
 2CFB A;  3B8X A;  3RUY A;  2OKK A;  1QIS A;  2VGS A;  1MGV A;  4MKK A;  2WK8 A;  4F5J A;  5HDM A;  4RIZ A;  3A9Y A;  1YNU A;  2YKV A;  3EUC A;  4I8A A;  1M0N A;  3EZ1 A;  3N7N A;  1U08 A;  2DKB A;  2DKJ A;  1KL1 A;  2VMW A;  3WX9 A;  2WK9 A;  3GR9 A;  1AY4 A;  4JEY A;  4M2M A;  1KL2 A;  3E2F A;  4WYA A;  4LNL A;  4WXF A;  3VK4 A;  4ZDL A;  5HHY A;  4F4E A;  1OXP A;  3ASA A;  3BWN A;  3R9A A;  1I43 A;  2V0Y A;  3PA9 A;  2VMS A;  2NMP A;  2JIS A;  1ARS A;  3GET A;  3QBO A;  3QM2 A;  3GSB A;  5TF5 A;  1ASB A;  1M7Y A;  1C4K A;  2CAN A;  3PPL A;  4R5F A;  1I48 A;  4GSA A;  2CJD A;  2HZP A;  3A2B A;  3LWS A;  3VP6 A;  4AOA A;  1JS3 A;  1C0N A;  1UU1 A;  4UHN A;  4IXZ A;  3VK2 A;  2D63 A;  1OAT A;  2BWP A;  1P3W A;  1UKJ A;  1BW0 A;  1AHG A;  3B1E A;  1ASF A;  4R2N A;  1TAR A;  1TPL A;  2CY8 A;  1GD9 A;  1IX7 A;  1D7R A;  4HF8 A;  2E54 A;  3NUB A;  4RAE A;  3W1H A;  2DGM A;  2EPJ A;  4E1O A;  2BIE A;  2JJH A;  3WZF A;  3H9X A;  1SZS A;  5DJ9 A;  2YKX A;  3G0T A;  3P1T A;  4GDY A;  3AEO A;  3KGW A;  1WST A;  3EIB A;  3DR4 A;  1I41 A;  3A8U X;  2BI9 A;  1MAP A;  2JGT A;  2JJG A;  1ASG A;  4UHM A;  2AY4 A;  4JEZ A;  4F5K A;  4LNJ A;  2VIB A;  4OCA A;  5JAY A;  3FVU A;  3EI5 A;  4K2I A;  4WYD A;  2CTZ A;  2W7K A;  3FZ6 A;  5DB5 A;  4CXQ A;  4RM1 A;  1TOG A;  3OKS A;  1B5O A;  2VGZ A;  4W91 A;  2HOX A;  1IUG A;  1AHE A;  3MC6 C;  1CS1 A;  3MAU A;  1OHY A;  3W1I A;  1GC0 A;  3K7Y A;  3WCN A;  1LC5 A;  2JJE A;  1ZC9 A;  2YCN A;  5G09 A;  2VMT A;  3P6K A;  4OC9 A;  1M0O A;  4JF1 A;  3DR7 A;  3NNK A;  4H51 A;  5FT6 A;  2FNU A;  3MKJ A;  4ISY A;  1IAX A;  4MQR A;  2G6W A;  3EI7 A;  1V2F A;  2E7I A;  2X8U A;  1YAA A;  4GE4 A;  1I29 A;  1ASN A;  4W8I A;  5K8B A;  2DOU A;  3L44 A;  2R0T A;  2HOY A;  4WBT A;  1W3U A;  3N4X A;  1ZOD A;  3FFR A;  2HP2 A;  2GMU A;  4A0H A;  1G4X A;  1AMA A;  5M49 A;  2JJF A;  3FCR A;  3JW9 A;  1DJ9 A;  5EAV A;  4KYO A;  1JF9 A;  1BKG A;  2V1P A;  3I16 A;  2HOR A;  2VMP A;  1GDE A;  1XEY A;  1AKB A;  2DR1 A;  1O69 A;  1BQA A;  1IAY A;  2BYL A;  3NTJ A;  3G7Q A;  4DGT A;  3KE3 A;  4ZWV A;  3FDB A;  3TFT A;  2A1V A;  5HXX A;  3QHX A;  2XBN A;  4WXG A;  5FT4 A;  4RJ0 A;  4IYO B;  5FT5 A;  4TMR A;  4ADD A;  3E2Z A;  4WYF A;  2C0R A;  2GQN A;  1W7M A;  3EI6 A;  3HT4 A;  1AKC A;  2BKW A;  1V2D A;  4XQ2 A;  3VK3 A;  2W8W A;  4MQP A;  1S06 A;  4IXS A;  4Q31 A;  4K05 A;  1B9I A;  2YKU A;  3FRK A;  4BQ0 A;  1PMO A;  4RLG A;  1AJR A;  1AHY A;  3AOV A;  2R5C A;  4W1V A;  3NYS A;  2QA3 A;  4RKD A;  1C7N A;  2VGW A;  2PB0 A;  4Y0D A;  5M46 A;  3CQ5 A;  1JS6 A;  1WKG A;  3ACZ A;  4W1X A;  4WD2 A;  4Y0H A;  1D7U A;  2D61 A;  3NRA A;  2Z20 A;  5EUN A;  1X2A A;  3FVS A;  2JG2 A;  2EZ2 A;  3LVL B;  4EMY A;  2E7U A;  2VGU A;  1LC7 A;  4FFC A;  2CB1 A;  1PFF A;  4P7Y A;  3PD6 B;  4LW4 A;  2EZ1 A;  4WB0 B;  1ASE A;  2Z9X A;  2X5F A;  2D7Y A;  2EGY A;  3FTB A;  1T3I A;  3G8M A;  3ELP A;  1ZOB A;  5EQC A;  4EU1 A;  1QIR A;  2KFP A;  2Z9V A;  3RQ1 A;  1M6S A;  2PB2 A;  2BWO A;  1M0Q A;  3PAA A;  3TCM A;  1BS0 A;  1Y4I A;  3JZL A;  4RJY A;  3WKR A;  3PJ0 A;  3AEL A;  1GC4 A;  2HUF A;  1JG8 A;  1S08 A;  5LHA A;  1M0P A;  4OYT A;  1CZE A;  2YCT A;  4CBR A;  1KKJ A;  2ZY3 A;  1O4S A;  2W8J A;  4CBS A;  1S07 A;  4CXR A;  1GEW A;  5EAA A;  3GZD A;  2ZSL A;  1BJO A;  1ARH A;  2YCP A;  5C6U A;  1LKC A;  1X0M A;  3EI9 A;  3AEM C;  2ORD A;  1AKA A;  2YKY A;  2YRI A;  3LY1 A;  2Z67 A;  1ARG A;  3GZC A;  4IY7 A;  5M4B A;  1AAW A;  3FQA A;  2O0R A;  4J8L A;  1MDO A;  3AEN A;  2ZSM A;  1CQ6 A;  3OP7 A;  5E3K A;  2BIG A;  1ARI A;  2HUU A;  1YIZ A;  2OGA A;  1ASD A;  2C44 A;  4B98 A;  1EJI A;  1AAM A;  1ELQ A;  1H1C A;  3QI6 A;  4WYG A;  4F5I A;  3FZ8 A;  3QGU A;  2VMU A;  5EFS A;  1O61 A;  4PIW A;  3E77 A;  4FL0 A;  4F5F A;  1BJ4 A;  1DJU A;  5LH9 A;  1SPA A;  3N5M A;  3MBB A;  2G7J A;  5AX8 A;  2OAT A;  2DGK A;  4MGR A;  1ASL A;  2HUI A;  1AMS A;  2GB3 A;  4WLJ A;  1IX8 A;  3F6T A;  4W1W A;  1GCK A;  3BCB A;  4W5K A;  1W23 A;  2X5D A;  4RKC A;  5EUD A;  2ZY2 A;  3WGC A;  3DZZ A;  3VAX A;  3F9T A;  1Z7D A;  4Q76 A;  4WXB A;  1KMK A;  1CL2 A;  2OGE A;  2BI1 A;  4N0W A;  3QN6 A;  2QB3 A;  4Y0I A;  4ADC A;  4F5L A;  3DYD A;  2W7L A;  1AMQ A;  2BWN A;  1GEX A;  1BT4 A;  4E3Q A;  5DX5 A;  1DFO A;  1OHV A;  2VI8 A;  1J32 A;  2ZJG A;  3ELE A;  1SZK A;  1RV3 A;  3N0L A;  1RV4 A;  3I4J A;  4R5Z A;  1WYV A;  1N8P A;  3HMU A;  1D7S A;  8AAT A;  1IBJ A;  4MKJ A;  4UQV A;  4UOY A;  3GWP A;  3R4T A;  3LVK A;  1ASC A;  4Q6R A;  1LW5 A;  4ZSW A;  3HLM A;  2AY6 A;  3WY7 A;  3BCX A;  2AEV A;  2X3L A;  2YHK A;  2BIA A;  3AEJ C;  1TOJ A;  3I5T A;  3F0H A;  2WK7 A;  3PDX A;  4ZDP A;  3WCO A;  1B8G A;  4WB0 A;  4IYO A;  2AY9 A;  4OBU A;  2BI5 A;  2CH2 A;  1LK9 A;  2VMV A;  1AX4 A;  3WKS A;  1CJ0 A;  2VGT A;  5E4Z A;  3B46 A;  4XJP A;  3D6K A;  3NYU A;  1AMR A;  1QZ9 A;  1C9C A;  4JEW A;  3BCA A;  3B1D A;  1TOK A;  1EQB A;  1M32 A;  2E7J A;  5KTB A;  2QMA A;  4AZK A;  4BA5 A;  1O62 A;  4F5H A;  4ATQ A;  3ZZJ A;  1AY8 A;  1YOO A;  4WP0 A;  1B5P A;  4DBC A;  4ATP A;  1EG5 A;  1LW4 A;  1TOI A;  2BHX A;  4F5G A;  5I92 A;  3JU7 A;  4A0F A;  5F9S A;  3FSL A;  3PGY A;  1W7N A;  2C7T A;  4M2K A;  2FYF A;  2Z9U A;  2HOZ A;  1SVV A;  2AY7 A;  2W7G A;  3ATH A;  3BN1 A;  3CQ4 A;  1X29 A;  1YIY A;  1WYU A;  1ART A;  3ZRR A;  3WGB A;  3KGX A;  2AY1 A;  3E9K A;  4HVK A;  5FT8 A;  1IVR A;  4BA4 A;  3FDD A;  3FVX A;  1DJE A;  4N0B A;  1WYT B;  4ITG A;  4WYE A;  7AAT A;  4DQ6 A;  4XJM A;  4PVF A;  2CJH A;  3LVM A;  2W7E A;  3MAF A;  3KKI A;  2HP1 A;  3CBF A;  2XH1 A;  3MEB A;  1QJ5 A;  1N31 A;  2RFV A;  3FD0 A;  2AAT A;  4K2B A;  3MAF B;  2DGL A;  4WYC A;  4E3R A;  5BJ4 A;  3B1C A;  3N75 A;  4GRX A;  1XI9 A;  1KMJ A;  4JE5 D;  4K2M A;  2CH1 A;  3AEJ A;  1B9H A;  2ZC0 A;  4P3M A;  4QGR A;  4MY5 A;  1ORD A;  1WYV B;  2QLR A;  4XJO A;  5G4J A;  1BQD A;  3NU8 A;  2FQ6 A;  4OBV A;  2R5C B;  4J5U A;  1G4V A;  3K40 A;  3E2Y A;  2QSR A;  2VMQ A;  4A00 A;  2OQX A;  2O1B A;  3DXW A;  2WB6 A;  4ZM4 A;  3TAT A;  2FM1 A;  2TPL A;  3DU4 A;  2AEU A;  1SF2 A;  3PDB A;  1D2F A;  3HVY A;  5IWQ A;  2OKJ A;  3AEM A;  2QB2 A;  1AJS B;  3BB8 A;  3WLX A;  2W7I A;  1DKA A;  1PMM A;  4A0R A;  1LC8 A;  2O7C A;  4XEW A;  2WKA A;  2ZP7 A;  3BS8 A;  1SFF A;  3NUI A;  2YRR A;  3FQ8 A;  4ZAS A;  1IX6 A;  3RI6 A;  3CAI A;  4BMK A;  4LW2 A;  1MDZ A;  3UWC A;  2BI3 A;  3IF2 A;  3PIU A;  4JF0 A;  3A9Z A;  3ZRP A;  1YJS A;  2ZYJ A;  1DGD A;  3MC6 A;  1BJW A;  1B4X A;  3NX3 A;  4ITX A;  4XAU A;  3ASB A;  3BWN C;  4TV7 A;  4AZJ A;  4CVQ A;  3H14 A;  3DRD A;  4JEV A;  4U2H A;  3HQT A;  3VOM A;  3II0 A;  3T32 A;  2PO3 A;  5EIG B;  4EB7 A;  2Z61 A;  1AY5 A;  1CQ7 A;  1CQ8 A;  2Z9W A;  3GBX A;  3AV7 A;  1LS3 A;  1D7V A;  3BC8 A;  3BWO A;  3FZ7 A;  1M4N A;  2W7J A;  1CZC A;  1Z3Z A;  3L8A A;  2W7H A;  1MLY A;  2VMZ A;  2W7F A;  1G7X A;  4NOG A;  1GC2 A;  4LNM A;  4M2J A;  4AH3 A;  1YJZ A;  4WLH A;  2CJG A;  3AEP A;  3E6G A;  2CIN A;  1MLZ A;  3IHJ A;  4A72 A;  1IJI A;  4PFN A;  1GC3 A;  3NU7 A;  1V2E A;  3GZD C;  5G2Q A;  2AY2 A;  4AO4 A;  1MDX A;  2AY3 A;  3E2Z B;  3JWA A;  1QGN A;  1VJO A;  2VLF A;  2VIA A;  1ECX A;  2W8T A;  1AIA A;  3M5U A;  4OMA A;  2FNI A;  2VYC A;  1E5F A;  1UU0 A;  3LV2 A;  3N4S A;  2F8J A;  2VMN A;  4BHD A;  3USF A;  1FG3 A;  4ZLV A;  3DC1 A;  3LVJ A;  4ZM3 A;  1AHX A;  1GBN A;  2YOB A;  4E77 A;  4ADB A;  4GEB A;  4A0G A;  5G2P A;  4JE5 A;  1VEF A;  2VI9 A;  4ZWM A;  1TAT A;  1ELU A;  3RBL A;  2VMO A;  2VMR A;  4GE7 A;  3HDO A;  1UU2 A;  3MAD A;  4JEX A;  1BJN A;  1ASA A;  3AOW A;  3DXV A;  4UHO A;  4KXK A;  5EIG A;  1V72 A;  1WYU B;  4RIT A;  5D95 A;  3UE8 A;  3ZRQ A;  4A6T A;  5G0A A;  2EO5 A;  4A6R A;  1C7G A;  4R8D A;  2VLH A;  1TAS A;  2ZUK A;  1WKH A;  3RBF A;  1OHW A;  3BV0 A;  3HBX A;  2D64 A;  1SZU A;  4O6Z A;  1GEY A;  3Q8N A;  1H0C A;  3TFU A;  1FG7 A;  4ZSY A;  2EYQ A;  2VGV A;  5G4I A;  4IXO A;  3TQX A;  3AAT A;  4OTL A;  3RCH B;  2ZY4 A;  2Z1Y A;  4XK1 A;  5DJ1 A;  3JWB A;  3ISL A;  1C7O A;  1AHF A;  2W7D A;  3QPG A;  2EH6 A;  4H63 Q;  1S09 A;  1AJS A;  4U1T A;  4XJL A;  4KAM A;  1X28 A;  1DTY A;  3DOD A;  2R2N A;  4ZDO A;  4LC3 A;  2FKI A;  4AO9 A;  3NDN A;  2GSA A;  2W8U A;  4EB5 A;  2AY5 A;  1AIC A;  2D7Z A;  3K28 A;  3EZS A;  5BJ3 A;  4ZAH A;  1S0A A;  4GE9 A;  2R5E A;  5F8V A;  2BYJ A;  3EI8 A;  4Q75 A;  4MSO A;  5D5S A;  3W1J A;  2QBT A;  2BI2 A;  3HL2 A;  3EIA A;  1G7W A;  1WYT A;  2Q7W A;  4MQQ A;  4OT8 A;  4F5M A;  3PD6 A;  4PFF A;  2FN6 A;  1MAQ A;  3GJU A;  5EUE A;  4EFF A;  2Z1Z A;  3ZZK A;  1YJY A;  4B9B A;  1PG8 A;  3ECD A;  3FFH A;  5E5I A;  2D66 A;  9AAT A;  3N4R A;  2CST A;  1QJ3 A;  3FQ7 A;  1RVU A;  4A6U A;  1ASM A;  1BJO B;  1E5E A;  2AY8 A;  1VP4 A;  1OXO A;  4L0O A;  5J8Q A;  1RVY A;  3COG A;  3NYT A;  2D65 A;  3UAK A;  2ZY5 A;  2GMS A;  4ADE A;  2VMX A;  1J04 A;  1W7L A;  3RCH A;  1AIB A;  4TN4 A;  3AEN B;  3FKD A;  1QIT A;  2VMY A;  3JTX A;  4IX8 A;  2W7M A;  1KKP A;  1FC4 A;  3LG0 A;  5M4D A;  4IW7 A;  2W8V A;  2C81 A;  1CL1 A;  1N2T A;  1TOE A;  3A9X A;  3PDB B;  3H7F A;  1DGE A;  2D5Y A;  3CQ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...