4P3XA

Structure of the fe4s4 quinolinate synthase nada from thermotoga maritima
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
305
structure length
305
Chain Sequence
b'MHHHHHHMVDEILKLKKEKGYIILAHNYQIPELQDIADFVGDSLQLARKAMELSEKKILFLGVDFMAELVKILNPDKKVIVPDRSATCPMANRLTPEIIREYREKFPDAPVVLYVNSTSECKTLADVICTSANAVEVVKKLDSSVVIFGPDRNLGEYVAEKTGKKVITIPENGHCPVHQFNAESIDAVRKKYPDAKVIVHPECPKPVRDKADYVGSTGQMEKIPERDPSRIFVIGTEIGMIHKLKKKFPDREFVPLEMAVCVNMKKNTLENTLHALQTESFEVILPKEVIEKAKKPILRMFELMG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Quinolinate synthase A
publication title The crystal structure of Fe4S4 quinolinate synthase unravels an enzymatic dehydration mechanism that uses tyrosine and a hydrolase-type triad.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
total genus 115
structure length 305
sequence length 305
ec nomenclature ec 2.5.1.72: Quinolinate synthase.
pdb deposition date 2014-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02445 NadA Quinolinate synthetase A protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10800 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NadA-like 4p3xA02
3.40.50.10800 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NadA-like 4p3xA03
3.40.50.10800 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NadA-like 4p3xA01
5KTNA 4HHEA 4ZK6A 5LQSA 5LQMA 5F35A 5KTMA 5F3DA 5KTSA 5KTOA 5KTRA 5F33A 5KTTA 5KTPA 1WZUA 4P3XA
chains in the Genus database with same CATH superfamily
4EI8A 3ZQJA 2QMEA 3QG5A 3RT9A 2NT4A 5B7QA 1TMOA 2ZR9A 5A05A 2D2IA 1NC3A 1E4OA 2TSYB 5KTOA 2OZKA 3ROPA 4IVQA 1V2HE 3T61A 3V1TC 4C0KA 3EX7C 5EMHA 3L8HA 3BD8A 1PEAA 2GEUA 1A9XA 1CZUA 3M5CA 4TWJA 4NK4A 2YOHA 1NUPA 2W6QA 2QZJA 4OXYA 4AN0A 3GLFA 3AL2A 2FXVA 4F9GA 4H7DA 3EY9A 4DMKA 2R66A 1LSSA 3K0AB 3OZUA 3ORSA 3JQGA 3VX4A 2X1VA 1R5NA 4FFWA 3P8ZA 1QIGA 3IR7A 3BBLA 2GH1A 1VBKA 4NV0A 4WZBE 5ECGC 5BV1A 1TUBA 1H2YA 4K7JA 1E5QA 4RIGA 5AHKA 1NW3A 2D74A 3D8TA 3R76A 3Q7IA 1P3DA 1Z26A 1XMOB 3HHPA 2P0YA 1F60A 3ESXA 3HY6A 2ILVA 3VR4D 5HKKD 3KTFA 2QAIA 1GAXA 5ALEA 4PFSA 4CIYA 3LHFA 3DZIA 2ZIUB 1HOTA 2VJLA 4EG0A 1I13A 2PS0A 6REQB 2QRQA 1KEZA 3EZ2A 1S2MA 5LFAA 4KYIB 3K1YA 1NMXA 2A3RA 4MR7A 4TZTA 1TEZA 2B6HA 3MD0A 5LVAA 1UT5A 3INYA 4P5EA 2ROQA 2NAPA 1WJGA 3WHIA 1E61A 2QW8A 2IRWA 1MVNA 2X4GA 5TIIA 3ROMA 1GQ2A 2QTTA 3WHLA 3N8NA 4ZDKA 1Y6FA 1S8OA 4FS8A 1N77A 1CE8A 2A5FA 2CXUA 4L9RA 1WPGA 1I6LA 4YDHB 4CF6A 7ABPA 3O95A 4INAA 3I61A 4UM7A 4JI3B 4C4SA 3Q9SA 2H11A 4MUAA 1BHJA 3P71T 4NG5A 3KSUA 2R84A 5DI9A 4EP1A 1UPCA 3GH3A 2NPIA 3GDOA 1XTJA 4BNFA 2FVYA 4QBGB 1N9KA 1QHEA 3D5EA 3VJLA 4YQFA 3HKCA 3OLQA 3UANA 1OLSA 3UJAA 3WBJA 2RG1A 3ESAA 3FCOA 2OXIA 3NBKA 2P2ZA 4TV8B 1TT5A 3BRCA 2GO1A 2O48X 2AW5A 2AVDA 3PJFA 3L4EA 3R3UA 4XB1A 1OFUA 2W9XA 3MAAC 3UXYA 4ZZ1A 1KTVA 1T5OA 3QVGA 1NV8A 2NWQA 4Y18A 4XGQA 2YV3A 5IBQA 4FOPA 3ORFA 5EEHA 1YUMA 4CMAA 2R0QC 2C5GA 4ENPA 1ESMA 1BGXT 4QGGA 2C2XA 3JRXA 4XEUA 2JATA 3WGNA 4BPRA 2GXAA 3C5HA 1I5OA 2Q5HA 2N42A 3VVLA 2D4AA 2I29A 3MF4A 4HN2A 2K6GA 4KQGA 4AG5A 1Z2NX 3VSEA 3Q3HA 3RFFA 4H3VA 1V8BA 1W93A 1SUBA 2V6BA 1JHPA 5DM4A 2WFLB 2WRZA 3KVNA 3PDJA 4MROA 2A1TR 3OPYA 1FZTA 2QTZA 5CDYA 1HWYA 1QO0A 5DK4A 4DCTA 1Y8RB 3ZK9A 2WTUA 1RBYA 3OOHA 4DXDA 1G5HA 2R4QA 1OI3A 3AUUA 2Z9BA 4J90A 5JUWA 2OAQ1 1Z0IA 1C9YA 1OAOA 1ZX1A 2OGSA 4E6EA 5DISB 4NCAA 3KAPA 2GRJA 4GX1A 4F4FA 1LSUA 2P2CA 1OVGA 4XASA 2PCLA 4Q3AA 4KE9A 3CVJA 2KWIA 3VHXB 3W2GA 5AM5A 1PL6A 2QRKA 2ZJBA 1QO7A 3SCZA 2CZQA 2GTIA 1E3JA 1NNLA 1C9NA 4X7MA 3O74A 1F4PA 2FP4B 2ZATA 1RP7A 3JYNA 2C4HA 2HOQA 3O38A 2J9GA 2VPTA 4IIEA 4YONB 1OC4A 3AM3A 2I66A 1QS0B 2JDID 4PXAA 4Y2GA 5A0FA 1W46A 2OAEA 4NPCA 3C98A 1GZHB 5SV2A 3ZLBA 4DDHA 5KU1A 1RC1A 3AI2A 2BLNA 4YUAA 1K8RA 1MXFA 1OZHA 1PT9A 3LX6A 2VHEA 4CN9A 3TQOA 4D4GA 5TLSA 3RSZA 1CUSA 1G5IA 2WJPA 1UKAA 3I6BA 3HJAA 2LGJA 3D81A 3SNHA 1UZNA 3LRXA 1XAIA 1T2UA 1I6KA 4GMFA 4RXTA 1NVVR 3VR6H 1NLMA 5BMVB 1A69A 1XU7A 3MTEA 4NIMA 4XI9A 2MSCB 2VO1A 2HDOA 1ZRSA 3CPSA 4N0EA 2XUOA 3V97A 3DV2A 4BMZA 2OBNA 2COEA 5EUCA 2ZIGA 1F0YA 2GZAA 2OV1A 4MWDA 3ZI4A 4ZAGA 5JW6A 1USUA 1CJSA 3ZWXA 3FKJA 2Z2YA 4Y9DA 3WMWA 5KVCA 1EA5A 1G8FA 2FUKA 2WAOA 5B7GA 2GK4A 2BMVA 1QH1B 4W9NA 3H16A 4DCUA 3HSKA 4MR9A 4C30A 4F4CA 3PU6A 5KWIA 3U1VA 1OLUB 3B38A 3K9FC 2IYRA 2X7HA 2O8EA 1KR5A 3AT1A 4M9UA 5TDHA 2RAVA 1O8BA 1WCIB 4PSDA 1E4YA 1ND5A 3PUWA 2VDRB 3D0RA 2NU8B 4ENQA 2PUFA 1NRIA 2X13A 4C05A 3ORYA 4LFCB 2NSJA 1FYDA 2VYQA 3A6ZA 4M49A 3LPCA 1THZA 3QKTA 1U8XX 5AI5A 5IXJA 2RK6A 2N1BA 3V6LA 1U6JA 3K0SA 3UCEA 2WM3A 1Z6GA 4MV6A 2BHTA 4BZPA 4UFOA 5CXUA 4OMUA 2CFIA 2C3MA 1J0DA 3G23A 3QTLA 1ECLA 1EK1A 1CDDA 5FFFA 2WBLC 2FG5A 2F3QA 2Q0SA 3GGSA 3F9IA 1S96A 3OKFA 1GA4A 1FJGB 4NCBA 3D6JA 4BGUA 5AVYA 2GDJA 1Y6ZA 3UT5B 1E3TA 1XXHE 4UNPA 4TM7A 2VBFA 1EFDN 1URPA 4UUAA 4FFBB 2OZLB 3O2SB 4Y2JA 4LISA 3C8ZA 1UXHA 2YJ5A 2V7EA 4LHXA 3WLMA 3OLCX 4MRVA 1PR0A 2EKZA 1US8A 2BKXA 2I1VB 3M6AA 1PGOA 3THWA 1Y1KE 4L3OA 3O92A 4JUIA 5JWOA 3UHFA 3G5TA 4ND4A 4ZVPA 1I7LA 3CZQA 1YRAA 4FYMA 3QWIA 5B58T 1QO0D 5C8YA 3GMIA 1C3JA 1M10A 3KZMA 3AF2A 4I9NA 1QAQA 2QLMA 4LE2A 1C3OA 4QTYA 1RPAA 2VK4A 3HSSA 3VPSA 1FLDA 1GQFA 4QZVA 4FR2A 1F7VA 1KBQA 5REQB 3WA7A 4ND2A 4UBOA 5KUTA 1LLCA 3C14C 4G01B 4E5MA 3OURA 2IV7A 3HUEA 1F6WA 1IY2A 5C34B 2QGZA 2ZDHA 3G5MA 3ROQA 3FPCA 4X1KB 4ZCTA 1CIPA 3G1UA 2D3WA 4F8JA 3TOZA 2OFWA 1YV9A 1GUBA 1K7CA 1L7DA 4R1PA 4C4TA 2MYUA 4Z4GA 1U7UA 4J1NA 1VECA 1KMNA 1BE0A 4JLKA 5GIPE 4MUKA 4WIAA 1ADBA 1C1DB 2G9RA 3GA7A 3O8OA 4HNSA 5ABPA 4DLUA 1O4WA 5KNCD 4CKYA 1BJTA 3TLYA 3PEVA 3S8EA 1USGA 4G4SO 1IL0A 3ZCRA 6ADHA 2WWRA 2GFQA 3SIWA 3ZGYA 5BN1A 1LNQA 2VTDA 2AJDA 3ZDZB 2C58A 2VVTA 4MWSA 4EL5A 1K06A 2NU6A 2ORYA 5EMMA 4UM9B 2Y0DA 3RODA 2FDCA 3OE7A 3F5SA 3W5UA 2YMQA 2FPGA 3UMRA 3ELUA 1BXZA 5G2OA 3KEQA 1OD6A 1ZC3A 1ZO8A 4GI5A 2GB4A 2Q99A 4M0KA 6GPBA 1DL5A 2P9JA 3AHHA 3HO6A 3NALA 3D6HA 3VKWA 1GXSB 3BD9A 3ZHZA 1DUVG 1ESNA 2K4MA 2XD4A 3RGGA 4C03A 2PL9A 2Q3CA 4EY4A 4JUFA 1FSSA 4NDNE 2DY1A 3L8GA 2PBFA 2Z98A 2PSSA 3OPVA 3JWPA 4X64B 2O52A 4ERNA 3EEOA 1NTRA 1GDTA 5DM1A 2P2LA 2WWWA 2FR0A 3AR6A 4EG5A 5MGBA 3GRKA 4ZVOA 1PVDA 5EJIA 3BDAA 3FTPA 3W4KA 1A9ZA 4AM8A 1OAKA 5LCXA 1GVNB 4L75A 4GPD1 4DRXB 4Y2TA 3A1CA 1TJ5A 3I2IA 2BEJA 2Y4NA 2EYQA 3JASB 2JGJA 5KTKA 1F8FA 1JZSA 1NX9A 4P5PA 4B7XA 1P80A 5C5IA 2R86A 221PA 4CV3A 1JKFA 4HATA 3CPJB 4D2IA 1B0PA 3PX2A 4DHWA 3PPXA 5TPWB 3TTSA 2XT6A 3NJRA 4IF4A 4RS3A 1P4SA 4BEWA 4D7AA 4I50F 1SB8A 2V45A 1CUFA 2BZ1A 2XZOA 2QTWB 1DZ3A 4ZHSA 1R6DA 1EHIA 1NDHA 3EJWA 1L9XA 2R6CA 5FV7A 3W6PA 5BYAA 4OU5A 4XAQA 5DXJA 3S1AB 4K8RB 1AIPA 3SC3A 3VHRA 2G5PA 1DE0A 3EODA 1L3CA 5IC6A 3OPMA 5CYGA 4QFDA 2ZSAA 4BMNA 2OV6A 4E51A 3RYIA 1XVAA 5D3KA 4HF7A 4AWAA 5ALQA 2HSGA 5FOWA 3NTXA 1R0LA 3LUCA 3Q2OA 3A2KA 3VPHA 1TGVA 1OPXA 1GV0A 5LP1A 3NIBA 3J80A 2ZBQA 3I6ZA 1ZU5A 5H4HA 3UT0A 2Q21A 2CL0X 5IVKA 2WYUA 3I9FA 2W2MA 3OQIA 4WADA 4J0JA 4DWJA 3HK2A 2O8DB 2JIZA 2Z4RA 4AKTA 1MVLA 1C8VB 3CNEA 2PX3A 3RVQA 4TL8A 4HWKA 3S28A 4MYHA 5THKA 4DUPA 2X9VA 1EDOA 3PUHA 4MAAA 3I58A 1UBTS 1GYPA 2FDXA 4NDAA 3EZYA 2GILA 3D7LA 1UMBB 5AOVA 3RF6A 4XVCA 2YW9A 3W4JA 2O20A 4DB4A 2P9BA 1IN7A 1PWXA 3G8DA 3HV2A 4JZKA 4DY4A 2FDRA 3NV9A 4UCQA 4RZUA 5K5EA 1M1XB 2P9EA 4X8LA 5IS2A 5ALDA 2ZT7A 5C8XA 3A32A 4KN5A 1KJ9A 1XMXA 3F49S 1DBWA 4BVGA 1E2PA 2KJQA 3D3WA 2SBTA 3O8RA 1FTYA 2WYIA 1SVUA 2VDNB 3KVYA 5DHPA 3TIGA 4Z5XA 4HDSA 2PV7A 1T9GR 1YFZA 2VP6A 3P9ZA 2WAAA 4TQ9A 5CURA 3H5TA 1GL6A 5H9WA 3PXBA 2WTEA 4I1PA 1X80A 2C4WA 2GFHA 4NPAA 5DK6A 1N2OA 5F2OA 2I4OA 5JMOA 3PGLA 4RF5A 1L4UA 1EE1A 1G64A 4MQUA 3GUVA 4YFYA 3DDCA 4D02A 1QO9A 3ISVA 4N7JA 2Z30A 1CETA 4JL6A 1YZHA 3DDNA 2E4VA 4DSOA 4NFSA 4G5XA 3R24A 3S68A 2Y76A 2ZS7A 1OA1A 3MCZA 1COWA 4GXRA 2L19A 1L4NA 2R44A 4K46A 3FRJA 4C21A 2CD7A 2WHXA 3DC7A 1FDUA 2ECOA 3STTA 1DSSG 1H42A 3WMFA 2CB9A 1YHNA 2H9AA 3BILA 3VU9A 1KOFA 3BRSA 4JD5A 2GCEA 1HDOA 1KS2A 2W8BB 4XWYA 4J0IA 1XPRA 1EAYA 2R7KA 2XWJI 2PZEA 2QQ5A 3B5JA 3L4SO 4KV7A 4NJMA 2WVHA 1E9BA 1SHUX 2IHKA 2AXQA 3PRYA 4V0LA 1XN1A 4JVLA 2HRQA 4UVHA 4IICA 4G9GA 4NNOA 3RJMA 4G5QA 1V6CA 1E9RA 2O8FA 1RYBA 4H7IA 3D59A 1FP1D 1Y8ZA 2GPNA 3G8BA 4LTNA 4OG2A 3OZIA 4F97A 1J0EA 1Z73A 4B4DA 2YZGA 5FL7D 1BFUA 1Z28A 3INTA 1JT9A 1WLYA 5CX1B 1VHJA 2WHQA 2IYQA 3GAFA 3IO5A 2DBYA 3UMYA 2PFGA 1FL9A 2D4HA 3HL0A 4RPLA 1A95A 1TM5E 2B8JA 2NSLA 3HS3A 3OFSA 1QJCA 4M8SA 4P92A 5DEIA 5BXQC 2PAFA 2VSXA 3GBSA 1Y3BE 2G0NA 3PR3A 4NK5A 4JSRA 4ETIA 3FPJA 3QE4A 1IZZA 4ARZB 4BO1A 5IFLA 4QPZA 5BYKA 1OXKB 2AJBA 1NDQA 4WZAE 1T10A 3AJEA 3IVRA 4L0QA 3F1LA 1V96A 3IMKA 2W5UA 1LS1A 2NUTB 1NXPA 4JMLA 3UK7A 3VI3B 4LK2A 1UDXA 3WZLA 1CERA 1HH4A 1ST3A 2W00A 4EG4A 3D3JA 4O2BA 5JRDS 5FJIA 4I1SA 3B51X 4RWEA 1UP6A 3LZ6A 4N12A 3IQZA 1F5SA 1K4KA 5GV8A 5IULC 4MITA 5L3ZA 4AQYB 3V7YA 3LC7O 1IN5A 1DT3A 1FU8A 1TLTA 1TVCA 1UKYA 1SUAA 2IPOA 3FLEA 4RETA 2PSFA 4W7HA 4W8GA 3TTTA 2J9RA 4FFLA 4LJKA 2YZ7A 1PS8A 2PMWB 3W04A 3WV4A 5JIBA 3EIEA 4K9PA 4W99A 3FOAA 2PXHA 3NEPX 4MH0R 2VPIA 1UUFA 4P7FA 3W3ZB 2H1OA 4AKIA 4ND6A 1PZNA 1SVWA 1EFVA 1ZK2A 5DYYA 3MK31 2VL7A 3P9QA 1HSZA 2HF8A 2XUFA 3F6YA 2OXRA 1SPXA 2ZR0A 2R1VB 5F76A 4PZCA 2I99A 3U13A 2QOEA 3G3EA 3W9SA 2F3PA 2X2OA 2G72A 3TN7A 3MPUA 5AM2A 1WB4A 1K7XB 1YZUA 4D8UA 2ZZKA 3AR3A 1X9GA 4BX9A 4ME6A 3ZH2A 2PX0A 3ZNNA 2VF5X 3DDOA 5F3DA 3ITEA 2QHXA 4F4HA 1GPWB 4V3CA 4A0RA 1RU3A 2ERYA 2XLCA 4IIDA 3L7DA 1T5LA 1Y48E 5DSTA 4QLOA 1OH7A 1NUHA 1Q20A 3WBFA 3QVTA 5KJFA 1LLQA 2J85A 4WCDA 2O0LA 1P2VA 4BZWA 3ASYA 2X3FA 3DS8A 1Z68A 4QQFA 3ANLA 3TQSA 2OORA 4DV7B 4QTZA 2FXIA 3SDBA 1YIDA 1ZI8A 4MW1A 3UJ6A 3R3VA 3FCUB 4JLPA 3OZEA 2X1LA 1DKQA 1YL6A 3ZHBA 3AFGA 4Q3CA 1U1DA 1W5BA 3I9V6 2WHEA 4MS3A 2HCRA 3R2JA 1W76A 5F1KA 2FQWA 4RTPA 1GZDA 1COWD 1P0IA 1V9LA 5HQ3A 4R2LA 5JDIC 1BCSB 5HQTA 3D6UA 5C51B 1QG4A 1N5OX 1P91A 2AOTA 4TSFA 5A5DA 2AMYA 4RTQA 3VI4B 2FN7A 1KI2A 4ECEA 3ZWCA 5CITA 2ZTVA 3IH5A 1ZW1A 4E15A 3R3WA 2C9MA 3K6JA 3SU8A 2OFOA 2GZDA 1HT2E 1K8YB 2ODNA 5KYUA 5K3AA 2JNWA 2GRAA 4EJMA 3OQOA 1RZUA 4TYPA 5C0OE 2ZYIA 1BRTA 1M1YB 3D2BA 3G89A 1NVBA 3KSMA 4P4UA 5CCBA 2A1TS 4EB6B 3IEMA 2FUNB 1J42A 4OQMA 2OQVA 1Q0RA 1ZOIA 4K6OA 2EWWA 4LQLA 2ASVA 2WF5A 4KVFA 5I3ZA 5B2EA 3FDZB 3WLPA 4B6PA 4HWTA 5K2OA 4J0CA 5AI0A 2R11A 3ODPA 3OJ0A 13PKA 2EGUA 3BWDD 3LCJA 1UC4B 2FEWB 3DLAA 1G4AE 3G0BA 4DVJA 3GT7A 1D6SA 4IDQA 5FYDA 1XLTC 3HYSA 3AK4A 4FINA 4QEZA 4WUVA 1WD5A 2QG9A 3LC2O 3QG1A 3OM9A 3TKLA 3P4YA 2L42A 1QQBA 5L3RA 2JK0A 2W6MA 3T3OA 2CGEA 4M87A 1T9KA 2EAUA 3B6IA 3WR5A 3GRRA 2ZJ0A 5E6RB 4FDTA 4JHXA 1ES9A 4BNHA 2P3OA 3ZDCA 3VR0A 5CDHA 5K03A 1C2YA 4U02A 1JG1A 1GRNA 5HQJA 2AFIE 2EW2A 1V7CA 2JJ1D 4UDOA 2NLOA 4IQFA 5K09A 2AZXA 1PJLA 1ZBDA 1AKQA 2GERA 3OJWA 5DM60 1NLUA 1YC2A 3CKKA 4B33A 2WU1A 3GLHE 3IEXA 2R6GA 3C3YA 4NH4A 5H83A 2A30A 3HJUA 2G8LA 1P62B 2HSJA 2MINA 3O4HA 4N0PA 4MHOA 1RZVA 4DMMA 2PRSA 2DU8A 3N2KB 3QI7A 4XYBA 4DIDA 4IV0A 4M86A 1AQNA 4YT2A 4HG2A 3H75A 3DTNA 5SZJA 1U7HA 3GH1A 2C0PA 3MJHA 4A92A 2YJZA 1C7JA 2NUPA 4XQGA 1N1MA 3TPZA 3IMCA 1FY2A 5FORA 1JAXA 4ZI7A 1Z36A 2RHRA 1BMQA 1RQPA 1VKHA 4IZ6A 1BVHA 2DKOA 1AZLA 2UUOA 3V4FA 2GEKA 3A1VA 5IJ0A 2FEPA 1YZFA 1ELOA 4Q00A 3EC7A 3K8QA 2PXXA 4V0MA 5CPBA 3WMXA 2JIDA 3PUKA 1GO2A 5DULA 4X94A 2H9YA 4NNPA 1VM6A 3BPSA 4BNNA 2GKOA 1K5DA 1CNMA 4FGWA 1Q0PA 4HAOA 4YO8A 1IK6A 5IP5A 4URWR 4FQ5A 3ZZUA 5HJ5A 4YMGA 4EJFA 1BHSA 1ECGA 2N47A 1ATZA 4O3FA 1QP7A 4Z49A 3K2BA 1K97A 3C1TA 4N0QA 4XB6B 4X6LA 3RAPR 3LOPA 4E1BA 3KQUA 3OX4A 4BX8A 4FHZA 5J63A 4JYPA 4LXIA 5MN4A 1KMMA 5KO2A 3GJTA 1NLYA 2D0DA 4G8JA 5L9AA 2PH5A 3BMQB 2GF2A 1HK7A 2O2HA 4V38A 2YXDA 4W7SA 5HF5A 5LC1A 3TD2A 3WLRA 3O3CA 3E03A 4HNHA 2BV3A 2ZRFA 4UEKA 1SUDA 3P45A 3ZJYA 1KY3A 4E4YA 4XSVA 5ITWA 3ESQA 5EIBC 2XDQA 2C5EA 4IDFA 1NBMD 4X6UA 3EEBA 4XCQA 4TYMA 1KFJB 2WM9B 4I5EA 2EQBA 1LC0A 2A4MA 3AU9A 1GTJ1 2ANCA 3RFCA 5I7VA 1U0HC 2M9MA 5FQNA 2AYXA 5BQPA 4HEA6 3KZXA 1LRLA 3BTUA 4XCVA 4TL6A 1GPJA 1PHPA 1BD4A 3ER6A 3F97A 4C0XA 1S2IA 4E07A 3JR3A 1DINA 3ZY3A 5KI6A 2KB0A 2JGDA 4XYGA 3FPSA 1WE2A 4HRAA 4UU7A 1KDVA 4TT3A 2H1SA 1Z5UA 2I67A 1YZQA 3MB8A 3FCYA 4FLEA 5NLLA 1D4FA 3ITKA 4E09A 3HVRA 3VKGA 4ZRNA 3ZU5A 1NUTA 2W0SA 4J43A 3IVAA 1WXFA 3S2SA 3KJFA 1SXJB 2LUOA 3RC3A 3JQAA 3PQCA 3OTQA 3HTXA 2VJOA 1GCUA 2IEAA 2JLZA 2XNHA 3U7HB 3URMA 4PFQA 4JP1A 5DGIA 2IDMA 2BVNA 3JWEA 2REOA 4FC6A 2VNJA 1XVVA 4DLVA 1YCGA 4RJJA 1UOQA 4FKZA 4KXQA 5DTEA 3R09A 2R00C 3B2EA 1A50B 2Q9CA 3QKSB 4Z0NA 5L3SB 4B76A 3M5PA 4EPVA 4JP2A 5LQMA 5DVZA 3T7SA 1DOHA 2BZ0A 2J0EA 3K6RA 3FWZA 2BBTA 1H1DA 3H04A 3ZGNA 2ECKA 3MS2A 3NG1A 5DN9A 1AS0A 3PDIB 3TO5A 2A0XA 2NZ8A 1P8AA 5B1YA 4AWBA 4CCYA 3KOUA 3MBOA 2DM6A 4GEKA 4QICA 4WACA 5JNLA 2WU3A 5JZVA 2FFJA 3M2PA 3QFRA 5ALGA 2OV3A 3HFSA 5FNZA 2JJ2A 5CB4F 1NG9A 1QG2A 4MINA 1GWNA 4DWVA 5AVZA 1FFEA 3RVKA 2PUGA 3JAKA 2I22A 1PAUA 2H2GA 2Q49A 3UWOA 4DLLA 4IOLA 1JNXX 5D5PA 3ZDXB 4NBNA 1E9DA 4TMVA 1F6DA 2VUUA 4WY2A 3DDZX 3U16A 4BAZA 5DTRA 3L1VA 4M8LA 3SZOA 3DV9A 1H65A 3VHLB 2Z6QA 4ZCRA 4NXNB 2NXCA 1QHIA 1C3VA 1YQQA 1FXSA 3KCNA 5CFZA 1CIVA 1E2DA 1FB5A 3QELB 3FJYA 3OTGA 3PTLA 5JS2A 4F92B 3ZU2A 2BMAA 2VSNA 3BDVA 2W6OA 3EIOA 3NETA 2O7QA 3I5UA 5JPDA 1C80A 4KNWA 3K30A 3ZLTA 4FM9A 2XUIA 4QYIA 4ZV4A 4H7FA 3SMQA 1JEOA 2AVNA 1Z5OA 2Q6IA 3VNAA 8AT1A 1RKUA 3EQ6A 3RR2A 1JHQA 5FFNA 1KOGA 3N2YA 3TLZA 2B4KA 3WMGA 3T7JA 1Z0SA 2AGVA 1Q0UA 1M34E 1WP4A 3R0XA 4IGIA 2IXAA 1AXEA 2ST1A 5I7FA 2HBQA 3KB8A 3L8EA 2OBYA 1VZ3A 1IRIA 4BKOA 1L8QA 4EG7A 3QEOA 4FGSA 1L7VC 3DAYA 1T36A 1UXOA 2C3OA 3H83A 1F8YA 1ZH4A 1XLTA 4ZEOA 2HRDA 4FYVA 3K6SB 1Z5PA 1E99A 4ZPXA 3TSAA 4K0KB 1IBSA 1R0CA 1WQ4A 4AMBA 4JQSA 1YBVA 5AKJA 2I2AA 5FD8A 3D7SA 2XDWA 4GF5A 1LQUA 4RVGA 1XX6A 2A0UA 4HB2A 3MB5A 5ALXA 1JEYA 4ZOLF 2X0EA 4U7PB 1WXXA 4LRYA 2ZB3A 1F2UA 3L8YA 2YY6A 4QO7A 1OTYA 2BFPA 1K88A 1KXZA 1NC1A 2CUNA 2YHIB 2DPHA 4WXPA 5DGCA 3V9AA 3QXXA 2KYRA 4XWKA 4RD2A 2HIHA 4PG4A 5CIWA 3V1YA 4TT3D 5A04A 2JVJA 5C5DA 1VTKA 3EF3A 4YAEA 1UKVY 3BMXA 4H17A 5GJCA 3R7SA 3WLEA 5LOVA 2X0DA 4I55B 4LXXA 2ODEA 1DOZA 3GC6A 2Q4RA 3I1IA 3MYRA 4YJDA 2C7BA 4KLAA 3ZU4A 5C32A 2F4NA 4CKWA 4Y2HA 4WK2B 2Z9CA 2KX7A 5DIZA 3PC6A 4YAJA 4A8TA 4CMIB 2FAXA 4YXWD 5JS8A 3A11A 1W5SA 3OG9A 3H9JA 4HAUA 5J59A 2R96A 5KNDH 4BL5A 2NAFA 4C07A 4EATA 4W9MC 2WQ6A 1NP7A 4CDMA 5FUYA 2QAGB 5KYXB 3TZKA 2AI3A 3EVTA 4MWCA 3F3KA 2TMYA 3H7IA 3ANTA 1DJQA 3K35A 1F0PA 4ARAA 4B81A 1GJRA 5IM4A 4O4LB 2NGRA 3QPUA 1GG2A 5CT9A 4U9HS 1PTJC 4FZ3A 1E7WA 5DXFA 5EL0A 1UKEA 2QT9A 3FPAA 1NONA 1Y1TA 2BFDB 4EKEA 2XCIA 3OKCA 1BH2A 4KNVA 2I5PO 3ECCA 1T9GS 3GVXA 1FS5A 1T2AA 4YJ3A 5IAAA 2YVAA 2C2KA 3E9RA 2QM0A 2B2NA 4AXXA 3RDPA 4MP6A 4YP1A 4HCJA 2Z8XA 1DEKA 4G3XA 4P22A 3EGEA 3KE8A 4O4IA 3CO5A 4R1OA 2V6JA 4YRMA 3T9FA 3LLUA 1LTQA 1P60A 1S8FA 3PFNA 1TDJA 3K5WA 1KERA 4U9UA 4OFWA 4EYKA 5LKRA 5HNKA 3TIIA 3TXYA 3B6KA 4L5IA 1JV2B 3WV5A 2VAPA 3E4DA 3N5CA 4D8VA 4OL0A 1TXGA 4V0KA 1XEWX 2ODWA 1WPQA 3I9JA 4TXLA 1JZQA 1KZHA 4DMCA 2LE0A 1TEVA 3O7MA 1USKA 5GONF 4YPOA 3JATB 3BCSA 1F1JA 3KU1A 3ETCA 4EGQA 1TKCA 3S7TA 2EWVA 3AWDA 2H06A 4BXOA 1PIWA 5FO0A 4DJDC 3A6LA 1EKXA 1QCDA 4RA9B 3PUYA 5DNWA 3NOOA 6Q21A 2CXTA 4BAUA 1AMUA 3V7WA 2NYUA 4C6TB 2OHHA 3OPQA 4U7FA 1KI6A 3FWYA 1E1RA 1Z5NA 4KVGA 1IG3A 4KPUA 4MMYB 1B2LA 4YAGA 4OI4A 2BGTA 4YROA 4EF6A 5LQAA 2GPTA 3NTOA 4QUKA 2ZT5A 4D56A 3HY4A 1UMDA 2Q5FA 5FBQB 2EFCB 3NHYA 3K5PA 3VDXA 5FT9A 2QV7A 4DTIA 4EHFA 4AUMA 4EF4A 4UMFA 2O5EA 3BMOB 2WYVA 2HTFA 3B52X 1N36B 4GKVA 1MXHA 5B37A 1F12A 3I04M 2D1FA 3DE6X 3ICQB 1H22A 2FZVA 2WZDA 3GXOA 1Z6AA 4YDRA 2JFWA 2ODPA 1DIOB 2P6RA 4WA7A 4H35A 1AQUA 5G4LA 2FWNA 3BCUA 3HKEB 2BGWA 5B7PA 2P9FA 5DCWA 2R00A 4WN3A 1OY1A 1OCEA 4NL4H 3QOYA 5D5QA 5FIUA 4CM9D 4WFJA 4EX7A 1EE2A 1T15A 4OP1A 1KFCB 1V5GA 5D6NA 2B83A 3WG9A 2ZBFA 4ZZ3A 4ZO8A 3M6IA 1HL7A 2VPPA 5C37A 3EAGA 1P73A 4DDKA 5L53A 4ZXPA 1D2HA 4IVRA 1RAEA 1CUYA 2MYPA 1EJBA 2I1QA 1R6UA 2XA9A 3IUQA 3OO0A 4YP0A 5FNVF 4BGEA 4W1QA 1ZXLA 421PA 5PGMA 1E9FA 1XP5A 2GUGA 1K1EA 3GLKA 4DLXA 4NZPA 3X1KA 4BFWA 1TQ8A 5LBIA 2O3JA 4ND7A 5G1OA 5GZ6A 1EQ2A 3T06B 4A6DA 4DJAA 4C7KA 5LYJF 1Z8DA 2BFFA 3C3AA 1AM4D 3EXFA 1SCJA 1WTCA 4RXMA 5EY5B 2C1ZA 2N9UA 3SBXA 3ICEA 4E7OA 1SFRA 3OD1A 3OIWA 2ADMA 5IVIA 5I9IA 4XJXA 1OFTA 2ZJ3A 4AQDA 3DOIA 1SHTX 4AC9A 5A6SA 1U3DA 2AR0A 1DKNA 3C15C 4ZQCB 3ZDQA 4X7BA 2QN7A 4Q93A 4ASUD 2PH7A 1GA1A 2B8WA 2W11A 4YAUA 2IS2A 1DNPA 3PHIA 4BFUA 4OHZA 3CNQS 1ODJA 1UBEA 1WX1A 4OHCA 2ATCA 4WV3A 4Q4JA 4ZOEA 3EC1A 3V8MA 2Q07A 2O05A 3UK0A 4QG3A 5ERGB 2EF1A 2G09A 4L2IB 4QKQA 4M2LA 1ABBA 3DBIA 5M2QA 2UYHA 1PR5A 2XMRA 1NSTA 3H7AA 5AP9A 1QR6A 2Q7OE 5B3JC 2GYVA 2Q2WA 2QR2A 4HVCA 2I1WA 3HVIA 5EE3A 1FDSA 3WQHA 3QEBZ 3KUCA 1VB5A 1IPHA 4IHQA 5CLGA 3KOXA 4PR3A 3N2ZB 1HM5A 4UU0A 3KKMA 4JJIA 1RKVA 3EW7A 1D9ZA 4CDNA 5P21A 2ZJOA 2QSUA 4NU8X 4NCJA 3NTQA 4R9VA 1VJDA 5AXAA 4R7GA 3ANSA 2WHYA 3C3KA 5F7XA 1Z4NA 4O08A 2ESRA 1ETHA 4GP6A 3DLCA 2FWJA 3BD7A 4UAGA 3AXSA 1E9AA 1DAOA 4P33A 4RVNA 1K86A 1PGQA 2J9FB 5EJGA 4CLXA 1N5JA 4C4YA 4G84A 5KYGA 4DABA 1O6CA 2GF9A 3EQZA 5HJ2A 1E1YA 4HH0A 2H08A 1M1NA 4JBIA 3B60A 5GJWC 1E1RD 1M2VB 2PRZA 3HCAA 1C14A 4KUGA 5L95A 4OHUA 9LDBA 4IWYA 4O59O 2UXBB 4G65A 4KWTA 4LWPA 1PL7A 2XMQA 3ICPA 1MB0A 4MI9A 4QPDA 2WB2A 1USVA 1E2IA 1H3NA 1CQIA 2MSKA 3BE6A 3QPVA 4GSYA 4TKUA 5IAOA 3Q88A 2UZ4A 4GYKA 3I6IA 5D7BA 4BWYA 1NJ2A 3PEWA 2BIFA 2GZHA 3DEZA 1PR4A 2P8JA 2OXTA 1Q7EA 3N3AC 2APJA 1Y89A 3KTOA 4JXKA 4LEIA 2EBFX 1VSQA 1I1QB 1ZS9A 2QQ0A 4XJSA 1XWWA 4HOYA 2ZXUA 2DETA 3TQFA 4D6XA 4K86A 1QYDA 3TB6A 1YDFA 3H42B 3FWKA 3DOUA 1GYQA 1U3FA 3NIWA 5EZYA 4KPFC 1Z2OX 4JC8A 5DLQC 10MHA 1PR2A 4IWXA 2M98A 1RHKA 2VHCA 1I2ZA 2B1JA 2DMRA 2WKRA 4KRXA 1O5OA 4Q1VA 2BTQA 4EFMA 1YRHA 1DPFA 2A6PA 3VMFA 1NTOA 4PSAA 5DWQA 2B4TO 1NNUA 2CXPA 3K8OE 4DMGA 4RPCA 2XRFA 5JBIA 5FO1A 3W8RA 4H77A 5LJLA 1AKMA 4LJ4A 4QRDA 5TMPA 2XKAA 3NQ41 4UEJA 1NAIA 2HMYB 5F77A 4LCEA 1NXSA 2GAIA 2GJ9A 1D0IA 1HDEA 4WL0A 3T7EA 2Q4OA 2ZI7A 1A9RA 3JTEA 4OXRA 2GM3A 4Q47A 3U31A 1XFDA 5LLSA 3EA4A 4XPIA 2ZBUA 2PUBA 1M72A 5AW7A 2ZJFA 1CY2A 5DLPA 3TJZA 3ZGVA 3L46A 1A8UA 3R7LA 2OYCA 5I7EA 5F3WB 3IT0A 1IWPB 1KYYA 3EUWA 5EJMA 2AR7A 4CQLA 1NFQA 3QY9A 2XUAA 4RMGA 4UTOA 5D85A 3U2QA 1XQXA 1P1IA 4CQJA 2OGTA 3HPQA 4HNRA 1QYXA 4IMJB 1L5RA 2Q8NA 2V58A 1FMJA 2C96A 3ZD9A 2VF2A 1AURA 4IFTA 2PU7A 1ZMOA 4XVQA 1SG0A 3DSRA 5KKCA 2JEYA 2X4DA 3RSOA 1NP3A 1R5JA 1SZJG 1YR7A 1SXGA 2DBRA 5C8ZA 1QFZA 2QUKA 2WU4A 3QVKA 1CJCA 1KOJA 1Q0TA 1YJCA 1EXNA 1C9JA 1PT5A 1BYUA 3EQ9A 4H27A 5JH7B 1XCMA 2IZOA 1R74A 5GMOA 3WL7A 3B8HA 3LOUA 3LXUX 4GE3A 3RIYA 3T3IA 2C9CA 3L6UA 1R4ZA 4C6HA 1IWBB 1F2TA 5K2MA 4BQRA 3O91A 1ZN7A 3UGQA 1V1MB 4JT2A 2P5SA 3GJXC 4RORA 1GVHA 1FPMA 4DZZA 3ZHUA 1CZKA 3PF8A 1ZOSA 2B69A 2ZRIA 2F90A 1TK9A 5AYVA 5DNYB 5JQGA 1DCFA 2XUHA 1J7JA 4YCSA 4U2GA 1N2ZA 5C2JB 1UJMA 3M6LA 1YI0A 1LDEA 1JDSA 1BN7A 1LF5A 1TC2A 4GKKB 4BWGA 3MCTA 3G13A 1H23A 1ZGBA 4GGPA 4DBZA 3UFXA 2LP4Y 4P4LA 1CQJB 1GTG1 4EHLA 3O90A 1WDLA 1UP4A 5FLXA 1BCRA 3COSA 1HE1C 1NLZA 1TCAA 4V24A 2ZWMA 2WYHA 2NACA 4XM0A 3EDQA 3QMMA 2IOHA 3PJRA 1JSZA 1QGUA 2VJYA 2OPHA 3TSWA 4B3RB 2H65A 1U0BB 1TMGE 4QPJC 4JJKA 2Z95A 5DWDA 4P35A 1Q19A 1AK2A 1YE5A 4LS3A 4TUYB 2XB9A 2X2FA 4FOOA 3HRIA 3QPDA 1GQYA 3PGKA 5B12A 3E9YA 2VTVA 3FOWA 4C29A 2JLRA 1MV8A 1P17A 3K1AA 5HBGA 3AEUA 1JRLA 1LFDB 5DCYA 5FBKA 3I28A 4DNXA 1I7SB 2IS4A 1SBHA 1YL7A 2G82A 2NO6A 3D2LA 3JPWA 3T4XA 5TJ9A 2QN2A 5DFAA 1VCOA 4NJOA 4A1OA 4HNUA 3DXYA 1ESZA 3O3NB 1WZCA 3HJRA 5F78A 1XKXA 3SBDA 1L5VA 1HA3A 2ZKIA 3PJEA 1CZOA 1D1PA 3QOFA 4WBXC 3T0IA 2CNLA 2J33A 1OX5A 2FPIA 4CFYA 4WD3A 1JR3E 1DBPA 4BVLA 3JD1A 3CVXA 4MUIA 4BN0A 2CJWB 2QJFA 3R9IA 1AQIA 5IKXA 4F46A 1VMIA 4JJGA 2P3LA 3TD9A 1QH0A 4KQXA 3RV3A 1VGQA 1UPUA 3I83A 1G1MA 1W4BA 4N6GA 3AEZA 2WP0A 4OFXA 1ZOLA 1BAPA 4WBSA 4D42A 1GKUB 3DLBA 1PI3A 4UXJA 1E8NA 3VVMA 3GMTA 4Y3UA 2YHAA 5AK4A 4BB0A 5BNIA 4MRPA 1YC5A 1CB0A 5CM8B 1W85B 3RS8A 1NWCA 2CNBA 1TIKA 2PSHA 4RK4A 5J40A 3X1WA 4EJSC 2FH5B 2WIFA 5FI0B 4TYWA 2OCXA 3WFZA 1IZ9A 2JGKA 3E9NA 3H2HA 3MMSA 4R2KA 2V4ZA 2WWFA 1VMEA 3HDGA 5JARA 3C4VA 2FW1A 2ZYGA 2GHIA 2H5IA 1ZUNB 3KEOA 5KMGB 1RJWA 1A3CA 3G5UA 4JSTA 4J29A 4BNDB 4FIDA 4C04A 4L76A 4EKDA 3L8CA 3OX3A 4KODA 5EESA 5H8WA 2BBSA 4A6PA 4N8DA 1A2OA 3FKSA 4EVIA 2DCMA 3DV0A 4KH1A 1XTRA 3CO0S 4XXHA 2J4CA 3K9WA 4ZP1A 4B9EA 4E03A 2D7CA 2I2XB 2YNMA 3CH6A 3EOZA 3E8MA 3IHTA 2W48A 1CVLA 1CR4A 3FRIA 3A1NA 1ZHFA 5A7HA 1NQTA 3PFBA 2B1GA 3B1FA 1PVVA 4CM3A 5TGZA 4PYKA 4TS9A 2YIVX 3K70D 3JQ7B 1L7QA 4ZTBA 4OH7A 2Q27A 2DWUA 4UU8A 3T0GA 2LDXA 2DVMA 2QLNA 4IXWA 4PS0A 4LW8A 2BKEA 4MUJA 1OWPA 5EZ5A 1SKAA 5K3BA 3FUWA 3U4MA 3LL4A 1ZQ1A 2ES4A 2ERXA 3DMPA 2DYKA 3PUJA 3QQ5A 2WA2A 2RARA 5A6VA 2D2XA 1AA9A 4KU4A 4TYNA 2GZ1A 3AR5A 2VHJA 3JZIA 4IP0A 3OQ1A 1A9XB 4ZI5A 5GM1A 5U4XA 1RLJA 3CLKA 3WP1B 1V6AA 5KWJA 1E58A 3IXMA 3K5IA 4NYIR 4CV2A 1G20B 2WMOB 3CRRA 4F3NA 1XCPA 5JCJA 3JQGB 3LP8A 4R7TA 5U1PA 2DF8A 4GDFA 2ZLBA 4JT4A 1U98A 5KWSA 2AFHA 1TUBB 1VFNA 2FQYA 1WG8A 4CBVA 1S3GA 1UBLS 4OB8A 3N2NA 4YP5A 2JFFA 4HDRB 4MRMA 2Q3JA 5EIOA 1DHRA 2QPTA 1EHYA 3TSCA 3VR5H 3DZKA 4KSBA 1EGVB 3TK1A 4RESA 4CKCA 1UBFA 2WQ7A 2H4HA 3N0VA 4YJKA 3H5IA 1VHWA 3VAZA 5H80A 1OC2A 2XGOA 4JBXA 3VMMA 1U8UA 4FI3C 1IE3A 2V3VA 5TPZD 4QVGA 3W5CA 4ZHQF 1PQ4A 4PYMA 4MR7B 4YQEA 1L2TA 1T6BY 2DUNA 1U0GA 4PC7A 5EE5B 1SHZA 3DNPA 4WLUA 4HDCA 3E8XA 3VZSA 4F60A 1BROA 1DRKA 1T2EA 2R1UA 3BHMA 3OBIA 4N5LA 1ADCA 1G21E 1S1MA 4D80A 1CE8B 2PX6A 3QFFA 4BMPB 2BP7B 5F1PA 2EKQA 3AFIA 4R8MA 3UH1A 3AEKB 2RGRA 3UNXA 4RFSA 2D5AA 2Z5VA 4JKOA 2YFQA 3AJ9A 2BELA 1BDHA 4KCGA 4NE7A 4BNVA 3SHVA 1VC2A 4OYLA 1E2FA 1TF5A 3HKCB 1OLSB 2XX3A 1D1TA 4RHTA 2VQFB 3FHJA 3UWKA 4I8XA 3ZHQA 5FOXA 2JFPA 1G2IA 1TT5B 3WXBA 2YZKA 3HDJA 1ZVVA 4JVNA 1NUUA 1Z2AA 3NT2A 3FOEC 1IVSA 2PSEA 3QVGB 4IDPA 4BFSA 1V16A 3WK6A 3A2NA 4HGNA 3RHTA 1SCAA 4JKYA 3DM9B 3F6RA 3BB3A 3WK8A 4BUJA 3B1YA 1H8ED 2OQ2A 2E49A 1A0OA 3KXPA 3O03A 2NSYA 3FYUC 3GEGA 3RW9A 2VHVA 2PWZA 5ALOA 4I9FA 4DCSA 5C7IO 1TEXA 3OIYA 1QTRA 1FP7A 2PQ6A 4ZEXA 2YNMD 2GLUA 1S2OA 1IOLA 1O9HA 4AYWA 1WQ1R 1PWZA 5CFMA 4D41A 1E2HA 2G0TA 2IUEA 3WMEA 4ETMA 3K9HA 1Z4LA 3CUTA 3OPYB 2BE7A 2J09A 3VYWA 3CPEA 4KK4A 3H9EO 5G0UA 3AEQB 1EDEA 3VC7A 4HPXB 2X77A 1N0IA 3EXG1 1FDIA 3HR7A 1J2TA 1PR1A 2H07A 4NZYA 4J75A 1PKEA 5ALVA 1VPWA 2CV0A 3WOHA 3ZDDA 1WZEA 3EVEA 3ENKA 1IYZA 3VPAA 1Y9ZA 3LG2A 1K6JA 3GCWA 4FDLA 3UOWA 4B8ZA 1SXPA 2OG1A 3UMSA 3QX8A 3VZQA 3AG6A 3IO3A 2IVFA 3CTMA 2I62A 4I7EA 1Z7GA 2R1ZA 1O95A 2ZUDA 3CH5A 2GM5A 5TSDA 4RGVA 4EPWA 1L4MA 2XDAA 5GOZA 3IL2A 4KMRA 2AG5A 4FFDA 2C8KA 3NXKA 3QM1A 4QL3A 4D3ZA 4A0SA 5JNVA 5LXTA 1GTZA 1VLQA 4WZBA 2GK3A 4PWZA 2P41A 2VNKA 3CLVA 4WI1A 4WXHA 5J4HA 3WB1A 3NKVA 1JU3A 3K2QA 4UCWA 2A5DA 2CVFA 1VLMA 2HMAA 4K6KA 4Z51A 3THXA 1M2WA 4OQFA 1GPYA 4N8EA 1KC3A 2VPQA 4ABYA 3P9RA 4KMOA 1CF2O 2PL5A 3RWOA 3U3KA 2EDAA 3JWIA 1E6CA 2CMKA 4ZAXA 4DPKA 2BUAA 1LS6A 4N8SA 3U9TA 1ZNYA 3V8BA 4C7OB 3FMVA 4UDNA 3C39A 3IAAA 4B87A 4CMKA 1EU1A 3TUIC 4QLAA 3RBZA 5J4KA 3OFJA 4RIEA 5EJ8A 1TQ4A 1ZCBA 2G88A 1AV7A 5DE3A 4MR9B 4YJ2A 1TIBA 3A2LA 3FNEA 2OO5C 3MOGA 3HCNA 3E9CA 3PHLA 3ZGOA 4B44A 4EUEA 5AQ1A 5I7OA 4TSRA 2GEVA 2IW1A 5KQMA 3GJZA 3DULA 3PQ3A 4ZT6A 2XQKA 4REQA 4OA8A 4CVNA 3JRNA 3ZVLA 1WSDA 1WLSA 5FUMA 2I7TA 2A0YA 3MINA 1ID8A 3D7MA 4S05A 3GLTA 1JAIA 4JASB 2V55B 4PX5A 1W48A 2G1KA 3L1JA 1MW9X 2WIKA 3L40A 5NULA 4BEVA 2JIOA 3I5AA 1IDOA 1AE1A 1E6EA 1Q14A 4YO7A 4ZU1X 4EHKA 2CDNA 4OYRA 4EZBA 3O4VA 4YAWA 2D0IA 5DEOA 4MW6A 2C7PA 3MGKA 1HFJA 1KPGA 3FNRA 4O2AB 1IUOA 4P84A 3WFJA 5CB6A 4GKJB 2WJWA 1KU0A 3LHSA 1X19A 2IZ5A 4L78A 1CF4A 3AKYA 2GQ0A 4Q05A 4L8VA 1GEGA 4YMLA 2REQA 3IEUA 2EVWX 5EP4A 3GIWA 2XUJA 1GTVA 3SN6A 5C5CA 4F2HA 4N39A 2WD9A 4RPIA 2IYVA 2FPPA 1CZRA 4IDBA 5E6SA 3QBTA 1DWOA 2E4UA 1J97A 3WLQA 1Z5GA 4BGIA 3ZWMA 1I4WA 2ONJA 5HZGA 4R3WA 1SUFA 4MJXA 1DKRA 4P86A 2OB2A 3Q12A 4KR7A 4CI0B 5K0GA 3HU5A 4HH1A 3EASA 2GLTA 1Z7WA 4TLAA 4EG6A 5AVJA 1UJCA 5GGYA 1KDTA 2IYOA 4RAOA 2PGLA 1OX6A 1W4AA 3W9UA 5C8YB 1L1RA 2V8OA 1YMVA 2QD5A 3I2GA 4BO9A 2Z9DA 3NGLA 3S8YA 5CLHA 3U4IA 4BTVA 1OI7A 1A7KA 4P0PB 1KH3A 3CX8A 4LN1A 4NLLA 2IHUA 3RQIA 1YS2X 2KHZA 2O23A 1RXYA 5EXTA 4B73A 3WIVA 3ZY6A 4C2BA 4GPEA 2QE6A 1XZFA 4URYR 3WDKA 1ZM3A 4JEUA 2KM1A 4PWYA 1TU3A 2IK8A 4B7ZA 2B35A 3IQDB 1ZM4A 1HOXA 1M1UA 3OFND 1T8PA 1O95D 5B2FA 2C03A 4LJ8A 3DMHA 1HPLA 3BIJA 3KUXA 4QX6A 2K2WA 4QQNA 3LTNC 4FS3A 4W5WA 5L4LA 4B2IA 3AU8A 5JYEA 3FX2A 5EUQB 3A1UA 4ADSG 1TCBA 3WGYA 3P2KA 4P3YA 2B5WA 1X0XA 2X6TA 2VF8A 4A36A 2GN9A 4C4ZA 4NP6A 4E21A 3V6MA 3F6SA 1TEHA 3AY6A 3OZDA 1T29A 4FOTA 2JI7A 3E2PA 5KTYA 1PFVA 2NU6B 1ZNQO 8OHMA 2PPVA 1XYVA 4PLWA 4C0LA 4OJKA 3OH8A 3TMAA 2QLFA 1P0MA 3G2OA 3HB9A 4PSCA 2FPGB 4QTUB 1G5QA 3KUUA 4HHEA 3CGGA 4RW0A 5C1PA 1YGYA 2O2EA 1U8AA 4ISCA 3P7MA 5TS3A 3B9BA 2X41A 2RBEA 3WGOA 4A8JA 3IAUA 3I92A 4U8HA 3I4FA 3RYCA 1JJFA 3K6KA 2QX9A 4G0PA 1P5JA 2BKAA 3H0KA 3RIEA 1S2DA 4XH9B 1DAEA 1KI3A 4DJTA 5AOCA 1J99A 4Y8VA 4N3CA 2P1RA 2ZW9A 3A4IA 5TS2A 3S8MA 2FPUA 1O7JA 5B58C 2GVZC 4R3NA 4PNPA 3RVRA 3WZMA 5BSGA 4OYYA 1JFTA 2O3TA 3KD3A 2ATXA 1VJGA 4BS9A 3QU2A 4C6SA 4Q82A 1R1DA 1PR3A 2F17A 2PS3A 1XRMA 2Y1DA 3OQHA 3RANA 3PWKA 3RU3A 4BFLA 2EHDA 5IKPA 4RANA 5KTPA 2X14A 4HYEA 2VH5R 4PICA 2B2XA 3U39A 4DV6B 1RI3A 5IBCA 1V8ZA 1JDJA 1Q6ZA 3QFTA 1XRSB 3QUQA 4RBNA 4BX3A 4YMTA 1Z47A 5E1OA 3S70A 1EG7A 3DDWA 4ALJA 2QORA 4J76A 3EVAA 3A9RA 4IIBA 5TT1A 5CFOA 5JD5A 1G8YA 1I3NA 1O94D 4KR2A 2FSUA 3K9QO 3VU0A 4BBJA 2FLVA 4DOMA 1DDIA 3QXGA 4B3BA 2JK1A 4LVNA 2OD9A 2QRJA 4OQDA 3PKJA 4M38A 2P9ZA 4XLLA 4HBGA 3OZTA 4GU5A 1EGHA 2IYEA 4M22A 4OKNA 1RTTA 5F1YA 3RYIB 1W6UA 2KLHA 1U2DA 5AWFC 4Q6WA 4IG4A 4XTRA 5ANRB 1DC3A 1M0TA 1P9NA 1XA4A 3TEMA 2XECA 2DWPA 3VXKA 1G41A 2VLBA 3BGSA 4XWOA 4FW9A 5HZKA 5TV2A 1C29B 4Q1BA 1SRQA 1E7QA 4Y2PA 3HVKA 2GXQA 1FUUA 2WV7A 1X42A 1H2AS 2PLAA 3P0IA 3KHUA 3KELA 4M54A 3P0HA 1P1CA 4W1RA 1KR2A 3ZJ5A 3HCCA 3ZX4A 3OUUA 2QIOA 5FKJA 3ZDRA 4JBWA 5E2BA 2B61A 1EP2B 5EUBA 1SZDA 2I4RA 2ZRNA 3TL6A 3ZJUA 1ZAKA 2OUIA 1VG9B 1ABEA 4EPYA 2X8BA 1GPDG 5SY4A 2HPZA 2V5AA 4WKCA 1BE8A 1KYTA 4D4MA 1Q0SA 4DREA 4EMSA 2H16A 3KQKA 2WJ3A 4BFVA 3SKYA 4K3VA 3SZUA 2H1WA 3WNDA 1TO1E 5GINE 3DNMA 2JZNA 4QQKA 1J8FA 3F5DA 3GB9A 1O08A 1R27A 5AM4A 1F8GA 5F7OA 2ZTLA 3N0TA 4E5VA 1ZOPA 2W6ZA 4F2PA 2WABA 3AHDA 1ZH6A 4IYJA 2Q46A 3D3WB 3WXMA 1OH8A 3I8SA 4H59A 3D6AA 4KQKA 3P19A 4MVJH 2G36A 2PMDA 5FLYA 4KOEC 5KINB 1JEJA 4HDSB 2Q3HA 4IDEA 4JP3A 5D00A 2RH8A 3ZK7A 2OCDA 1CRWG 2PLRA 4WBNA 1EWVA 2UUBB 1AKNA 3GQVA 1X94A 4AF8A 3IMEA 3PLRA 4MV7A 3ZWBA 4GLLA 2B36A 4ZD6A 4G8BA 3SQNA 1Z63A 4FDAA 2I65A 3OETA 2AQIA 3ELWA 5IABA 1OH6A 2P1ZA 2VH1A 4CM4A 4M9ZA 3RWBA 1HR0B 5HDQA 4QNMA 3IBYA 1ZSNA 4FEEA 1Z5ZA 4OFBA 2W58A 3S2FA 2QVGA 2G76A 4UZFA 2DFDA 3KJXA 1V0JA 5ALZA 3CNHA 1RNLA 4ZT5A 4ZJUA 1Z5WA 2HJWA 1SH7A 3VU9B 3LPNA 1Z4JA 4X0EA 1FXWF 1YA8A 5ISMA 2ZVPX 3NTUA 1QQAA 1YVRA 4JBYA 4NJMB 4ID3A 3RQSA 2XADA 1OQAA 3H2BA 3CH7A 3F7OA 3T5CA 4LF6B 5EZ6B 4HWPA 1PW7A 3FWNA 3LPLA 1XDUA 2XR1A 4QU8A 4FFVA 2O8FB 2HTEA 3RO7A 1LK7A 3I8OA 4KO3S 2R8EA 2VBGA 4JJAA 4WFIA 1X7WB 4N40A 4HYQA 5I5GA 4QWMA 2Y1XA 1Y6RA 2C7RA 4AECA 3GZTB 2II6A 3EGDA 6PFKA 3AKZA 4MW2A 5AI9A 4FCWA 1EG2A 1U04A 3B53X 2AZDA 3H4TA 3TQQA 3UHPA 4OQEA 3VPFA 5K9ZA 1CBUA 4LSMA 1IQUA 3P2EA 3G0DA 4XCXA 3SBEA 1MX1A 2Y68A 1H4TA 1SBNE 2C4VA 3GQBB 3JQRA 2POCA 1P7ZA 2RHJA 3AHJA 1Z2CA 3O47A 4CCAA 1DIBA 1ODLA 1W9HA 1XZMA 3IQHX 3HJTA 2QD3A 4DR7B 1QHSA 3H17A 3NAQA 3GNSA 3PHGA 5CFLA 5A71A 4LGCA 1EEXB 2P68A 4M0MA 3AJDA 3QEMA 3HR4A 2XRZA 4IINA 3SZLA 2NO7A 3FB1A 2SKEA 3P32A 4O5OA 4WK6A 1X86B 2K7ZA 5GOTA 5CFQA 4BECA 2BT4A 4B85A 2NPFA 1PV4A 1Z33A 4RIHA 2PL3A 4WTOA 3OQPA 5A03A 3LNTA 5AVRA 2DBZA 5KU7A 3ZD6A 4M46A 4OLJA 2HI0A 2FETA 4JBLA 3JRWA 3ZCXA 2W90A 1D2CA 4UBNA 2XZLA 2NZVG 2VT7A 1I6WA 1ODIA 3V1MA 2AA3A 1Z6XA 3LBYA 2C2BA 2WA1A 4OMDA 4ZT4A 2BSQA 1GPLA 1ISRA 2OHFA 3G2HA 4G5RA 2O2CA 5BQFA 4GMKA 5H1YA 1LQTA 2VS1A 3KPJA 2BAGA 5LA6F 4B7CA 4EMUA 2I4LA 2DECA 3ONNA 4FYYA 1JQEA 1BWSA 1I9GA 2JIBA 3NAMA 5IH3A 2XMZA 1Q50A 1V25A 2YQ5A 1NVGA 1Z6YA 4KXVA 2J5BA 3DF9A 1S3IA 2FUG1 4IIJF 2YJTD 1G3QA 1AUXA 3LXXA 2HUPA 4NH0A 3TI7A 5BN3A 1FSPA 5EXSA 2Z8YM 3GUHA 4IXDA 4ZCMA 3KLOA 3P26A 1T4GA 5DI3A 5KX5F 1DLJA 1HSOA 5ERXA 5CA0A 4CG0A 1JPVA 1JPJA 4OUDB 2YW2A 2AG6A 1RABA 1CUDA 3PNPA 1C4KA 3GR6A 4RSRA 1U4OA 1WHTA 5CLLA 1DQZA 3NDPA 4LF5B 1QCCA 3G88A 4LXTA 3NYRA 3ILSA 3PITA 4V3BA 2GD2A 4CF7A 1ZGJA 2AS0A 3PCTA 2IYAA 2F3RA 3U4GA 4BN5A 4OQXA 4Z6KA 3BICA 4D3FA 3IAS6 3HCBA 4NENA 3COJA 3NB0A 2WD7A 3L8MA 1FFXA 4MS3B 3F4KA 4EKNB 5K99A 4EY3A 3PEYA 5HQ3B 2XMGA 4J49A 1LCIA 5IWCA 5L6LB 3LBHA 5DMHA 3ZVNA 1QIIA 2Q1SA 2HHHB 1L4LA 3S5JA 2AOTB 4C89A 2Q62A 3PNKA 4ALMA 2AX4A 2BDEA 1W29A 1MC1A 3F4BA 3CT4A 2F3TA 3O26A 1E2QA 2QWXA 1JAZA 5K6TA 4KMMA 3D8UA 1SEVA 4Q37A 1K92A 3GGGA 1XF9A 5KYUB 4Q39A 2PMBA 3G9XA 3LQKA 5K3CA 2NP7A 3Q15C 4TL9A 2FPOA 4U2DA 4WKPA 3L0BA 2PFKA 2A14A 2CEAA 4Q1DA 3UMFA 2C7OA 1WIWA 3DP9A 2RKBA 2ZSEA 3JQPA 4X3CA 3K96A 2G80A 2ORED 5FYQA 3THSA 2EATA 2QZ9A 1MJGM 4TXJA 2HLNA 4LGYA 2HLHA 3RFXA 3SJZA 4BE9A 5ED4A 4HGZA 3PZBA 3IPAA 1BU8A 1Z0AA 1NDUA 1QVWA 1T24A 2PQ0A 2Y1OA 1O8CA 3WE7A 2C84A 4LTDA 2J08A 1VLZA 3QJGA 2R48A 1R88A 1VKOA 3OZCA 4L9AA 4KKXB 1WVIA 3PD7A 1E96A 4X85A 5ILGA 1KWGA 1UIRA 1YGPA 1QRTA 2PLFA 3AQIA 3FF1A 1W5FA 4UMVA 1QOZA 3TGLA 4AIRA 3SJ7A 3KQOA 2AD1A 3LVBA 4LZJA 4LOKA 1B42A 1GARA 1U2QA 2PANA 2VDMB 4R83A 5C4GB 1UPFA 2BOVA 2PRKA 1NE2A 3VOAA 1QVVA 4OFZA 1SNYA 5MDHA 4COKA 4JIMA 4NOMA 4QHTA 4LOAA 3EVFA 3DZFA 2XAUA 5JSKA 2IF0A 2CYBA 1M6HA 1BWPA 4U7GA 3R8XA 1H2HA 1VE1A 2AR9A 4BO3A 4ILKA 4V0RA 1BDJA 2MYTA 2P0EA 2PTGA 5IBRA 4IRUB 3FE2A 1RWWA 4FFNA 1Y9AA 5C53B 1GAQA 1MAUA 2UZ0A 4AY5A 2WIAA 1T0HB 4ZT2A 1EFRD 2MINB 4MUYA 1RYEA 1E8MA 3UEOA 4ZEMA 3RTAA 4YRZA 5J2UB 1L4HA 3DHYA 3FYDA 1DFIA 3BMNA 1QTIA 3JAWA 3S1LA 5ITVA 3QSYA 1ECCA 2Z3WA 4H7PA 2NUPB 3E5RA 4U63A 4JLWA 1II8A 2RGWA 4U4AA 4CR7A 4ZI7B 2P40A 2HXYA 3BXFA 4LSGA 4J8PA 1NVUQ 1VE3A 1ONOA 2BEVA 3JTMA 4C5CA 2WIJA 3HDYA 2Z1DA 4CF4A 4D4KA 1KSHA 2A5JA 4JY7A 4FMCF 1KK2A 3BULA 4RDHA 521PA 5CBKA 1F06A 1E3LA 1R9NA 1PJSA 4TKMA 4IPTA 5DN6D 2EEPA 3H5WA 2JEZA 2XB8A 2I7XA 4H4CA 1IBCA 1EJ6A 1M5TA 3ADKA 1U94A 4N9QA 5FWNA 1SU4A 1WY7A 1GPAA 1YR3A 2P35A 1XZPA 5GJVC 1XTUA 3RU2A 3IUNA 3VDRA 4EPRA 5J43A 1KS9A 1FJ2A 2P6OA 3MM4A 4HQNA 2W8ZA 4RKQA 4YRGA 4FJ2A 1UP7A 3CLRC 1IIBA 3P0FA 3TXAA 4B4WA 5ILOA 4M53A 4AUEA 4HYYA 2OKGA 1UZAA 4MVJP 4P3XA 2XXAB 1MCZA 1XZKA 4GT1A 3W7BA 3ND5A 3IAFA 3C48A 1IPEA 3LCRA 4LFBB 4BTEA 2HT6A 2CKDA 4WMLA 2PKXA 3O9ZA 4RPKA 3BQ9A 4HT3B 4EY8A 3F5MA 2GSDA 1X9IA 3UY4A 2FZ4A 5TT0A 4BMYA 3BDIA 4G4JA 3TVDA 4CLDA 3NHUA 4RH3A 5DX8A 2M6KA 4EHNA 1LB1B 1U9IA 3EN0A 5FADA 4G86A 2RI6A 4JLVA 4PGGA 2HXSA 5MN5A 4BNUA 2OENG 4YIKA 1JP7A 1Y5LA 5TB5A 1NIJA 2I6QA 2VR1A 3LW7A 2IUFA 2V7QD 3A4VA 4MR8A 5IT9A 1OFVA 4PLGA 1ZISA 3RHSA 3N58A 1NUSA 1KYVA 2EU8A 5AK0A 3VZRA 1K9VF 2X9QA 1EFLA 5HEKA 1U63A 1GEEA 4LDAA 3L92A 2YQ4A 3OJEA 4BKQA 4BP8A 1NFRA 1VKNA 1XTIA 3IHWA 3O4JA 3RSFA 3PXDA 4CHGA 1ZCAA 1ZG3A 3M9LA 5TGDA 2EG5A 1H9AA 1XKLA 4TRJA 3W0LB 1R37A 1U0JA 4OQNA 3T5DA 2XZDA 1RRMA 1WQ3A 3JQAB 4M1WA 4YI5A 3DOOA 1U02A 3RASA 4BQSA 2JFHA 4JXXA 3KSDO 4RHUA 3GUZA 4I6GA 5L8VA 4NICA 2FWRA 4XFKA 2J0UA 1EJ2A 1J9EA 3SFVA 4RQUA 3TEFA 1L4FA 1CY7A 3LVQE 4XJVA 4ZOQI 1ZP6A 1CUAA 2OLJA 3TBKA 1UDBA 1EP1B 1IONA 2OM2A 3JSXA 3R8CA 5A2GA 4CETA 1L5YA 2C94A 2WJVA 4EO4A 2JJMA 4I4TF 2Z4TA 1ODTC 4GBGA 4MICA 1AXGA 1E3WA 1JE0A 2X9NA 3B5IA 3CRZA 3L7NA 1F8XA 3NNSA 2J30A 4NWIA 4GE0A 4WFKA 3WGQA 3A37A 2Q29A 3NJ8A 4FTWA 1EB9A 1GV1A 5SZHB 3KB1A 4HRXA 3EISA 4CCYB 1NJ6A 2GF0A 2C8LA 2QVZX 3FJ1A 4AN4A 3E4CA 4K9OA 4EB0A 2JHAA 3PKZA 2ISSD 3HLKA 1UJ2A 4WNAA 4FB4A 1GNVA 2DH5A 3JZFA 4MGKR 4MQFB 1NUQA 3REGA 4MVJI 5IN5A 2KLBA 2P4UA 4NULA 4AU1A 1FYWA 4EWLA 3N8GA 4KQJA 5EJ7A 3I1JA 5T41A 3NU1A 4PQYA 2QKYA 3D2CA 3GRUA 3RUEA 2JCBA 5AW8A 1ILWA 5LU9A 3KB2A 5IJAA 3Q7PA 1G0OA 2NSHA 5JADA 2CCGA 3DZGA 3AQ4A 3CMCO 1XWIA 3KL4A 4BNLA 1NIPA 1PQUA 3Q41A 1JE1A 1EX6A 5D3QA 4BJ5A 5EJ4A 1ZJ6A 3BX1A 2PZLA 2XGMA 3U49A 3TZCA 1YASA 2H4XA 3C3BA 3QXCA 3GA0A 1MX9A 3OTHA 1V3UA 2R7LA 5B2ZA 2I34A 1YH3A 1E1MA 1J90A 4AY4A 3CEHA 5GPBA 3WIEA 1O3YA 1NYQA 3OCJA 4TMZA 3TTYA 5A9SA 3H1FA 3KWLA 3T38A 1HMYA 4EHDA 3AY7A 4TWRA 4PPNA 2RHTA 3SVLA 1NQOA 1T8TA 2VDVE 4JB2A 2GEDA 4LZWA 5EFOA 3UA4A 3ZIAA 3PQ7A 1TJPB 3WIOA 1E1CB 3E18A 1YK0A 5A02A 3EWIA 4B5LA 4ZDWA 2LDBA 1U8YA 2OB1A 1FQWA 3OIFA 1H9CA 3ISTA 3IKJA 1OBOA 1KZ7B 5J2TA 2DHEA 1M2FA 2FEOA 3GARA 3HVUA 3TZBA 1RYHA 2Q3EA 5CGZA 3RFVA 4IKEA 1DQPA 1PGJA 4M0FA 2PJRA 1T36B 2ZRMA 4M8IA 5BSUA 3LHIA 3T4UA 4K9SA 2FEKA 2R8YA 3M6MD 3W8NA 1A27A 4HFJA 3RVDA 3U3OA 1I2AA 1Z3IX 3ZBUA 1TJYA 3TOCA 1N5LA 1FOEB 3FM9A 1R4NA 3TH5A 3QU9A 4B46A 2W2TA 1BXKA 4AY3A 1YO6A 2YC4C 3RJ5A 5SICE 1MO5A 3T52A 1JEYB 1EGQA 3EOAI 1V9CA 3U4AA 1ZCJA 3GYGA 1F2UB 1XDZA 3NVAA 4M1SA 4PLTA 4HADA 4QIHA 3DLHA 1IEQA 3V1UA 1PLKA 2VYNA 5EXDA 2QE7A 4Q3DA 1PF7E 3HN7A 1ZCZA 2FKAA 4TXMA 4YN3A 3Q87B 3GRFA 3QBDA 2C3YA 3MHPA 5CA1B 5AVUA 2A0WA 5JBNA 3VA7A 4DILA 4O2RA 5CFPA 4GXNA 2DWCA 2G9QA 2EJWA 3MJSA 5GM2A 1CDOA 1QP0A 2CLEB 3QPBA 1RCUA 2YXBA 3VNBA 4L5YA 5MHTA 3ISJA 1E2MA 3CUYA 1WTAA 2RGNA 1E0DA 3NM6B 4J7AA 4RTLA 1MMFB 1B6RA 3KWJA 3TL2A 4B35A 2F7SA 2YS7A 3F8TA 1JQLB 3F3MA 4DNPA 2E5FA 3CSSA 1YRBA 4H18A 4JI6B 1Y8QB 1V2GA 3EZXA 4K03A 1ZEMA 3DMDA 4LGMA 1IJEA 2BMEA 3UHOA 1YULA 4OXIA 3ZE7A 1A5AB 2GXUA 3FFBA 4KTTE 3R74A 3ICWA 2ETXA 2GZ2A 4IDOA 4OGGA 2FR8C 1Z2EA 2OKCA 4G9EA 1U1CA 4LYYA 1SU8A 1GP2A 4MGIR 4UUQA 3SP1A 2ZRBA 3CEJA 2WIGA 1BYIA 1PYOA 3O1HB 1T3GA 1TB4A 2X19A 1PNVA 3VR6A 4EEZA 3BL5A 1GGHA 3MJEA 1N32B 2DP4E 2YH2A 3QWHA 3UV3A 3LUHA 3QRWA 3ZHCA 5F7ZA 4JI0B 3QVXA 2AB0A 5HILA 3KD2A 2PIAA 4RGYA 3C74A 4BX2A 1JHZA 4UVGA 4Z3OA 3OZFA 1GNLA 2XE8A 3GFFA 2IYLD 4KDCA 2VTBB 1EFAA 3V4PB 3CLSC 2QTFA 2IHBA 1B8PA 4FEYA 4TMXA 4A0GA 1E9VA 1ZN8A 1KEWA 1BVYF 2O0HA 1A2QA 2UZIR 4LRSB 1YHZA 5HF9A 2D5IA 4KUEA 3R5SA 1LRKA 3QLUC 4GZLA 4OHPA 2VP3A 2QN8A 5DRTA 4Q7MB 3AUYA 2Y1WA 2VZ0A 4EQZA 2IX9A 4U3JA 1Y5IA 4TV8A 2ZI3A 1HFKA 2NVBA 4KE7A 4PTZA 1Y5NA 5A7GA 1XL0A 4KYTA 3EWNA 2JGAA 4E5KA 2AC7A 3KSZO 1KI6B 4DQ0A 5AFSA 4V02A 2OP0A 3OOWA 1MG0A 1M8FA 1DKPA 4YMVA 3FDFA 3SD7A 3GLIB 2JLCA 3DLTA 3ZVKA 1BQEA 5HJ7A 1CRPA 2VPWA 1WZNA 3IJ5A 1KC1A 4POOA 1UMDB 4B79A 4KNYA 4DR6B 1IFXA 1QKKA 5LLDA 1NF3A 1KE2A 1M34A 2VPYA 2BLLA 3D9QX 3CCFA 4N7RA 1GL3A 2V1XA 1ID1A 4OHBA 2QJWA 2ATIA 4HPJB 4YFVA 1H05A 3GF4A 1F17A 1I33A 1UINA 2EX0A 3AR4A 3RRZA 2D0OB 2BWJA 4A2CA 5LQKA 1Q3KA 3O8DA 4I5DA 5K4HA 3UAWA 1PO7A 1Y7PA 3T3MB 2WFLA 1W34A 4YHBA 1E9EA 1Z4MA 2B34A 2OTCA 1N78A 3QKRA 1LJ8A 3Q6MA 2HBRA 5BYBA 4R01A 1ZJYA 2FW0A 2YICA 2WINI 4R2IA 1G9XA 4C1BA 3EDMA 4CEHA 4RF2A 3JCZA 4MDFA 1HNWB 3HNPA 4I14A 4PU0A 2EG9A 4LHVA 4X1YA 2PL1A 3FVTA 1ONPA 2YYYA 4GDMA 3QKUA 2Y1GA 4R1LA 3ZBTA 4J6FA 2AOUA 1VPLA 5ALYA 2VLIA 4DDVA 5BUCA 4QYWA 4CODB 1KZYC 3RADC 4EGSA 1OW3B 4TLEA 1CHDA 3ZOKA 4PN3A 4DV5B 1I4EB 2TMGA 3U7QB 1YRLA 4KG7A 1NXVA 2NSDA 3FVVA 4FVTA 1JDBC 4M1ZA 4M36A 2CXRA 4N5NA 3QP9A 1QS0A 1K4YA 4G36A 1M73E 4JWTA 5LMUB 3D6NB 1N2XA 3SR4A 2HL6A 5EWLA 4CU2A 2IOYA 3EWSA 3EXFB 1UMCA 2BFFB 4HB4A 4MVXA 5EP1A 2HX1A 3DE1X 4ZCIA 2XOKA 4M9RA 2ZUWA 2OSVA 4MV9A 5TEWA 2GD1O 2ZBVA 4RGQA 4BNKA 3DAHA 1JDZA 4CCWA 1KP2A 1UKZA 4K6GA 4AS2A 2K5UA 2JI9A 3TR0A 1EVZA 2CVOA 3G8YA 2VXBA 3CE9A 4Q4JB 3KQTA 2NTNA 1AS3A 3VR6D 1N1GA 4AAYA 2O5CA 1H2FA 4JLAA 4ZVNA 1XCLA 2IODA 2AFVA 2ETVA 1Y1RA 4I1VA 4BHTA 1QH1A 2EGGA 3GP3A 2AG0A 3CFYA 1XGKA 4QEDA 2JHPA 4X60A 3AZOA 1POXA 4R69A 1OLUA 3NAGA 1EB8A 2FWMX 2R8XA 3H5LA 3K9CA 4KHZA 2QAJA 4MWOA 1ACMA 4OPMA 4N5MA 1BJKA 4PQEA 1NXWA 5AHXA 5DIFA 5L7WA 3K0HA 2I6XA 3O5AA 4OMCA 3NMUF 3UAXA 4BLUA 3NVMB 3WKDA 2CUZA 4AZWA 1ZSYA 4CUKA 4KJZA 1E6MA 4DNQA 2NG1A 4BPBA 1A4RA 1H2WA 2EKLA 3OMLA 4UHFA 1NAHA 1TF2A 4FQ8A 3T7KA 1QZZA 3IELA 5ENVA 2VQ6A 1OV6A 1NSYA 1QZUA 4WSOA 1UADA 4JITA 5BWCA 4GX5A 3Q3VA 5DU2A 2ZWIA 2Q5CA 1G1AA 4PYQA 1H0KA 1KI8A 1BTOA 2WNSA 3D4BA 2CFCA 1RXWA 4W9RA 4QGFA 2C7GA 4RM3A 2AYYA 4ZGWA 2XGJA 4OX9B 1ZR2A 4S2EA 1CUIA 1NA5A 1PFWA 1SKYE 1G16A 2DFTA 1U7TA 4Q7LA 4EHJA 2AJTA 3OE4A 4JC4A 3R5HA 2F2TA 1F2VA 4C88A 1T1IA 4Q1FA 4WLEA 1U9ZA 5U4QA 1S8NA 3K09C 3UWSA 2BEUB 3MTJA 1G59A 4GUAA 5M7EA 4DIUA 3KQQA 2R8PA 2H4YA 2VA9A 4UDXX 4BB6A 5G4KA 2VP0A 4FIZA 4YC7A 4QPNA 2QSZA 1VSTA 3RKUA 4G24A 1GGNA 4PZAA 3NHLA 4MK4A 4DM4A 3RT1A 4TKUB 1TQ6A 2HU8A 4B3JA 1DPGA 3Q7RA 3I30X 2AC2A 4MI1A 2O59A 3RVMA 4DA4A 1GHTA 1CR2A 1GKLA 1FTSA 1TFUA 2VT3A 3P0JA 1NLFA 2FRDC 3C7TA 4XFJA 1KOLA 4CIXA 2UZ3A 1R0BA 1VP9A 3DOHA 1QCZA 3DW3X 1MBZA 1XAGA 1D6MA 3NBZC 4JOCA 2DT5A 2HZ7A 4PG6A 5DHUA 1F5NA 1GFIA 1X87A 2FUCA 1GGFA 1WDKA 1UJ4A 2AN4A 1HE8B 4I9UA 3TGPA 4CMGA 2B7LA 4M1OA 3IEVA 1FDVA 2BTQB 1R0YA 2W6ID 3HZHA 5REQA 4BVAA 4F11A 3DFMA 4U9IS 5FPKA 1DAHA 1IB0A 3IE2A 1AK9A 5LZ8A 5C31A 3RYTC 4I1UA 4YCBA 3VZPA 4NOJA 1WXDA 1NZJA 4X95A 1IWOA 1JA9A 5IT5A 4LI3X 1VIYA 1UBCA 3LPAA 4D8TA 1XK6A 4JSYA 5CT5A 2GGSA 2QPLA 5HFAA 4AY2A 3GOQA 3U4HA 1RZRA 3D4LA 1KZ9A 4FMDF 3EQ2A 3U80A 1OJ7A 1VSBA 1XTVA 2HWKA 3KYBA 4XPIB 3JQDA 5BRAA 3U44A 4CL2A 4F8EA 2C5LA 2P1DA 1U8FO 3LM8A 3NDRA 2UKDA 4FX2A 2UYOA 4ENTA 1GG5A 1I2BA 4C5BA 4CQLB 4CG3A 1WU8A 5E3JA 4M83A 4CM8A 2FZEA 1WOYA 3GEDA 4H1VA 2RGDA 3KJGA 1TM4E 3HBFA 4P3OA 3B3QA 1TKRA 1UBRS 1THGA 1WW3A 4DARA 2NQ8A 1VOTA 3L7KA 2WJGA 4IIFA 3WHKA 3BWXA 2YMMA 1RWBA 4UHEA 2PD4A 3VM6A 3JVDA 4EB3A 1T5BA 4KN6A 4D0LB 1GGKA 4ND1A 4YALA 2XT0A 1DG9A 4KYVA 3M1AA 1HYGA 3CZ5A 4PYNA 4TTQA 2HH9A 2ZIWB 3OTOB 1LQ2A 1KYQA 3QQPA 2O3UA 1O97C 4HX2A 2VDQB 1JSLA 4FKMA 1UF9A 3WGGA 5L4NA 1F2TB 1EVJA 3TRFA 5JFGA 1T4DA 4PZUA 2QENA 4UPDA 1T5TA 4ER5A 2HU7A 4WEQA 2QP4A 1H93A 2OPBA 2VA8A 4R1SA 1RRCA 2ZYTX 1DO2A 2HF7A 3ICCA 3IUJA 1L5OA 1RE1A 3RKSA 5LSAA 1X92A 4RF4A 3HP1A 1I1OA 3H6HA 1WNTA 3W8FA 5KOYA 2VYVA 3K0CC 4Q9HA 1KJQA 3DD5A 5CB4A 4RQBA 5EIWA 1MEEA 4FFSA 3SY8A 1SVSA 3U1BA 3JQ6A 1B2RA 3ZH9B 3ODGA 1U99A 1XBTA 1XEWY 2CDAA 1K5GA 1ZC4A 2PKCA 3UFXB 1LZLA 1WP9A 4KL8S 4CL8A 1BCRB 1QGZA 3LWZA 5SYAA 2IUYA 2FE4A 3CF6R 4JX9A 1PGNA 1RJDA 3PD1A 1Z29A 1QGUB 2WSYB 4X65B 1Q21A 1C81A 3ANNA 1TIPA 3GDGA 5B7NA 4UREA 3AETB 5B1HA 1XZIA 3ORQA 2OV2A 2PSDA 2RGYA 4X20B 3EYAA 4EEXA 5HIAA 3HA2A 4WASA 1RM0A 1JH9A 3AEUB 4WW0A 3LFTA 4Q18A 4AVYA 1ZDMA 4QDXA 5M34A 1IUNA 5IK2A 4QM7A 5SYMA 1IZ0A 2A9PA 2ID7A 1IG0A 3WY9A 2A9VA 1DCTA 3MSXA 1XC7A 3L8DA 4A27A 2C20A 3OQBA 3UPDA 5JO0A 3AF5A 4YMIA 1JEQB 1SKUA 3TG8A 2H0RA 4P3PA 4ZO9A 2EJVA 4M8NE 1TRHA 3B1XA 1BNCA 2RHDA 2YVQA 3OCVA 1YTUA 4GQBA 1M8JA 3MJDA 1GLNA 3T9BA 4WVFA 5ILQA 5AI8A 4YVFA 4YAKA 3N0RA 5KJ1A 4L8FA 1SIWA 5LJIA 1CZLA 1DU4A 2G25A 5IT0A 1CY1A 3F9RA 4Q19A 4D0SA 1DBIA 2YYAA 4BAGA 1RQXA 2VSFA 3K4HA 2BFCB 5ALNA 1TW3A 1AHIA 5JPCA 3BS4A 3MT7A 5K0BA 1N57A 2W6JD 2ZBGA 4G0MA 3HQ4O 2H1VA 3BGOS 4JN6B 3E2MA 3KETA 4GP9A 1B0UA 1K0UA 1YS1X 2AFRA 1GQOA 2HN9A 3IOEA 1V7QA 3NM4A 5EZSA 3IUMA 3ZWKA 3TBHA 1XMPA 1DELA 3IQGX 3GFGA 4IUBS 2BM8A 3RNLA 3S2ZA 3WYGA 1NJSA 1RT9A 1FP4B 4P81A 4P6VF 2X3YA 1X7YA 4H6VA 3VKVA 3BHJA 3EXIA 1J6UA 1WEHA 2VJAA 4ZC8A 1X14A 2OZEA 3D4IA 3U0BA 1IZ8A 1D0VA 3LF2A 1LX6A 4BRUA 2XKJE 5DO9A 4UM9D 4CWAA 3DV0B 3DTVA 1FFAA 5LQRA 5JANA 2GX6A 1L1QA 5FJJA 1R5OA 1XCBA 2BUBA 3G9UA 1P2SA 1MO3A 4MIKA 3IBSA 4MPTA 4WT7A 2AE2A 1ZMRA 4QBTA 2X8AA 4NCKA 3CVWA 4EB8A 4QRIA 3KWFA 3KALA 3ENZA 4B3SB 3BIWA 1E9CA 2AN1A 1XRQA 1YKGA 2A7QA 3DR5A 3L02A 4J94A 2PIDA 1FFSA 2YRWA 2B3TA 1RQ7A 3EY4A 2Q6KA 3K09A 1I32A 1YQTA 2A5GA 4DB2A 5CMLA 5K8LA 3STVA 1BKDR 2OV8A 3VU1A 1GFWA 1JAHA 1E62A 2W4IA 1OFUX 1JLRA 3G2JA 3OT4A 4V0NA 5HRCA 4DQLA 3MLEA 4GRIA 4MB6A 1VG0B 1J56A 1P39A 2W8BA 3JWGA 3VV2A 2O19A 4TS3A 3PLAE 3RAEC 4J3JA 5JS7A 2WT4A 3S6JA 5IJZA 1FC0A 1LK0A 4LJ9A 3ZCTA 2AQHA 4MULA 3EUAA 1CY0A 1QR2A 2FRDA 1NATA 1PEYA 2NZYA 4MW5A 4RDCA 5J5CA 3DWGA 1B6SA 5T7BA 2P2DA 3B6JA 3H86A 4MVYA 1OBHA 5F51A 3KU4A 4X61A 2BFAA 4P36A 2AFHB 1E7YA 5TGTA 5K8UA 3FSJX 4ZVQA 3M1LA 1ZVMA 3ETJA 3GEIA 5J5AA 2FJUA 4FHEA 2A3NA 3FN4A 4F84A 4LHWA 1QK4A 1R0WA 3RG8A 4M99A 1WRBA 4FUTA 4IHJF 1C41A 2FOIA 2BRUA 4WDRA 5FWDA 5GONA 5HKBA 5K8JB 2PWBA 3ESCA 4RSGA 1P1FA 3TE6A 4WGFA 3OEWA 1V3TA 2Q1TA 2HA2A 3H97A 1CU1A 5IK2D 2J3JA 3LI2A 4IW3B 4QM6A 3GEPA 5A3VA 4F5ZA 4EG3A 2ZTHA 1HTTA 1KQPA 2NUTA 1YZNA 2R6DA 2QSJA 3A0RB 2BFNA 2A94A 5ES4B 3KCQA 3KR0A 2D1YA 2Z0MA 2VP9A 4YIHA 3GEBA 4FT2A 3M8KA 4AB1A 1K6MA 3NJ4A 4PG7A 1JR3A 1QIMA 4QELA 1XG5A 2YFYA 2G83A 4DS3A 3TQIA 3TX6A 1I2DA 1RQ2A 3TFWA 4RFSB 1LTHR 4CL3A 2NYAA 1ZIYA 2BGKA 2Z1MA 1QCYA 1TCVA 3R5JA 3RV4A 3VVCA 4AMUA 3ZXUB 2VATA 4QAQA 3JYQA 3ZWVA 5JZ9A 4ID9A 3UICA 4DCOA 5DJ5A 4V1CI 1UJBA 4HZIA 3NBXX 5B1DA 5J23A 2X8JB 2BM9A 1JIQA 2JCSA 4Q34A 2XTZA 1UQTA 1GILA 4IDNA 4JXZA 4G2TA 2P2YA 4YREA 1G2PA 4R54A 3VR4H 3W77A 3E7FA 4TSKA 2YN4A 5E7QA 3NIGB 5A4DA 2BF7A 1KXJA 1LPBB 1V16B 2VYFA 2DQ4A 2EFEB 4W8HA 4RLHA 3D6VA 4FYHA 4YEDA 4BASA 5K1ZA 2HK6A 2R85A 4IMIB 2VRNA 4QU9A 2A9OA 2ZE8A 2IYWA 4G0UA 4A2QA 2W43A 1TYZA 4O25A 3J81k 4IJQA 5FNVA 1VL2A 3OHPA 3BFJA 4LOLA 2CE7A 4Q3NA 2NZWA 3K0CA 2H2AA 4Z1MA 1P2GA 5IX8A 1UBNA 1NXQA 2QJOA 1HT0A 1EPUA 3JYLA 3FOBA 2BFWA 5HUQA 1OSNA 1B74A 2CW5A 1GZUA 2CJPA 5LYJA 4BGVA 1I4TD 3PXGA 2BJWA 2CJYA 2JF0A 3R7FA 1SUCA 3QVMA 3RVOA 4MWGA 1PFYA 3R8FA 3C6ZA 1JU4A 4Q03A 2P8SA 2PU5A 4IOJA 2P2GA 4U7TB 1ZUWA 1AZTA 1I7PA 2E0IA 2V98A 1J1UA 5EGNA 4IFIA 3S5UA 4QT0A 5CNJA 2FZWA 2GBPA 4J3NA 1DJNA 1XVUA 1U1EA 2HO4A 5DB4A 2F64A 5B3AA 5BNFA 4E2ZA 3CHYA 4D9IA 2RKOA 1XQ9A 4OHXA 1XMJA 2HEIA 4HEQA 1YS6A 3CNBA 1J8VA 1PDVA 2YY7A 4UNQA 4EJ6A 2FV8A 2IBTA 5A5FA 5KYVA 3PGVA 3WBKA 4LX8A 2F59A 2ZSDA 1YB7A 2LCIA 4K9MA 1OXBB 5I7SA 4EUFA 3RTEA 1R10A 2PEYA 3K0BA 4J91A 4QYTA 5CT8A 4LHEA 3DXXA 3TKYA 3T3NA