4P3XA

Structure of the fe4s4 quinolinate synthase nada from thermotoga maritima
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
305
structure length
305
Chain Sequence
b'MHHHHHHMVDEILKLKKEKGYIILAHNYQIPELQDIADFVGDSLQLARKAMELSEKKILFLGVDFMAELVKILNPDKKVIVPDRSATCPMANRLTPEIIREYREKFPDAPVVLYVNSTSECKTLADVICTSANAVEVVKKLDSSVVIFGPDRNLGEYVAEKTGKKVITIPENGHCPVHQFNAESIDAVRKKYPDAKVIVHPECPKPVRDKADYVGSTGQMEKIPERDPSRIFVIGTEIGMIHKLKKKFPDREFVPLEMAVCVNMKKNTLENTLHALQTESFEVILPKEVIEKAKKPILRMFELMG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Quinolinate synthase A
molecule tags Transferase
source organism Thermotoga maritima
publication title The crystal structure of Fe4S4 quinolinate synthase unravels an enzymatic dehydration mechanism that uses tyrosine and a hydrolase-type triad.
pubmed doi rcsb
total genus 115
structure length 305
sequence length 305
ec nomenclature ec 2.5.1.72: Quinolinate synthase.
pdb deposition date 2014-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02445 NadA Quinolinate synthetase A protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10800 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NadA-like 4p3xA02
3.40.50.10800 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NadA-like 4p3xA03
3.40.50.10800 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NadA-like 4p3xA01
5LQMA 5F35A 4P3XA 5KTPA 5KTOA 5F3DA 5KTTA 5KTNA 5F33A 5KTSA 4ZK6A 4HHEA 5KTRA 1WZUA 5LQSA 5KTMA
chains in the Genus database with same CATH superfamily
1KK0A 4J75A 5EIEA 2YWFA 3H5NA 1NVKA 2Y4NA 3KZMA 5CBPB 2EQBA 4YT4A 2PT6A 5DSXA 4S35A 1DAKA 2BEUB 3V4SA 3IIJA 5HGJA 5FTLA 3EF1A 1RLUA 3WNBA 4BP1A 5HJEA 1Y4UA 3C3AA 5K20A 5MN5A 1C3OB 1TF5A 3V4ZA 3RC1A 1BGWA 3QNUA 3T5BA 4AWBA 3EVGA 3M0EA 2E49A 1G16A 3DNMA 3ZWVA 4P58A 3LHIA 3RUAA 5FA5A 2Z2YA 1GNTA 2OD7A 2D5LA 2OYSA 2VH2A 2YKGA 2B0CA 2DFPA 4EVIA 2WWTA 5HYVA 4IXTA 4II2A 1ZUIA 3NDBB 4I8DA 3IULA 3O94A 3ND8A 4YRTA 2VJNA 5FWYA 3U5TA 1DSSG 1CZOA 1VKJA 2OBXA 3QVUA 4ZT4A 4REMA 3UC5A 4PWZA 4CLOA 3TB6A 1QIDA 2DP4E 2WE8A 3O4IA 1FNBA 1OC4A 2DH6A 2PX4A 5I4KA 3AM1A 2FPRA 4FC6A 4HTFB 1C5KA 5ECDA 4YR9A 4D25A 3CX8A 4YRMA 5G1PA 2W2VA 4BKRA 5AXDA 2AB0A 4DLPA 5HF6A 1E4OA 3EPPA 3C87A 5G0VA 3IBSA 1CUBA 1J4AA 1K8RA 3V7UA 1PS8A 2REQA 2R7LA 3QYPA 5CP8A 4EH1A 4OBBA 4ENQA 2JJ1A 1XLVA 4L9SA 4A26A 2XVZA 2R6CA 3AGPA 4QHSA 1WRBA 4CMEA 3AVTA 2XA1A 1XRLA 1PJ3A 5DBFA 1O6CA 2WSSA 1SU8A 4WGFA 5JOQA 1BHO1 1PYOA 1V5IA 1HYBA 1YR1A 1VIYA 3I58A 4M83A 1N34B 3P9RA 1J70A 1ECBA 1M34B 2WSLA 5ISMA 3N2YA 1VPDA 4R3WA 2DY1A 2WWIA 3VR4H 3EJWA 3K35A 2PX5A 1IIRA 2FE4A 2FY8A 1DFHA 3ACCA 2J8ZA 2H1RA 5EE9A 1ZH8A 2XZOA 1G6HA 4E11A 1JXQA 1XB2A 4CG3A 1I5EA 4D3DA 1OZ0A 3ZHRA 5JDIC 1ZW6A 3NYWA 3DE2X 3HP7A 1LC3A 2FR1A 2QD3A 2QLMA 3F6EX 4JA2A 5IBPA 3T1HB 5IHPA 4K1LA 4ZOLB 4EHFA 3G88A 3I0ZA 4HX5A 2H8KA 2WF5A 1G5QA 3UT5A 3NFYA 3GXOA 3ZU6A 4YTEA 1BA2A 3UENA 1N8KA 4OBEA 2YXPX 2FWNA 4I1VA 1CYEA 1Z6GA 1S01A 3DEIA 3WLQA 3ORHA 1WCV1 1PJSA 1ZA1A 4LZAA 4D26A 4UEJA 5AUNB 3OPQA 1U0FA 3QKIA 3A9TA 4OKSA 4HK4A 4G0MA 5EJ9A 3RSLA 3OJEA 1UUFA 4DG9A 5JCJD 4J4HA 5EFZA 5K09A 1GR1A 1W1WA 2GZ2A 3MBKA 4ND8B 2H5JA 4MUEA 5LQSA 1E7YA 4G26A 1O9GA 3ZNPA 5G53C 2VSYA 2OBMA 1AQ6A 3HQ4O 4PLZA 4X91A 1KZ6A 3KCQA 1EM8A 5FWXA 4EENA 2OV2A 4H9GA 5DCYA 4UTOA 3FAZA 2PX6A 3AI2A 3UCFA 1JXAA 5F33A 1PWHA 4IDPA 5B1IA 3JQFA 2PO7A 3K7EA 5JNUA 3FNEA 3HXMA 2ZTSA 4YXWD 4UQOA 2EWVA 2ZWMA 4OJQA 3Q7IA 4CKXA 1ZN9A 3SMVA 2C9DA 3GOQA 1JGTA 4I6EA 3NBFA 5DE3A 1U2DA 2P8SA 2IF2A 3D4LA 4RVHA 1UXKA 2JF0A 4F3RA 1D04A 1L5YA 1QFYA 1TZMA 1VLHA 3JYNA 4H15A 4K8RB 1JV2B 2ARKA 1E1CA 2CVFA 2YYZA 1PR2A 1KYTA 2CFCA 3LY5A 5ALIA 5IDVA 2XADA 3U4GA 1J2TA 2QT0A 5K3FB 4DIOA 2R7KA 1O96B 4ITUA 1ZZEA 3EDCA 2CFRA 3HR7A 2GS9A 2AN3A 1Z6PA 2FHPA 1E79D 3BXOA 3TLCA 5CEEA 4TS4A 4DJFC 4FXPA 3CWQA 3KQKA 4LXGA 3OMLA 4QOIA 4BNZA 2HR1A 4Q93A 1SZDA 3UFXB 4CLRA 4GKKB 1WQ3A 3K0AB 3K0SA 3AUKA 2B61A 1LPPA 2Y71A 4KKVA 1JJIA 3TLKA 1SUPA 1XE3A 2IZ5A 1XROA 2AN4A 1QOZA 2JJ2D 2OAGA 3A4VA 3A6GA 3EQ9A 4QOEA 4BV9A 2OXEA 4I2VA 3DMFA 2EX1A 1ZVKA 1EDOA 2GJAA 2NVBA 3DO8A 5CXUA 2F17A 4JLOA 1H2EA 2J9YB 4QQKA 1G9TA 4Y18A 3DR3A 2AUNA 2I5PO 2DGDA 3LKDA 3M8KA 2SKCA 4LDRA 1O6ZA 4MW0A 4WOJA 4YUWA 1OC2A 3X3HA 2PKXA 1NLYA 1SRRA 3RVBA 2ZG6A 4YP9A 4NH4A 3C7DB 5EUCA 4C88A 2VUIB 4DLTA 4EYGA 1W1UA 1NJGA 1WHSA 3N2KB 4IF6A 5EZSA 4BVAA 3M6UA 3O6VA 2PL5A 3IMKA 3JR3A 1QANA 4I1YA 1QE0A 1F2VA 3T7EA 1Y5NA 4L75A 2WAOA 5HCIA 4BO8A 1QORA 3NU1A 1PJ4A 1ZS9A 4C0XA 1KI8A 6LDHA 2R00A 1MF7A 1R64A 1DC6A 2B5WA 3M6AA 1AUQA 1XTBA 2J4CA 2PFGA 2GN8A 2ZITA 2XDQB 1Y7LA 1R4NB 4H1UA 4JUIA 4A0GA 3KKNA 1BROA 3C3PA 4OSEA 1RAGA 2WF9A 2P77A 3MW8A 2IKQA 4JDUA 2PN1A 1B4DA 1F6BA 4JR0A 3UF0A 1Q11A 3CGWA 2WHPA 4HQLA 3N6RA 3EZ6A 4U2EA 5J4YA 1OZGA 1QF9A 1A82A 2LV8A 2O0JA 3FPCA 4WXMA 5ALUA 3JRXA 5DI9A 3MWDA 3NNNA 4HNGA 1H0HA 4IXMA 4UAUA 3ZTYA 4PC6A 1T6NA 4LWOA 2I4NA 5K2OA 2F8LA 1RRFA 1DDOA 2Q7XA 1GLNA 3HLYA 4F5WA 5HUJA 2E3JA 2Y67A 2OMKA 1COWD 2MOKA 3QVGA 3OQJA 3KCNA 2M1ZA 3KPJA 3WQSB 4PS0A 2RHJA 5D87A 3TF5A 2MSCB 2RGXA 5TPWA 4HYTA 5FI3A 3SBDA 1FNNA 1SVNA 4K2HA 4U9UA 4F6LA 1NRIA 2BFAA 2VYCA 3M4YA 3AFOA 5J5AA 1F1BA 2HU7A 1SVIA 2H07A 3MWYW 5SZHB 3VHXB 3HY6A 1N8NA 4O4IB 3G9XA 2IY7A 3VYVA 3EEOA 3CUVA 4QARA 4DRXB 4H7DA 1EFVB 2R68A 3C7KA 3OKCA 3TLGA 1FXSA 1DJOA 1EXNA 1XZEA 1TU3A 5SY9A 3W7AA 1E2GA 3WGJA 3ZY2A 4DGQA 1JH8A 1UBGA 2XNHA 1HZZA 1TJYA 3I0MA 2XKAA 5BW6B 2BDTA 1V8BA 4JUFA 2B7BA 2EX4A 5FPYA 3EH1A 3FX2A 4HQKA 2JRLA 3ZD6A 3SHQA 3Q4GA 4HDRA 4POOA 3JSAA 4E33A 3NHZA 4JXXA 4JK3A 4C08A 1R00A 1P2GA 2BFOA 3EY4A 3OT1A 4P0TA 3UJ7A 3Q7RA 1Q1NA 1Z8HA 4X94A 1VI5A 3IXLA 1BMTA 3L0ZA 2WFAA 1LY1A 1O95C 1V8DA 1XTSA 2VN8A 1TJ5A 1G63A 1RAIA 2VZEA 1W34A 2BGUA 2XMGA 3O95A 4EAQA 3RRJA 3R9XB 4Z9AA 1U02A 1RCFA 1YQUA 4Y2SA 5E6UA 3BSSA 3O0DA 2K2WA 3NLLA 3K92A 4PZEA 3HGMA 1T2VA 4OL0A 1GCGA 5E7IA 1BZYA 2E5LB 1JJFA 1K08A 2FR8C 4RW0A 3ZV3A 1VSQA 4JDPA 3CIFA 1DFGA 2VC2B 3WGQA 3RC8A 2ONZA 4KYTA 4XLZA 3TJZA 5TGDA 1DGQA 4WDRA 4MGIR 4Y6QA 3N7TA 3ZVNA 4QOGA 3I09A 4R1PA 5B4TA 4HN4B 3DMYA 2DX7A 5DBIA 4IV5A 4UZSA 2GETA 3NXKA 3LNCA 1RBQA 2AYYA 2VK2A 1W52X 1IUOA 2ZJ2A 1SURA 1TJ3A 2D3WA 1P2UA 1DKOA 4TSKA 5LYJA 1SZPA 2ZI7A 5HHTA 3R41A 4I14A 4QPNA 1XZHA 1E1RD 2BDEA 3NNDA 3DQPA 4FDVA 1Y1SA 4HAIA 4OU4A 3LC2O 2X8WA 3U4QB 5CPBA 4FB4A 1FSZA 4UCXA 1W96A 5FNVF 4C4XA 4F84A 2H63A 2JD2A 2V0NA 3EMDA 2EAUA 1U28C 1Y80A 2GN4A 4LW8A 1SXJB 4GGPA 1K4KA 3MHPA 5JO9A 5CEFA 5KQGA 2LBPA 3EH2A 1SBNE 1PEDA 3T3EA 5AIBA 4WBNF 1DLIA 1M6HA 2VJMB 5DOZA 1ZNXA 1EDEA 3ECAA 2RBKA 1MEJA 2O8EB 3LVQE 3T7JA 4QQRA 4MVJH 1REQA 1J0CA 3OEEA 2QRQA 4YPFA 2CLDX 3ROXA 3TLBA 3ZK9A 4YGYA 3CCFA 3H5AA 2EEZA 3S2SA 2QQFA 4TRNA 1SUEA 4FDLA 4X7PA 1GUYA 4DBLC 3WRVA 4LRTB 1ZNZA 4XTCS 4ZICA 5AKXA 1QE5A 5GMOA 3H05A 5HF9A 1KH2A 3ADDA 1SUWA 4A0QA 4DW8A 4PNZA 4KPEC 2XUIA 1S2MA 3OU6A 4KWIA 3CUKA 3H9UA 3QXJA 2C7OA 1TQ2A 1EX7A 4XJVA 4HDMB 3IEUA 3UJDA 1TD9A 2BBOA 2R1UA 3NM4A 1HKUA 1KMQA 1ORRA 3O2QB 5EMJA 3I6MA 5KX5F 2FMIA 2R87A 3U09A 1UKBA 3ICCA 3SJBA 2RGDA 3P0EA 1DC4A 2DULA 3C5EA 2IBSA 3KYJB 3R3HA 4MA4A 1WV1A 1TK9A 3Q98A 4NOLA 2FPPA 5ALGA 1EVZA 2N0SA 3F6RA 1LF5A 2A59A 1AT1A 4BDSA 3BGSA 1SUAA 4PO3X 4ZO7A 5HQJA 4G8JA 4TV9A 4OXNA 2QLBA 2C2YA 2R86A 1B8OA 2G1AA 4XWOA 2OPBA 3UMVA 3KOOA 2EGHA 8GPBA 1Q16A 2HU5A 1P0IA 4X41A 1OZAA 3NHPA 3D6HA 3BAFA 5KOYA 3IEVA 1NRWA 5DSZA 3PDUA 1CJTC 1EZ1A 3TL6A 5LJIA 2GCNA 3OE7A 2YVKA 2GZ3A 2R85A 5JC8A 1IEXA 4ZRMA 3V34A 1Q17A 4X00A 4JXZA 4QXRA 3IIEA 3VPHA 4LDJA 3WRXA 4YLEA 1YC5A 1MKYA 3N2GB 4XB1A 4RD0A 1CR6A 3WLOA 2ECFA 4HYEA 1CJCA 2DMRA 2P3SA 3CXUA 4JENA 2QZ4A 4A92A 1ZISA 1LB1B 3V80A 5BR7A 2HUNA 2I7TA 5KYYB 2YHBA 1NSTA 1U8CB 4TZ6A 2E18A 5IW8A 3OMWA 2VP5A 1NXSA 2P78A 2H9IA 4EZIA 1Z39A 4M7WA 2O7QA 1UC9A 5M7EA 4HATA 1AKNA 4P3YA 5H0IA 1ZIDA 3DPUA 3VV2A 1K3FA 4FHEA 4M1ZA 2B2CA 1VKNA 2K4MA 2IJGX 2DHEA 3P9KA 4Y2UA 4DAEA 4O4HB 2VTKA 1PAUA 3M70A 1KC3A 4FTWA 4G1MB 4JLDA 5GGYA 3VR6H 4B45A 4L07A 3F5MA 1SKQA 2FK8A 2CLMB 2VYVD 1QPGA 1R0XA 2Z04A 4OGKA 1JJAA 2XWJI 1W36B 1HOTA 1SZCA 3S2FA 2G8LA 1IN4A 4YAUA 1ENYA 4LYDA 1BGXT 2QBYA 1Y3FE 3DMGA 3FD8A 2X41A 2KBEA 2A92A 4GBED 1DQNA 3GY0A 4WNYA 1QH0A 3W4KA 2SBTA 4M22A 1UKCA 4OXIA 4NBNA 2JD0A 3I2KA 4KIGA 2SCUB 2QTVB 1MABB 1PW5A 3PF9A 2GYUA 1NQWA 2CNWD 3CRQA 2EYUA 2O3SA 3N28A 4FDTA 3C3CA 2FN9A 4C4YA 2V03A 5D6NA 3H1EA 4V0SA 3WMXA 1IOLA 5BORA 5IF3A 2O8CB 3UW3A 1P8AA 4UNRA 2D5CA 1FFYA 3KK0A 2XSZD 4NMLA 2Y9PB 3QA9A 3O5AA 2WMOB 4Z3OA 5C7LO 3IQDB 1LLCA 1K68A 1DTWB 3H5LA 2R62A 3IE0A 1GR0A 3OZEA 1EEHA 2X19A 3QZUA 2ZR0A 5A4JA 2EWMA 5C5CA 5KYUB 5LDDC 1FK8A 2D1TA 5EQTA 2ZZMA 5F21A 2BEKA 2BMEA 1ZXBA 1WD5A 3E3AA 3MD9A 1C3XA 1ZLXA 3VR5A 3LLVA 1QDUA 3UXYA 1SVSA 2PNJA 2Q2OA 3HKEA 4FEAA 5CFZA 3DZCA 1UZLA 1OXSC 3REQB 3N2NA 4TUYB 3SSOA 1G2IA 4EBBA 1DARA 1EFKA 3T9EA 4XIJA 4XYMA 4D3ZA 4G37A 1E7RA 1IWPB 5FUWA 3RNLA 2BF7A 2COKA 4B6GA 5JNVA 4I8IA 2DPGA 4ZO8A 4ZU3A 3L8FA 2XMCA 3WDMA 3WNZA 2BR3A 3DA8A 4RJLA 3ZZNA 2YV3A 3G0HA 3MLAA 5C1DA 3NYIA 5J2TA 4TTAA 1P2BA 2WG0A 1NVDA 2AG5A 1TK3A 5LPNA 1ISHA 1DDGA 5E38A 3MIZA 1UCFA 5E95A 1KEWA 2HRBA 421PA 1IRIA 1QCDA 5BURA 3EPJA 1QF6A 5HIAA 2JG3A 1M1UA 3IGFA 5IAEA 3QFHA 2KB0A 1QF7A 5FP0A 4BJ3A 4D9IA 4CF5A 4RL4A 1A50B 2P5UA 1TZBA 2B4KA 2ZYGA 5IC5A 1GPAA 4HVAA 1AK1A 1HKHA 1UT8A 1HTTA 1O0BA 2V5UA 3QEAZ 1EHIA 3K8OE 1Z15A 2MJLA 2WE7A 4JU8A 3FTDA 1JTVA 5A2QA 3KJEA 4N7MA 1RWKA 3BE5A 4N82A 2HJHA 4PZ0A 1KI6A 2O3JA 1G8GA 1PGNA 2Q3LA 4FBGA 4JCOA 1Q7GA 1GO2A 1FTWA 4GIBA 5LR6A 1ZU5A 3KTFA 1C7IA 5AR1A 1KKUA 4JLUA 4PGHA 3QLVA 2H1LA 721PA 1MGPA 4LF6B 2GTHA 1AQLA 4M1WA 4BTEA 5LU9A 3U9LA 4Q21A 2PUGA 3DKKA 3CSSA 3D2BA 4DV5B 5IM4A 1VC2A 2C20A 3E1GA 4NZOA 1FDSA 4KOEC 4HGZA 2QX4A 5CT8A 1ZAYA 2H2DA 2PH1A 2X2FA 3FAKA 3IR6A 4C78A 4EMSA 3QPVA 3W5BA 2WJIA 4XVQA 4PSUA 4DTCA 2ZBPA 1C7FA 4MW2A 3D1LA 4NFYA 1QUEA 1GN9A 1L8OA 4BRSA 3AEZA 3ITNA 4KQ6A 2AJCA 1Y1LA 4L4RA 3GBSA 4QEZA 1XALA 1KI6B 4BWVA 1VDZA 3A6EA 4OQFA 4R9VA 5G4LA 1RC0A 3DWFA 4OMFG 4DCNA 5ITSA 1XEWX 1GPBA 4QT0A 3RUHA 3VOTA 2DFDA 4N48A 2XDQA 3DMHA 1YL5A 2GHIA 1SOUA 3UICA 1N2OA 3EK2A 3SQLA 4BLUA 3P5BA 1Q3KA 4G1VA 4RDHA 4EB6A 4EHNA 5KC8A 3K20A 1CR0A 4NQRA 1EWYA 2ZIFA 5HDQA 1X3LA 2H2WA 3T4UA 2RHMA 2UZ1A 2XE8A 4PSAA 3SOPA 3TSAA 3V32A 2W2MA 3H11B 4TQAA 1H4SA 4KO3S 1J25A 5TEWA 1EAYA 4IQGA 4BU1A 1HDIA 2QG6A 2A35A 1TIPA 4Z54A 1IQPA 3FSGA 1QLJA 4Y6OA 3WIUA 4EPYA 2ZRDA 1OBVA 3L43A 1IBMB 2BKLA 3RTEA 3ZLVA 4RTRA 2HV8A 3LUDA 4MQLA 4OXQA 1WXXA 1ULZA 2AA3A 2VP2A 1OASA 3LRTA 4KO8A 1RWVA 4MKHA 4O1MA 3UWOA 1GARA 3I2GA 2AJBA 4LJAA 1RYBA 1RHKA 1CQJB 2HCRA 1DIAA 2I7CA 1A7JA 1YZUA 2CLOB 3B52X 4OVKA 2D2VA 3ZXSA 4E30A 3AEUB 1QK4A 3QYAA 1H05A 2JLQA 5IYZA 3HADA 1V5WA 4H35A 4HDSB 2PR7A 4Q4AB 4Y2YA 2WU0A 5BWOA 4HFJA 2NZWA 2RDMA 5EYPA 5IABA 5BQ5A 3FSJX 4O1HA 2WQ6A 1U2EA 4M7RA 8OHMA 2GJ8A 2CVHA 2D0IA 2PS0A 2QHXA 3FMGA 3GGDA 4MARA 1MQAA 1U8XX 3GJYA 3KUUA 4YAWA 4XWWA 2O9JA 2YOFA 1NN0A 4LQLA 4QVIA 1AN0A 2ACEA 3FFBA 2Q9BA 2C3OA 4LJ4A 1WVMA 2YOHA 3WQBA 3BD8A 2ZE8A 3CUYA 2PGDA 5KJ1A 1C1XB 4FINA 3D8NA 4UASA 5ICCA 1XTJA 3QJ5A 2JRCA 2OBFA 1XL0A 3STHA 5ICMA 1L4HA 1NOJA 3DEAA 4KIFA 4GMGA 5DTMA 4YRRA 1I6KA 2ODPA 2OBBA 5CCDA 3WIVA 4ZI7A 5GJBA 6Q21A 4NCXA 3P71T 4CQMA 3F6SA 1AU9A 2CHFA 2LW7A 3DCNA 1VXOA 5C81A 4EF6A 4KUEA 3IIKA 1XZGA 4BNDB 1NL3A 3DHEA 3I04A 3L6DA 3WJAA 1CB0A 1CQIB 4TYPA 5TXGA 2I2FA 4PRYA 4JLKA 3HC7A 3NWPA 5E6RA 2HNBA 1CY6A 4FC7A 3ENVA 2VF7A 3OCUA 3VZBA 4G1UC 2QRHA 5BNTA 2CXSA 4Q1EA 1ZJ5A 3T1QA 1ABBA 1CZHA 4P86A 2O5RA 2GCOA 2NT3A 3FDJA 3ILSA 4IS2A 4YECA 5AJWA 3GFFA 1H3FA 3NRCA 4HGOA 5HFNA 3WNVA 1ZHOA 3RTAA 4OHCA 1IWOA 2RIRA 3GB9A 5BSRA 3IMFA 4TOIA 5LL6P 3NATA 1BVHA 3V8MA 2X4IA 1R0SA 3CYFA 4DWVA 2BBTA 4FWBA 1NUHA 3S6JA 4US2R 3HP4A 3WWOA 2B8NA 1VP3A 2ZCUA 3SPXA 1NYLA 3I92A 4G5SA 5DBOA 4D3SA 1JJBA 2WAXA 2XTJA 2ZSBA 4UHBA 1REQB 1CRQA 1CVLA 5TR9A 3TGPA 1JG2A 3GFPA 4F06A 4FDUA 4G6ZA 3WY9A 1KJ9A 2QE7D 3RT7A 2WM2A 4F9EA 1IPHA 2ZUEA 3TTXA 4LOIA 5D7BA 1HQDA 1FP2A 4EPVA 2LDXA 3W5VA 2FYTA 2JASA 3F90A 3HZOA 4C1NA 4L1KA 3DEYX 2IYPA 4TWBA 1QX4A 2OOSA 3TZEA 3UK6A 5DI3B 2P35A 3W5IA 2QMEA 2X22A 3KJIA 4NZZA 4QO7A 1JKXA 1GV1A 1KFJB 3SS7X 4IDHA 2XCUA 1EP1B 1RWMA 3PXBA 4FOLA 1SWVA 5JNRA 3TGLA 3JXEA 3LQKA 2XNDA 4FUTA 4JQOA 3VO8A 1S9DA 1BS2A 1TAQA 1Y9EA 2J09A 2X9GA 4D96A 3KQYA 3H9BA 2J08A 5G0TA 3T99A 2BGIA 2Q5EA 1U9IA 1EB9A 1EINA 4PS1A 4AXXA 3S44A 5DHSA 2TMDA 3U3OA 2O4UX 3T15A 4R1NA 1CUHA 3V4OA 1TMKA 2JAXA 1DBWA 3QPBA 1DX9A 1NF2A 3QOXA 5FT9A 3WIOA 3HXTA 5HK9A 5LDGA 1OXUA 4WKGA 1N1GA 4CQLA 3LK7A 4EARA 5NLLA 4BMYA 4FE3A 4AWXA 1I24A 2Z4SA 5JPDA 3ZK7A 2AZTA 1ST3A 2YVQA 3G23A 4YGXB 4UXHA 1VCOA 3L4JA 1LPBB 2IYZA 3PEFA 4FS3A 4KQFA 3TQQA 1WXDA 4BRZA 3DKIA 3D3EA 4ONEA 4X6XA 3F6PA 4BV3A 4MWOA 5A0TA 2I2BA 2F7SA 2B78A 2ZBQA 1P7WA 2YV5A 3EODA 2CXRA 1RI5A 2DVMA 5CA0A 1EP2B 1TPZA 4UTRA 1V11B 1RJEA 5T3UA 4BZPA 3JU3A 5IAOA 2P2YA 2XVAA 3SZUA 1K97A 4KKXB 4BNWA 4Y3UA 3U19A 4D0SA 4RMJA 4F1KA 4Q9KA 5YASA 3TZQA 4MRPA 3NOOA 3MCZA 2OSBA 2CJWB 1PO7A 2VA8A 4GOXA 4RLQA 3NUQA 3OUUA 5EZ6B 2HLPA 4DEYA 4LOLA 1H5QA 1U1IA 4EHLA 1T34A 2BMAA 4ZYXA 5KWIA 5CBPA 2I4IA 3LP8A 5HKKD 4O8CA 1I3OA 3ZHVA 3RYHA 2BHLA 1OBOA 2HI0A 3NO4A 5FI1B 4JAVC 1SVLA 5SYMA 3ZIUA 5I9LA 1HLDA 3GLFA 5FI0B 4K6FA 4PYOA 3IP1A 4DILA 1ZK2A 2VHQA 2SICE 2XUKA 3WGNA 1WF6A 2CNOA 4G2TA 4R01A 4CIBA 1JHMA 4ER3A 4GGMX 2FFHA 2Z08A 2ZROA 5AJVB 3S2IA 1F7UA 1YJCA 3N9IA 2XA9A 4PYLA 5D85A 1KIMA 2A5DA 2JFZA 4A0HA 5HZMA 5H16A 1N5DA 2PUAA 3P7MA 3COVA 2OXRA 3RVQA 2QWXA 2I54A 3CLKA 4DNQA 5HR5A 1GNSA 2GEDA 2IXDA 4ENRA 1MH1A 1RVDA 1UANA 2IHUA 2P9GA 5FNVA 3V3TA 3WMEA 4OXRA 4NI5A 4L5CA 4KBYA 4B6EA 4HDKB 1Z74A 2OY0A 4QD3A 3VPFA 1NNEA 4EUEA 3TMKA 2OKCA 1TO1E 4H60A 3BWCA 4KWTA 1KDZA 5CDHA 1TYAE 2QTZA 2I6XA 3I2HA 3F3KA 3ICQB 2BGNA 4BGDA 1G8PA 2UYQA 5L6LB 2BD0A 1KEVA 4REQB 2A1TR 2CL5A 1ZWLA 2ZRJA 1G66A 4C6HA 2FG7C 5E3JA 1EE1A 2PZLA 4MO9A 1V39A 3MB8A 2ZYTX 4IYJA 3RM3A 4ENTA 3QF4A 1OU4A 5I3CA 3ZYZA 4C0BA 2GQ0A 3RADC 3NOXA 5D1NA 3HMKA 1QIIA 2FZKA 1DOHA 1SOWA 1ZOOA 4JLNA 4PGMA 2GUWA 4RZSA 5AQEA 5CX1A 1VA4A 4G4SP 4A8JB 4F0JA 4FEEA 5F3RA 3NPAA 2AW5A 2QIPA 1I1OA 2OVFA 4ZC1A 3SHOA 3VNVA 2NU6B 3FPJA 4KQWA 2MSWA 4M1KA 2YYYA 1E6LA 1TD1A 3BHNA 4CKYA 4RTPA 1L5QA 3W77A 3T3OA 1TLFA 3EMKA 1BE6A 1NASA 5BXYA 2ZIUB 3QLEA 4ZOLA 4K6MA 1N2GA 2HTFA 3CG0A 4AIIA 1EIWA 2ZS8A 3MTJA 1RPTA 3E5NA 1N2ZA 1KIFA 4ARAA 4QUHA 2XVMA 3I32A 1ZA2A 4U8HA 1W2WB 1SXJC 1F6DA 3KWJA 4B7AA 3C45A 1BHJA 3A2MA 5B7QA 2FW9A 2XJ4A 4ZHSA 1OILA 2VYFA 5HPYB 3WL8A 4HAXA 3QPUA 5IXSA 3FA2A 1NXPA 2ZXEA 2IYQA 4PQRA 4U7WA 5K3EA 5L4SA 5H3CA 1W5FA 4ZRNA 3FFTA 4DA4A 2CFIA 2NXNA 1KVUA 3E8SA 1S8NA 2XHZA 3K6JA 1B8VA 1XZPA 4NTZA 1NWHA 4ZHQF 1NBAA 1K3UB 1NU8A 1Z7EA 2XF8A 2PE5A 2OE2A 1ZHHA 4EG5A 3FSEA 3LBFA 5JVDF 2JJMA 3B3FA 1G2PA 3B9RA 4KE9A 2C4KA 4N7BA 4H6PA 3W7VA 1U3FA 4UBOA 3CNOA 3T1VA 1Z2CA 3SYTA 2P4UA 4OAOA 3JZIA 4F3CA 1CUWA 2V3CC 1VPEA 1Y1TA 4UHFA 3VTKA 3OESA 5E7MA 4YAGA 1W47A 2X0FA 4IRMA 2PZ8A 2JGFA 2HTEA 2VA9A 4NZYA 4OJKA 1QXSA 5DSTA 1QFSA 2F00A 2DWPA 3OQ1A 1ZN8A 4JGBA 2XIJA 2NU9B 3UAZA 2J07A 2VZ8A 3PP8A 3GRRA 4AAYA 4CV1A 4IZ6A 4CM4B 2J3IA 4DDHA 1H85A 2J3JA 1UMKA 1XT6A 1QIGA 1XYVA 2X1MA 2Y6UA 3GN1A 1RHRA 1X38A 4HDNB 3LRXA 5EERA 3S2UA 2AOTB 2B25A 1JZTA 3QW2A 2IOHA 4MRRA 4RIHA 4F3TA 3MTQA 2A9VA 1FF9A 9MHTA 4J9VA 2EDCA 1CUAA 4LBZA 2QRPA 3AX6A 3OECA 3RE1A 1B3BA 2VK1A 1RVV1 2YFYA 3HB5X 2O8BB 2A5JA 2IHNA 5F5XA 3THRA 3L6UA 5JWRA 2F4VB 1N36B 1I4WA 1ISIA 1ZQ9A 5EN4A 4OI4A 3PUZA 5SZJA 2A9JA 2V6MA 2YR0A 3GL9A 1NKTA 3K6RA 3PNBA 4O08A 3IP5A 3ZHCA 4DZZA 2G28A 1CX9B 3IIMA 1IXKA 2QS9A 2QL7A 1EX6A 1R74A 4HQOA 4PEVA 5E2AA 3QVKA 4ALKA 1WP9A 2WKRA 3HZRA 3ZVKA 3FVTA 2BOVA 4P4SA 1QV6A 1OV4A 3A6KA 4KN9S 4XVHA 4YO7A 3B70A 3GIWA 4UVEA 4C4RA 3PJGA 2NXCA 2XCOA 1TVKA 4FOOA 1VLQA 2KS6A 3ETNA 3TIGA 3UWMA 2EFYA 2WTXA 3LO5A 4J07A 5DW3A 3UYLA 4CL8A 4UM8B 2OHGA 4M0UA 2VPZA 1KI1A 3ZXUB 4YCJA 3LGSA 3OCYA 5E2IA 3LL4A 3BMCA 1IUKA 5LZ8A 2W4IA 3IMCA 3AJ9A 3VR6A 2CXTA 5ITVA 1FUEA 3T3NA 1UBNA 1QGZA 1NLFA 1T0JB 4OKNA 5D5HA 5E4YA 1Y6FA 4B75A 2FPPB 1NUTA 1Q21A 1SPXA 1LC0A 3IYLW 1HF3A 1MBZA 3IFSA 5FOQA 1LX7A 2EJUA 4K05A 1ZM7A 2QE7A 2V7GA 3HL0A 1WDKA 3IUQA 1NU6A 1N9ZA 1PUXA 5HS6A 4NDNE 1DKRA 1G7RA 1HEYA 2FPWA 2PGIA 3R09A 4MW6A 3WFJA 2GK3A 4B85A 4Z9FA 5JV5A 3NEPX 4EY3A 5WRFA 2VFAA 4DB4A 4QBKA 3C5WP 3NIFB 1PK9A 3ASUA 1MX3A 1RFGE 2XHEA 3H5VA 3E3NA 2XIQA 2ZATA 4H3KB 4ZCPA 1NMSA 4W9MC 1V1RB 4MW5A 2C5LA 3TVYA 1JMYA 2XYVA 3EF3A 3KVOA 1OI7A 3UV6A 3NC0C 3A1NA 4BCBA 4DVGA 1JDJA 3G8AA 3KAPA 3KXKA 1LSSA 1FDWA 1EHCA 4LVOA 3TS1A 3ERCA 1LJLA 1CRWG 2FNAA 3H8SA 4OTZA 2ZSHA 1YMUA 5ER6A 2QP9X 4JP5A 3V8QA 3CWZA 3KJHA 2BKEA 2Y99A 2Z8YM 3IQIX 2BFFA 2VQ3A 1M2GA 5SYAA 5FKJA 4EA9A 2D0PB 3JASB 4LJYA 3FB4A 3E5RA 3GA5A 1X2BA 1Y8RA 1T35A 4LRUA 3U62A 1FRFS 3B53X 5CB4F 2XAUA 4MDEA 1CJUC 1TK2A 1TUBA 4JT8A 1EGAA 1JG7A 2ZREA 4TMWA 5CPFA 1E5VA 4MIYA 1KYQA 5CA0B 2AEFA 1C0EA 3LIIA 4WT7A 4QC2A 1LK5A 5TVKA 4ETMA 3FTFA 4F12A 3HY3A 3S28A 1P44A 3CH5A 1PWXA 1UZUA 3LUAA 3P94A 3PUHA 1Y33E 2VJLA 3OE7D 3LDUA 4BRWA 3A3YA 4R05A 2RAUA 3NIBA 1A76A 4KZPA 4GS5A 4ZFNA 2C7GA 1G20A 2IYNA 5HIKA 5JRDS 5ELMA 1E9AA 2CWWA 3MMXA 3OX3A 4P93A 1HMPA 4ILEA 3UMJA 1R0LA 3N87A 3NHMA 4GKVA 4PZPA 1R5OA 1RZRD 1ULSA 3FGOA 3CZAA 1K0UA 2FZWA 2IHTA 3F96A 1NT2A 1IQRA 4RBNA 5CGZA 3U40A 1AXEA 4L5IA 5AM4A 2AD5A 4II7A 5FULA 3UEOA 1CNEA 1EFAA 3UC9A 2P8JA 1A96A 3EDYA 5IAKA 4H7HA 5BYJA 1EZ4A 4U9IS 2AOWA 4HWOA 4OQDA 2BE9A 3DBRA 5HMMA 2QRLA 3OEYA 3QSGA 2AOUA 1V0JA 4OSPA 1WSDA 5JS2A 1U0BB 3FBTA 2ZVDA 3VQTA 2GBFA 4C04A 1E3TA 3BHMA 3I9OA 5FB3A 3TIXB 1GKIA 3BXEA 4DQUA 2OQIA 3VNSA 4JI6B 4NK4A 2UZ4A 1ADYA 2OGWA 4BNNA 1VRWA 2UZAA 4KITB 3I2YX 2XYHA 1I3KA 2BL4A 5CIQA 4ZVQA 4TV9B 4X3PA 1VG1A 3H83A 4HLCA 4JY7A 4Y8VA 5EP1A 3KT0A 3WL6A 1NAHA 3DYBA 4RHCA 3HBMA 2NU6A 3UOAB 3P0RA 4YRQA 1U04A 4J1TC 4JKYA 1H93A 3VHRA 5C18A 3MOIA 2VRBA 3W8NA 3RIYA 1VB5A 1J42A 5T4EA 1XZCA 5E2BA 4XRGA 2QUAA 2Q8PA 3SK0A 1ZD5A 2OCPA 2YWDA 4MPPA 3ZWPA 3C8MA 4GPTA 1KNQA 1TRHA 2HGSA 3IP6A 5DKFA 5KYVA 2A4KA 3AMVA 3CU5A 2OGTA 4YXFA 4ZDIA 4CTOA 4LSWA 2UVQA 3HVHA 1QRAA 4IIEA 1O87A 3AF5A 1M2KA 3AR3A 4A91A 5AESA 1A2BA 2WWGA 1TF2A 2INGX 3O73A 4OF4A 3OOEA 4MI3A 1JI3A 3FM9A 1CYDA 3ITDA 4ZZ3A 2F3SA 1S8OA 4Q3BA 1CJBA 2DWCA 4AJNA 4I0WB 2XE7A 1HT3A 3MJTA 1TI7A 3RBZA 2EVWX 1ZBDA 5EJFA 3GFRA 4YYEA 5HOEA 3SX2A 1Z2EA 1PTKA 4CMCA 2FPSA 5HRUA 3DYIA 1J07A 3ZLJA 3HCCA 3AKEA 1D6JA 3ZQ4A 1WOMA 3KZXA 4E21A 1K7FB 5DASA 3G2PA 2CHUA 3H5TA 1I5RA 3INRA 4H77A 2R8BA 1B26A 2HDWA 3ESDA 1U8FO 2VT7A 2E37A 3D4IA 4YBRA 5DHPA 1OX4B 3BD7A 4D6PA 3AVYA 1KR2A 2ZDGA 2NXJA 3GLUA 4H16A 4OXXA 4TTIA 3TLAA 4AX8A 4DZTA 4EB8A 3FGPA 5KQSA 1WV0A 4DSOA 4K9RA 2LCIA 5B37A 3EGDA 3HLKA 2R8XA 3JQAB 4DMLA 1CQPA 2NPFA 4G1CA 1FFHA 1JU3A 2W2PA 2ENUA 3JCZA 2IZ7A 1M0SA 3P0IA 1O77A 4Z4GA 4MGYR 1WB6A 1JEQB 2QW0X 4J2OA 5KWSA 1CF9A 3B9BA 2NAFA 4IIJA 1YR2A 2B7LA 1YS4A 3G2JA 4JMPA 4MR7A 4WVFA 4E03A 2CNDA 3GT3A 5LMUB 2G67A 4FYMA 3U80A 4Y2TA 1ONNA 3E9ZA 3KUXA 1U3WA 3CEAA 2P90A 3GGGA 2PXXA 3PJFA 4JLWA 4K81B 4RHYA 5BOVA 1TEVA 3GO4A 4BCCA 3FH0A 1Z3IX 1JKMA 2ZIGA 1JHYA 4G23A 1OT5A 3SIRA 4KLZA 4KVGA 4WL0A 4EMTA 4ARSA 1R3DA 2D4HA 1B41A 4F11A 4RJ2A 2B35A 2Z2JA 4YC7A 4QFCA 2ID9A 2CV0A 1PKEA 5IAAA 2Q9AA 4R9RA 1OOEA 3BRSA 4LTMA 4JA0A 3LHDA 3WK4A 1WDMA 1C2YA 2A1UA 3DCIA 3ZWBA 2O2YA 5JECA 4G1FA 2QX6A 3QJYA 3PUVA 3A1DA 3O4RA 3PFCA 1LKZA 5GV7A 3UPTA 3H16A 3EFOB 1V7PC 4JI5B 3B1YA 1OYVA 1NM5A 2AHRA 3E5HA 2XQKA 2W2XA 4P3OA 3F46A 4XE5A 3CW8X 5GOTA 4Z51A 5JD5A 1NIJA 2NZJA 4L8YA 4GGOA 3AHHA 2WYOA 2RGUA 3ELDA 1EAMA 1NURA 4C4AA 2N47A 5ETJA 5K8VA 4FQ7A 3PQ4A 1A5SB 1MT0A 1IDN1 1O6BA 4XGKA 2PAAA 3RSGA 2JK0A 4C03A 3D64A 2QL9A 4FU0A 2DSTA 3LWZA 2W6PA 4I5EA 3EGOA 2GYYA 5FLKA 3R8XA 2ERCA 3OE4A 5L9AA 1KFCB 2J4DA 3VYWA 2XV1A 1ICIA 1N9GB 4F4CA 3S3TA 3CISA 1DKNA 1V3QE 1SBIA 3BQ9A 2I2CA 3LYLA 2AN9A 2PV7A 4OREX 2Q3CA 3P2MA 1AUOA 4C6TA 5IJ9B 1QONA 1THMA 4B74A 4ZN6A 2P6UA 3LF2A 1FFGA 2IITA 3Q9UA 3NIDB 1GQFA 3I05A 4P32A 3EWIA 3W2TA 3HN6A 1CIPA 1G7CA 3PDIB 4IIUA 2ZUDA 5EXPA 2J0UB 3ZGOA 4MDFA 5IHXA 2GNPA 3EQ2A 3DDSA 1PQUA 2REOA 4CR8A 1YGYA 3OKAA 2GK4A 1EX1A 4B17A 4BO2A 5LZ9A 3BJEA 4G9EA 3AR8A 3CR7A 3EISA 2H5EA 1CPYA 3MTBA 3A05A 3SP1A 3TZ6A 3E0QA 3PQ6A 4JJFA 2XPCA 5AK3A 3HU1A 2KW5A 5LA6F 1W0KA 5TT0A 1M2WA 2BEJA 1Q0RA 5ALFA 4B4KA 2BGGA 4X24A 3A9UA 2JD1A 1IUPA 5K05A 4LXQA 3OTGA 3AB8A 1USUA 1P1IA 1TJNA 3C3EA 1FPQA 4CMIB 1RLTA 3DLAA 5JAHA 1U2GC 1Y1PA 2N3ZA 4PLCA 5K3CA 4OBXA 3WQRA 3G0DA 3ZWKA 2IS1A 2G9ZA 1X14A 4IKEA 4IMPA 1S1MA 1T0HB 1Y9AA 3QVWA 1HMYA 1QHYA 2D0OB 5JJBA 4Y9SA 3DE5X 4QXPA 4UHHA 1AKUA 1YB1A 3EVEA 4YFVA 3QLUC 4I5IA 3GLIA 3JQPA 1YJ5A 4WESB 4QA9A 3DW3X 4DSNA 1GTRA 4XUDA 3IOCA 1ZKDA 3H8VA 2ZUVA 4GDMA 3P8ZA 2OHFA 4AJPA 4P22A 2XYPA 3RS5A 1VCNA 2CWDA 3EQZA 1J06A 2VJMA 3T52A 1VPTA 4DV6B 4X61A 1I3LA 4EW3A 3D7MA 2JJ1D 3AERB 3FPKA 2HL6A 3UJHA 3ADKA 5CIYA 2Q1XA 3BL6A 3D8RA 4AKSA 4AYTA 4RY8A 2IUTA 4A5SA 1XZFA 3R3ZA 3TD2A 4L22A 5ER9A 5BQPA 3RRBA 4LYFA 2V3WA 1NPTO 2VBIA 3H9CA 3ZU5A 2ZB8A 3RJ9A 1ZFNA 4MUKA 3T7SA 2FETA 2JATA 1ZSYA 3KAKA 4O0MA 4EPRA 1KVRA 1CWUA 4MXDA 1GFZA 3GNSA 3ODGA 4F4DA 5IH7A 1QRSA 2VSQA 2YHIA 3RBXA 1J8VA 1KKLA 4NPAA 4QGFA 4JEUA 4FK8A 5KCMA 1YR3A 1RYZA 3FTQA 4TLDA 4BWFB 2VTBB 1QQ6A 3L8CA 3WP0A 1UBCA 3SQNA 4UU0A 2H08A 3D8BA 4D9HA 3VM6A 2X3UA 4NV0A 2H00A 3H3XA 4WKCA 3ZE8A 1M6VB 2UUCB 5K4GA 3ILHA 1QTQA 4Z86A 1U3VA 4D8XA 3QNWA 1HZJA 1UFOA 4KO2S 1PK8A 2OCKA 2DXIA 4W6QA 1H2BA 4JODA 3MOGA 3IT0A 2R48A 3NQ41 4LY3A 4TKLA 4Z7QB 3PEEA 1ZIOA 1EJ2A 3UMGA 3GW8A 1I14A 3DWIA 3PHHA 3R9KA 1GTJ1 3HH8A 5JMPA 1UDBA 1VRVA 3ICPA 3HXPA 1L4EA 3I01A 5JS6A 3U0VA 4ZMSA 3D4OA 2F43A 1G8HA 4TSFA 3T7TA 3P9PA 3ZWAA 2V0GA 3DL2A 2VF5X 4FPXA 3IBYA 4IIYA 4COKA 3OWXA 2QQGA 2O1SA 5AUOB 1D9XA 4XX0B 2HDOA 3E22B 5IM5A 2W7TA 4WKPA 2XDYA 3SKXA 1HGXA 1YUNA 1VMIA 3LVBA 1GA4A 4UFOA 4I4TB 1PCXA 4IDCA 5HZGA 2C5BA 3MWLA 4NFSA 4LF5B 4QTZA 1C9JA 3P52A 3CVXA 3L8ZA 3D8UA 1E1NA 1PL8A 3D3WB 1L4LA 4J91A 4PN3A 3PHGA 3K0BA 2P9BA 4BTLA 2F1RA 1X92A 3MT0A 4RJTA 2Q5JA 5J43A 1L7RA 3W2IA 1DU4A 2ODQA 2Y1KA 4R41A 4KC0A 1VG9B 4KWCA 1GG8A 4RZUA 5H68A 2XLCA 3TZHA 1YOBA 3RJTA 4FFWA 2I2XB 2FPLA 1W4RA 1NFFA 1N0WA 4O2AB 1Z6XA 1Z6YA 5DBHX 1K2VN 4CL3A 5B7PA 3ZDEA 3ABRB 4BGEA 2Q6KA 1UAGA 4I1UA 4YRLA 4NP6A 4BN4A 4H6XA 1PI3A 1XHFA 5M3BA 4DCJA 5EJ4A 4Q7JB 3WLTA 2YNMC 1PVDA 2WWWA 4UOEA 4E0BA 1LV8A 5T41A 1JQEA 1PX2A 4EY8A 4X1YB 1PJQA 4I9UA 3A8TA 4NARA 3MXOA 2XZLA 3MM4A 2AUMA 5L7YA 3FWYA 3L7CA 4WK2B 5E9AA 4PONA 4RVNA 3OTIA 4ZANA 1ZH6A 1RFLA 2F6RA 2I2DA 3LX4A 4YRZA 3WGUA 1F9EA 4LYYA 5AHRA 3VNQA 1GGKA 1A8PA 4ZYTA 4LSGA 2Q6IA 1R8XA 2V8BA 4URWR 1AKQA 1J49A 1NHGA 1I32A 2HA7A 1S96A 3S68A 1DUSA 3OJLA 2PRIA 1DP4A 5TGZA 13PKA 3A1VA 8MHTA 3EGCA 3IESA 4AL4A 3RAJA 2X4LA 3FTPA 2P9ZA 2V7TA 3GJQA 3BE6A 1H0SA 2AFRA 1C80A 4F9FA 5A4AA 4LJLA 1ADJA 1IEQA 2Y66A 4YCSA 3O8BA 1S0UA 1A71A 4JR2A 4XPIA 1PLJA 2Z3VA 4Q4HB 3DV0A 4RC9A 2X0IA 5T4HA 4DMUB 4MULA 4WN9B 1I3CA 3BRQA 2GB4A 2X6QA 3IHWA 3C6YA 3QVTA 4Y0VA 2LIPA 2J48A 3FLEA 5B2EA 1FVFA 3KKPA 5ALDA 5G3ZA 3I37X 4RAQA 5EWMB 3T1TA 4B7CA 5BRJA 1M2HA 4HZIA 3OO1A 5DTEA 1F14A 4BLWA 1D2RA 3ZVRA 4B1FA 2Z2KA 3FVWA 1WU7A 3U7HB 4BO0A 1ILEA 2A84A 1F3OA 2HC9A 3W0LB 1XEAA 4HVTA 3IJPA 3TAUA 4UQPA 3UAVA 2NUTB 1HSOA 4F6RB 1MGOA 1V1MB 1TYDE 4NV3A 2F59A 2C2MA 1BG6A 4IIHA 4P4LA 2GKSA 4KO4S 5BV2P 3O8NA 3HUDA 3WLNA 3NBYC 2PA0A 1W2GA 3W5SA 2GPTA 5E1BA 3WB1A 5FPPA 2ZJAA 2H7XA 4JWKA 2I91A 5EG5A 4NCAA 4NICA 2ATCA 4M60A 2DF8A 1JFFA 1J2EA 4GZ6A 3THSA 4C6RA 4EKNB 3HHEA 3RIXA 4OA5A 4KSYA 2Y1EA 3L9XA 4WW0A 1FTYA 1CUZA 1T4BA 3ZNQA 4KK4A 1W0JD 3ZHYA 4B5LA 4BB5A 3U4QA 2RGGA 4PBTA 1FJ2A 1UMCB 5D86A 3X1XA 3DH0A 3F78A 1JPVA 4HKTA 1KERA 3M2TA 2C61A 1YZ3A 3DV2A 2H1IA 1U98A 2YN2A 5JMOA 3MWKA 1KYWA 5H8WA 4MVJP 3JZFA 1PZEA 4KRFA 2D2XA 1RM3A 1IOZA 3GG9A 2VT3A 2VAPA 1EP3B 3U9TA 3C0KA 3SEAA 3Q3JB 1SVWA 2IPLA 4JLSA 4BZZA 1U1DA 3EGXA 3VZDA 1GZVA 1X94A 3WGZA 2ZJ5A 3EC2A 3ODPA 4MS1B 1E66A 2X1HA 3BRCA 4MUMA 4C07A 2PMCA 3CE9A 1T1SA 4YXWA 1U0NA 2OBLA 2XDAA 3B7GA 4IZOA 4RX1A 4GOLD 3C8UA 4HNSA 1GSHA 2JAHA 2TMYA 2ZPUA 3QY9A 3AEQB 1H5UA 1EB8A 3BGDA 3WISA 4A10A 1K88A 1YKFA 1D03A 2XGGA 3KKEA 2VCYA 2OTCA 5LU8A 2ZT7A 3AUUA 5DNAA 5A3QA 3KHTA 2J4FA 2QVZX 2DJIA 3NVMB 4GXNA 5I6DA 4W63A 4ZCQA 2V74B 1ONOA 3NS7A 4GMHA 1O54A 3IE2A 4L78A 1Z0UA 4ZI5A 5E3HA 5LDHA 1W46A 2KLBA 3NETA 2ZBVA 4P6VF 3RVOA 2HXGA 5B1EA 1PT8A 1G21E 5JATA 5MFPA 4JX8A 3BORA 4BRUA 2E4ZA 1RZVA 2I6FA 1YB4A 2IXAA 3AHIA 3K2QA 3LA8A 3D54D 5DNUA 5JRJA 3GMDA 3VR2D 4KPFC 1L1FA 2FCAA 2DQZA 4Q9JA 2PRKA 3L01A 4LJ6A 3GARA 1UJ6A 4CM4A 1F60A 2EXXA 3CZ4A 4U7HA 3BMCB 3TNDA 1IHUA 3Q5GA 1IN1A 3TAHA 1S4QA 1EIZA 4CEJA 1XWFA 1KGSA 3QEKA 3U13A 3KZCA 4C4ZA 5DRTA 1QS0B 2CLFB 2V7QA 3PR3A 3KS9A 5FOUA 3ZH9B 2RI0A 3Q1KA 2D74A 4PF1A 5T6MA 4JVNA 2GF2A 4AJHA 4D6XA 1AOXA 2QPOA 4Z6KA 4L8WB 3GEEA 1N0IA 2FVXA 2P4SA 1PL6A 4KXUA 4K0RA 3UHJA 3DPIA 3CMMA 3N0XA 2BJWA 4W9RA 1OBHA 1MX1A 3VO2A 5KWEA 3MWGA 3WKCA 3B82A 4GPAA 3D43A 4A15A 1G98A 3RT1A 1QTNA 2GFHA 1JDZA 3KZNA 3H84A 3I8XA 4ZDWA 4DJTA 2F43B 3NJRA 1JDSA 2AWOA 5CGQB 5F4BA 3TI7A 4Q9LA 4E15A 3JQ8A 4YI5A 3FF1A 1ESZA 5BSKA 3UANA 3A7DA 3OKFA 5FAXA 3R3JA 5KUTA 3B8HA 5EVJA 3RTCA 1PR3A 3RLIA 2QP4A 2XWQA 4V0NA 2H5IA 3ZDXB 4G25A 4YHBA 1IMJA 1XTIA 2QMOA 2WQZA 2O5CA 1OAOA 2A0XA 3CUWA 5EHZA 1YF3A 1TM7E 3TPCA 4RZ2A 1T8WA 5CXXA 5KREA 5BR8B 2FPIB 1A69A 3QMVA 1GZHB 1Q15A 1R6AA 2WVAA 3G5LA 4TL9A 4RKEA 4TTVA 4BLVA 4EJ0A 2V5VA 2E7ZA 4IO1A 4U7DA 4MS3A 1P1RA 4ZP1A 5JAQA 4ODIA 3AC0A 1L7PA 4DDUA 1EQUA 1EGVB 1JIUA 3QLTA 4KN5A 2II6A 4UPDA 5BYBA 1AV6A 3HKDA 3AGQA 3LT5A 3DD5A 3WBJA 2IHBA 2HT6A 3QWFA 3WS7A 5JTTA 3CR8A 3E9RA 2B34A 4PPGA 2I6TA 2EFCB 2P2NA 1RHUA 3UJBA 2BFMA 4L8FA 3SZGA 1CERA 1MB3A 1MTZA 2J6CA 3HVJA 4L15A 4A8JA 2WT9A 1EFPB 5CX1B 1U31A 2AUTA 3ZZ1A 2BI7A 1E96A 2QTFA 1INLA 4BNLA 3G7SA 4BYGA 4UBKA 1FQKA 4UU8A 2XMBA 1GDDA 5LLDA 3T4PA 4GR4A 5C4MA 4P35A 1Z5VA 2ZIXA 3QX8A 2FW0A 3TQRA 3AESB 1NYQA 1IXSB 2AC2A 4R7GA 2X0KA 1U3DA 1XQXA 2BTOA 2WPNA 2XE6A 4HEJA 3NH9A 4ZAGA 1ZGZA 3IPRA 2VNAA 1KO1A 3TG8A 2IXFA 2FX3A 1H22A 4A2CA 2WWYA 1Y8RB 2NTVA 2YXLA 3H0EA 1T9GR 1HC7A 4MV0A 4BB6A 5KMGB 3LXUX 4LOHA 5AVUA 4D7AA 3HKCB 1NDQA 4CM1A 1KP2A 2APJA 4B7XA 4NV1A 2RBGA 1FRQA 3PQEA 3UWPA 2QT1A 4CIVA 1YDFA 2OXIA 1I7LA 3VH3A 2Q8QA 4YCCA 1EFLA 1TCVA 1X0XA 2GN2A 2DFTA 2PH3A 3QPDA 4EGJA 4CTMA 5GZ1A 1C2TA 1L3BA 2OL4A 1XRQA 1P7ZA 3LGAA 1U9CA 1QHFA 2MT9A 2J9RA 3IPCA 2HLDD 2IHYA 3BHIA 3L84A 3LX8A 3R23A 2PUJA 3O2JA 4K9SA 3R7BA 5INTA 5C51B 2CDBA 3MJDA 3CB4A 4LG1A 3E3LA 4OX9Y 4HFMA 3VUEA 1B73A 2BFBB 4MUIA 5C53B 1XZQA 3PFKA 4II3A 4EHKA 1Y37A 5DYYA 1T10A 4FSDA 4ZT2A 4MRMA 4ENPA 2OAQ1 4RM2A 4V0LA 3U3JA 5TLSA 5LP6C 2K5UA 1I1QB 1RKVA 4B44A 1Q7EA 4GMDA 4IFTA 2I8CA 3UJ8A 2IDJA 1P33A 4P9NA 3L0CA 2B1QA 4N47A 3KYBA 4NJOA 3Q88A 1G7TA 4TL7A 5AI9A 1O97D 1WMAA 1T9CA 1XWIA 2CJWA 1A98A 2JHPA 5L53A 1ENOA 5LP1A 3B1ZA 1YMQA 2ZBDA 1E20A 3K1AA 4G86A 4UJ5A 2P69A 2Z6AA 1FNSA 5G3YA 3WK9A 2WJPA 3TLZA 1VIMA 3PZBA 4CBVA 4DR1B 3BAZA 1HT1E 2NYUA 3IO5A 5JSZB 4I99A 1KY2A 1Y1KE 3HRIA 1A8UA 2EX0A 4HDKA 1XN4A 3HWSA 1MAAA 1DVRA 4JU9A 4KLCA 3MJ4A 3L1VA 1VIDA 4DNPA 5A6SB 4FYVA 1E9DA 2ID7A 3PHLA 4WJLA 3HB9A 5JADA 1T4GA 3QENA 1PSDA 1FFSA 4HLUA 4NZ9A 3HCEA 4URYR 5F4ZA 4TL6A 5KDLA 5B53A 5ICEA 2OAEA 1XCLA 2PKRA 2W6QA 3TTUA 1C7QA 2IBMA 3N74A 4GP6A 4J0KA 3G5AA 4OHZA 3Q9NA 2H4XA 1R9NA 2AMFA 2CNBA 4OQQA 3DW1X 5EKTA 4OYHA 4MQEA 5JZVA 1UOQA 1XNGA 3ETJA 4YJ3A 3CS3A 1E64A 3OAAD 4RVSA 5E6SA 2ZI3A 1C4KA 2NUTA 1U1EA 4GVXA 1I3NA 2NUBA 4MV3A 4WNAA 1SNYA 5IRCD 1KYXA 1Z16A 2CUNA 4ZQCB 3W9BA 2DWQA 3CRVA 2N46A 2I2WA 2XTMA 2YCLA 4MGKR 4CF6A 3ETLA 4NF2A 1EXMA 4WOCA 1DIRA 5CR9A 3RU9A 4ALLA 3P19A 4E13A 5J63A 5KB3A 1MW9X 4MH0R 1T2CA 4XUEA 4I9HA 2FP3A 4M7OA 1TKBA 4DCVA 2GT1A 2GX6A 5F2KA 3L4KA 3I2FA 3BILA 4XIYA 3LUJA 1T13A 3U7RA 5ELLA 1UIRA 1XNJA 1LVUA 2Q3BA 3AVQA 5DIZA 5L7WA 3TW8A 2FPMA 4K6OA 4DUZB 3RG8A 1T9HA 5IJXA 2QGNA 1OZHA 1WUYA 3WNDA 2D5AA 5B6PA 2GO7A 3LY7A 5K0CA 3WNQA 5C5DA 1Y9JA 2B0JA 3MS4A 3KXIA 1XV5A 4UE2A 2HWYA 4DDTA 3IAAA 2EKDA 1SXHA 3OY2A 2QVBA 4OQ4A 4UD6A 3UKJA 5HQ3A 1PJCA 3BFPA 4R3UC 1V2GA 4FM9A 1P4JA 2OZLA 4S3MA 4XQ9A 2HQSA 3MJCA 2QR2A 1FP1D 3H19A 1ZC4A 5E3IA 3OPMA 2UYOA 5JFGA 3KBOA 3LS2A 4I7EA 5LBIA 4DT1B 4LXTA 5DLPA 1UEIA 3CNHA 4RCYA 3DO5A 1L6IA 1BXRA 1W25A 5FPQA 4KQIA 4ZVUA 5JCXA 2EFJA 3GRFA 2P2CA 5KIAA 1QAMA 5H80A 3L04A 3GZTB 3OLVA 3HSSA 2ZVJA 2XOEA 3COPA 3TW4A 3WSVA 3ROGA 3ZG6A 1KETA 3K31A 4JLVA 4YCDA 1E1KA 1TCBA 1V8OA 2BM0A 4Q9HA 4EY6A 5GIOE 3CX6A 4KR6A 1FSPA 5BSHA 4NBKA 5U1PA 1ML3A 2YRXA 4XH9B 2WFMA 1WTCA 3VPCA 4CKWB 4XWAA 1V5EA 2PMEA 4C4SA 4AJKA 2EARA 3RS8A 4ARUA 3O4HA 2QTTA 4CF4A 3KEGA 3QK7A 4RHUA 1MNAA 3F67A 1FUUA 3JVEA 4WXPA 2CVOA 1EK2A 1X1CA 4L3OA 1G5FA 1Q0LA 2V6FA 4O2AF 5D7NA 1FJHA 2G8NA 2G6BA 2DLNA 1V26A 2GEUA 2B99A 1Q84A 4S1OA 1IVSA 2FH5B 1OFUA 2AFHA 1SEPA 2Q0XA 4UVIA 2QTLA 3ABOB 3VR2A 4RLSA 2XB4A 3STUA 1Y1QA 1P91A 1CC1S 2XRFA 3HDGA 3K53A 2YWCA 4QTUB 5I9TA 1CLUA 4TYWA 3ACDA 3RS7A 5KQLA 4BO5A 2EC5A 2XXBA 1PX0A 2DRIA 4H31A 3LYAA 3EFOA 4N9WA 3SS8A 1AZLA 2VL7A 3E7FA 3I8OA 2GPJA 1POWA 1FNCA 3NKFA 4J0QA 4FBLA 3TSZA 3Q10A 3ZXXA 1UJNA 3BQNB 1E58A 2E21A 2W5UA 2QUHA 4RPKA 5FEMA 5TS3A 5EEHA 3USCS 4LHWA 4R7ZA 4RH1A 1YZVA 2RGBA 1JJVA 3T9AA 2BSAA 1JJ7A 2HSDA 4RHTA 1ZI6A 3U6KA 4JI7B 5IVHA 2DUMA 2WAYA 3LQ2A 2HPAA 2OORA 4GICA 3EWAA 1UXJA 2Y1WA 4GR9A 4XDHA 3AETB 3OLWA 4GSLA 3C6BA 4E09A 4L73A 4NYIQ 2JI4A 2HAEA 2BC9A 4BC0A 1XOIA 3HKCA 2MYPA 3EPRA 3QX9A 3WGHA 1E9VA 2RAPA 3D3JA 3GZJA 3O84A 3V7NA 3QM1A 3VSBA 1JLHA 4YRSA 2FUKA 3KL4A 3QFSA 4M76B 4LX0A 2IWRA 2IIBA 3TPFA 4BAGA 1EFRD 2JHFA 2NSHA 4FFMA 4RA9B 2JLRA 2JLCA 1AQYA 4I4CA 3TTVA 1C4XA 1GUFA 1L0BA 2D1YA 1GYQA 1UPUA 2F9LA 2FQYA 3BSFA 5DK6A 2O7NA 2H54A 4QULA 5CA1A 3HA2A 4L9WA 1IOVA 5CDFA 1W4AA 1WE2A 3M6WA 1NI3A 2HA6A 2GHRA 2QNIA 1EWVA 4B6OA 1E9FA 4W1SA 3NUZA 5DXAA 5K8CA 3IJEB 2GA8A 5KEIA 3AJAA 1DRWA 3LVRE 1CY1A 3STYA 1EBBA 3U49A 1QNFA 2OCXA 3V1UA 2VDVE 1F2TB 1KAGA 4MAAA 3RC3A 3AZPA 1RMTA 4FR5A 1F51E 2R8PA 4JEIA 4DPMA 4EGAA 3OIVA 1QP7A 4DVJA 3CIOA 1GZ3A 4DY6A 1X9HA 3EDOA 2W2OA 3GRAA 5DHQA 4MWCA 4IQFA 2AR7A 4UARA 4NBLA 2HIGA 4W7HA 4LXIA 3BC1A 3H4VA 3L7MA 2FLKA 2XUDA 4XXHA 1WWKA 4NC9A 4YN3A 3SNKA 4AI6A 2AE2A 4FONA 3QU5A 5CB0A 2OPHA 4JSTA 1RWWA 2HFJA 1PQYA 4S1WA 4UHJA 5CM2Z 4PHTA 3TTWA 1H6CA 4AUEA 4D8UA 5BPFA 2OFOA 1W48A 3CKKA 5AHKA 2JJQA 1RSZA 3DV0B 5E6RB 5CDFE 1RAEA 3UMSA 2ZB2A 3PI6A 3QX7A 3X43A 1O9HA 4QASA 4D8WA 3M5CA 2OP0A 1RMYA 4FIDA 2RI6A 3CFYA 4O2BB 3GDWA 2FUEA 2IZ0A 3ZD8A 1SQ5A 1EE9A 4DV2B 4QUJA 3KOXA 5F7XA 5DGXA 1H1DA 5GPBA 2A0WA 2HF8A 4TQ9A 2WICA 5A4KA 1QZ3A 3MSCA 2WY2D 2Q6OA 4B35A 4JJZA 4ZVKA 5HNKA 1VMDA 1W75A 2OB1A 1MOPA 3T5DA 4F2DA 3G6WA 1C1XA 1XMQB 1KO8A 3Q3IA 2BP7B 3R44A 1J00A 2QYHA 4FCCA 2CC2A 3EUFA 3I42A 2HGZA 4M0KA 4MQUA 2GZ1A 2UUOA 5GTDA 2MTBA 4G0QA 4YUAA 4YRKA 2ZRQA 2ATVA 2W8BB 2G1PA 1PF7E 2OLEA 2VHVA 3KDAA 1GZ6A 1TYCA 3HVKA 4FFVA 2ZFUA 4PO8A 4UE3S 3GLGE 2XCSB 1RWOA 4JQYA 3TSCA 3V48A 4OHBA 4PLFA 4M87A 2X5OA 1T1JA 1KRHA 1MZPA 4O2BA 4HNHA 2ZSEA 2GYWA 3HPRA 3IUYA 2VJOA 2ISQA 3O1JC 3QMMA 4AVYA 2BMDA 2E82A 2WUDA 4V2IA 3P9SA 4GKBA 1IDOA 1U11A 2YRFA 3ZPXA 2XT0A 3QVXA 4MINA 1C7JA 1YRYE 2XUPA 4BNKA 2RE8A 3GBVA 4PLGA 1ZDMA 2OZLB 1L5ZA 2P9JA 1AGNA 1M5TA 1RAHA 2OCLA 3STTA 5JE8A 4BB9A 4QTYA 2O7RA 1QC5A 2WJVA 4ZIRA 1P9RA 2B8TA 1U7HA 2ZSKA 2PLAA 4HSGA 5F76A 5AYVA 3UATA 4JLAA 2CMFA 5L8VA 3U6BA 1UM9A 2FSGA 2DPYA 1T25A 2HHAA 3OIFA 3CV3A 3EW9A 1N5RA 2QJFA 1L5OA 3QHAA 2OC4A 4QDJA 2DUWA 1QFZA 2H92A 2GWHA 4ML3A 3BSWA 2F3UA 5KYWA 2PQ2A 3AF0A 3FW1A 3H7IA 2GPSA 3BRWD 3D6FA 1KOGA 5FHRA 4GL2A 1YTUA 1OF1A 4NDZA 3SZOA 3BMNB 2ZJFA 3Q72A 2RCNA 3KQQA 1NLMA 3IRUA 2EU8A 3WL5A 4NONA 1F38A 1XXLA 5BSUA 2C5AA 4EG1A 3O31A 4RL6A 1IOWA 1YB2A 4G9BA 3L4BA 1CUJA 2DSNA 1XXHB 1QLWA 4NCJA 1AKVA 5FFMA 3R6LA 2W11A 2R1VA 3ESZA 1BW9A 4F56A 1SU7A 1U7XA 3B3AA 1DZIA 4LISA 1PFQA 5DHAA 3ZBUA 5JDCC 3HB7A 4LQDA 1JYSA 1U2TA 2VCHA 3JQ7A 1HEUA 3O93A 4D0RA 2A5GA 2X14A 3FDIA 4JIMA 5FLEX 2O06A 1XPRA 1Z4LA 2QLTA 4HB3A 4HI0E 5BYKA 1YR8A 5CXSA 2DZDA 1RLOA 1PQ4A 3KYIB 3VX3A 1T8RA 2UV8A 3ZXIA 4BQFA 4RHEA 4BQNA 3BIJA 5TE9A 4ZEMA 4UTNA 2D00A 4RORA 3LUPA 2AEJA 2FEPA 4N5LA 3RVSA 4UTPA 4Q1BA 1J8QA 2PBRA 1YRLA 1MIHA 4H59A 3C15C 3SR0A 1CQJA 2A33A 4I4IA 4IIVA 1V5GA 2WU1A 3OTQA 5C4IA 2ZRCA 1LBQA 3HFSA 3S8YA 3JQGB 4XRRA 4BJ6A 3LY8A 1BE0A 2D5IA 3AF1A 4U00A 3RGGA 4RFSA 4MV4A 5EKSA 1K66A 5LXTA 3JV7A 4WFIA 1T4CA 1DBVO 4QJ5A 4RTQA 1Q1GA 2CD9A 2H4JA 2JCVA 2QY9A 2ZJ7A 1CETA 3L1UA 1J22A 5BN4B 3WGYA 1BJRE 3NWOA 3E53A 5K0EA 2C1ZA 2I8AA 4L4SA 4UJ3A 4ECAA 2Z95A 2CMGA 1UWLA 3HUUA 5F1PA 2PBLA 2CZGA 4G5FA 4LOAA 3EUWA 4ZV7A 5IJWA 5L3QA 3FPSA 1CY0A 5I7RA 1TE2A 3JQRA 4O4HA 5D3ZA 3FVRA 1QJ4A 1ZO8A 2XH8A 5I48A 4J7CA 2DUNA 5K0TA 2JIDA 3ESRA 3KHSA 3PNQA 1IY8A 2RONA 1GCUA 4EFNA 5GGXA 4UM5A 2ZI4A 2G83A 2PKEA 4P4UA 5KJFA 1Z4OA 4QYIA 4G56A 1J5PA 4HWTA 4GP7A 1PT5A 4PCVA 1DIBA 1SHZA 1ZNQO 3E48A 3L7AA 4P31A 2NTNA 1JSLA 2A4MA 1Z7BA 2C9OA 3M6IA 4H4CA 5T4BA 5IKPA 2BH2A 1JHRA 3KAQA 1ZY2A 4B4OA 3ZCUA 1NG9A 4AKIA 2VNIA 3M4ZA 5HM8A 2ZBFA 2O8NA 1E9EA 3Q3EA 4OQZA 4QYSA 4JBGA 5KAMA 3QE3A 2AT1A 2NIPA 2ZE5A 1US8B 3R2JA 4JQZA 2WWXA 1ZI8A 3AJRA 3JYLA 2AF4C 4ZO4A 2JI6A 1VCHA 2O5EA 4UUMA 2X3FA 3IV6A 1EM6A 1X1SA 2Q49A 5JFOA 1XEXB 2R00C 2QD2A 1O2DA 2J30A 1MB9A 4IDGA 4B7UA 2WFLB 3TKLA 5IF9A 3GG2A 1G55A 1U7PA 4AZVA 1P2DA 2FCRA 2H1SA 2D6FA 2J5XA 3Q40A 3AUYA 4WCDA 4H7EA 2GDZA 2JJ8A 3D0RA 4HMPA 3IKTA 3GP8A 4LQCA 3UHPA 3RYFB 5EC8A 2GKOA 2FWIA 2A9QA 2WVHA 1CHDA 3C1OA 2A94A 3K3PA 3MBIA 3NDIA 5EXDA 1EUQA 1A2QA 3IAXA 4JI8B 1UIMA 5EIBD 2H85A 2HSZA 2J9XB 1CVRA 3HNPA 4TVOA 9LDTA 5FPKA 5HQ3B 4RKQA 4RQBA 4AULA 3HO8A 4R8KA 1JQ3A 3A7EA 4DR7B 3BTVA 3V33A 2RHOA 2FZ5A 4WFQA 4MIEA 5CHYA 1AKTA 2V96A 2GBLC 1OLUB 1KORA 5ADUS 4M6WB 1NBMD 3PPWA 4OFWA 4HDOB 4HWKA 2YZ7A 5A5GA 3IXQA 2FHSA 1E1DA 2IT1A 3MGBA 1NW3A 2JDIA 3QA3E 2JGDB 4NU0A 1QC5B 1QQTA 2PGLA 4QBHA 4XLTA 5AJYA 1TT5B 3URKA 1JFRA 1QOQB 1CF4A 4WA8A 2G1UA 1WQ4A 2M6RA 3AV0B 3GLHE 4A8PA 4ZGBA 2B4QA 4RZHA 4G5QA 5IARA 1YR7A 2YC4C 3DTTA 4PNHA 4L6IA 3U3DA 2XODA 1J23A 3A9WA 1FFDA 4ZHQA 1P6UA 4G63A 1A5BB 2H1VA 4CMGA 4EY4A 1KVTA 4V1CA 5IFKA 1UPTA 5L40A 1YTLA 1EHYA 2Q5IA 2UYGA 2OMEA 1EXDA 1NQTA 1AHNA 2J87A 2CCKA 3OEED 5L3QB 4UD2A 2OHJA 1X70A 4FQ8A 3IJRA 4ED9A 1RI1A 2H48A 2QUKA 3KT3A 1ZX1A 2ZDQA 1JHZA 3ET4A 4BFLA 4ZEVA 1AZWA 5JH7A 3BFXA 3NDJA 4KFSA 4F60A 4X3OA 4YWHA 5BSMA 1YCDA 1XVUA 3OM8A 5JAIA 4HDCA 5TV2A 1Z07A 1GU0A 3T5GA 5J1TB 3D2AA 1FYWA 1Q22A 2QGZA 3H4TA 1DAHA 1O0SA 3KSMA 2ZM6B 4QPJC 5AKIA 4KZKA 1F3LA 1QP4A 3WWCA 2V7UA 4WLUA 3H65A 2ZAGA 2QN7A 3SWWA 2A5YB 3UJNA 2KPOA 3QE4A 5JAPA 1MEOA 4ICIA 4INPA 1GL9B 1WBDA 4MV7A 3VKVA 4CT4B 4JJKA 4JLJA 7ABPA 2ATIA 1WBBA 3K5HA 5M04A 4OYLA 3OFVA 1LBIA 2A9PA 4F93B 3HJTA 5DGCA 3B20A 4YAJA 5K99A 2QSZA 1ID1A 1R0BA 2PVCA 1JSRA 3SQMA 1ZJZA 5HFJA 1PGPA 4BBJA 1QOPB 3CX3A 3C6ZA 5A4MS 3PL5A 2GEVA 4HS4A 2XUHA 1V4BA 1BWPA 2BISA 1NV9A 3GLKA 2CDRA 5J5CA 2O8DA 1CRLA 1WEHA 2GEBA 3BE8A 1JPNA 4LZJA 3OOWA 3SC3A 2PZJA 4M9QA 2OUIA 3KPVA 4FP9A 1T2DA 1VL8A 3LCMA 2Q4OA 1L7MA 1E8MA 4PO9A 4QE3A 4EX6A 3PE4A 3KFVA 2CLCX 3DMNA 3GEBA 4M98A 4TKMA 3FG9A 4RTSA 3VYTB 3TE7A 1QH8B 2GD0A 4NQZA 3VPSA 2B4RO 1XD8A 1A7KA 1L9KA 3ITEA 2FMHA 4JOQA 4HT3B 2IQIA 2OHXA 5EJGA 3L6CA 5LA6B 3EHEA 3QMPA 4CCYB 4L6CA 4XR4A 2OCYC 1WKBA 2IU6A 4L0QA 4KPUB 4M6WA 5E8RA 4KR3A 4XYGA 2PS3A 4HGRA 3TR5A 2GA9A 2C4MA 4R81A 1X0VA 4ZTZB 3V1YA 3ADPA 1TX4B 1FUKA 1QE3A 2ZS9A 5GONB 4MLZA 5TSDA 2ZI5A 2BELA 1MB0A 3U3KA 3T7KA 3PGXA 4XQEA 1K4MA 4Z0PA 4ARIA 4D8YA 1LPOA 4B3MB 4ZVNA 3E58A 4LJ7A 2AFVA 4XIIA 4PAOA 3GUVA 1KMNA 2IOFK 1K7EB 4NVRA 4GXQA 5EWJB 2QUBA 1KSFX 2ZRAA 4H17A 2J3EA 3K8YA 1GGMA 3O0TA 4WV3A 1NMXA 4TQGA 1BCRB 5K0SA 1EK5A 1QKKA 2OLKA 4MCJA 3G2NA 2JHAA 4DBLE 3OPVA 5IDQA 2J6IA 3FGZA 4RS3A 1TM3E 4BFXA 2N1MA 3H5OA 4OB7A 3SZLA 3DZKA 1MVNA 4XDYA 4ZCTA 4U7JA 5KNBA 1HWYA 2VRCD 1J6UA 2OD2A 1AO0A 3TR0A 5BR4A 2G06A 3QJGA 3TL2A 1GNRA 4UZFA 3RAFC 1TIBA 3FJ1A 4IIXA 4GQAA 4DSZA 4UHDA 5EIFA 1LLUA 1UQUA 3K0FA 4KL8S 2J7PD 2MSNA 3ONNA 3WLHA 5LZ4A 3I83A 1VZ3A 4UZEA 1OB5A 1XQ6A 1WY5A 1MJGA 2P4EA 3AH8A 4EKGA 2XRYA 4WN9A 3UGQA 4OHXA 3NHUA 4BNJA 1I30A 1QMGA 3RT9A 3T3DA 1PD1A 3ZCSA 1LPMA 4QREA 1FRVA 3EXIB 3KZKA 4NCNA 4UMDA 5AW4A 4M9ZA 1DMRA 3UGTA 1AXGA 1P4GA 4JC4A 4JLPA 4F5ZA 1SKYE 2Q28A 2WJAA 4QOSA 3OQNA 4C5CA 1VHJA 5BVHA 2REBA 3JATA 4B2LA 3B3GA 3CX7A 3L49A 3HV0A 2Z4TA 1LA2A 4G5HA 3GLVA 4BV2A 2GEFA 2P9YA 5CVCA 1JKIA 3ZI0A 4FFBB 5BVGB 3M4JA 3HJRA 1PUIA 1P19A 1XA3A 3C5HA 2HCBA 5BN3A 2HXYA 2AIRA 1P2TA 2WG1A 5GVRA 3F8TA 4RPHA 4Y6SA 3S7TA 4HXYA 5D3KA 2C7PA 5AI6A 4ZALA 5FUYA 1Z5PA 1D2MA 1FX0B 4G8BA 3TQOA 4D43A 1QU3A 3PUJA 1IONA 2YWGA 3FN4A 2QM0A 3H8WA 3ZLUA 2GASA 2P75A 3EZFA 2C77A 3IERA 3OCCA 3A1SA 2ACVA 2YV2A 3QXSA 2QLJA 5HX7A 2R97A 3E7DA 4CQMB 4LJ8A 3DLPX 3B3JA 1JHVA 4Z53A 1JR2A 1JRLA 1K6JA 1E2LA 3P32A 3R75A 3RRYA 5KC9A 5EWLB 2WYUA 1I2BA 4U7GA 4X7RA 5AKKA 4CZ2A 2E4VA 2NG1A 1J9GA 2WM9B 3SJAA 5MN6A 4WACA 1DKUA 3EC7A 4DYVA 2WPDD 2HF7A 3L7KA 1V25A 4WSOA 5CB4B 5D51S 3MXTA 4XYLA 2E4XA 1E63A 2WU3A 2G82A 1PDOA 3DUFB 3QHQA 4BMXA 2NW6A 3M1LA 4OM8A 3EZ9A 4R4JA 3LDAA 4XOIA 3RK0A 4N5NA 4WZAB 2VP4A 3DGEC 4U4AA 4ESOA 3G6KA 4I50B 4Z4FA 4E2FA 1F48A 3MA0A 1MAWA 2NPOA 1A9ZA 4JZKA 1RIFA 1ZGHA 3KR0A 3R3XA 5DYWA 2LR0A 3TZBA 2COUA 2ESRA 4N9QA 2CFTA 5ALVA 4GI1A 4WXEA 3RSCA 3BULA 1AQNA 1G8JA 1G19A 3KKLA 1EJ0A 1JQKA 1YIDA 3AIMA 4UDOA 3U3ZA 2GAIA 2H51A 3CF6R 3W2EA 1RRCA 4OH7A 1C0PA 1O8BA 3M4NA 3BBLA 5GP1A 2PZMA 3FNHA 1G1AA 1R3UA 2E4YA 2IYAA 4MA0A 5CCEA 1B2RA 1L5MA 1YZFA 1Y5LA 1M2NA 1PLLA 1Q12A 3BWXA 4H1VA 4Y67A 3HL4A 1JG6A 2E0IA 1RZRA 1CTQA 2G72A 1HG1A 5COQA 4FMDF 3C5CA 4FJ1A 4IDEA 3K9NA 1UMCA 3IUJA 3IO3A 3NW9A 2CNKA 1H4VB 4RV4A 4GM1A 2VQEB 4A6EA 2GO1A 1U0GA 3VU8A 1NJ1A 1IBSA 2XTNA 4M0FA 3WGTA 3CNBA 1BQEA 3BIXA 3GJ6A 4JR1A 1I6LA 4ALIA 3TD9A 2VTBA 4NAVA 5I7OA 1DTSA 5JSUA 4UREA 2AFIE 3NJ4A 4OOFA 2PX3A 1V9CA 1NOIA 3IDZA 4F4UA 2DTEA 4HC4A 1BW9B 4HYYA 1X7XA 3NTLA 2F62A 3OF2A 4PAWA 4AKTA 2Q6VA 3D4BA 3R24A 3SS9X 2VSXA 3K1AB 3MGAA 1RTTA 5M5BA 2BFWA 2FA9A 2WSYB 3L40A 3B89A 4K9OA 3MUOA 1YA8A 2SHKA 1FFAA 5REQA 4G01B 3TKYA 1JHUA 1MQ8B 4P7JA 2VP3A 1KAQA 4QBGB 3PTLA 3K5WA 5CA1B 5D3MB 4X3CA 5LVAA 3KKMA 4KI7A 3OC6A 1VHLA 2WJGA 4YAFA 3IKLA 4G4IA 3SF8A 3ANMA 5BV7A 1T3LA 5JYEA 3B60A 4C01A 3QVMA 1Q2XA 5C5IA 3AI3A 3RASA 1JHAA 4YLGA 1FB5A 4X0EA 3CVUA 1OYOA 1GAXA 5FWYB 3PEYA 5LWQA 5A9TA 2ZQYA 1G3RA 1QP8A 3ONWA 1PEAA 2Q62A 1L5HA 3QSYA 1A7UA 3L0IB 1AUVA 3ANLA 4XGIA 3ROTA 4MW4A 1IEWA 1GPJA 2BYTA 2FEKA 4KBGA 5IKMA 3KU1A 3RODA 1P45A 2JGAA 2ZRMA 4U0JA 5A62A 1P0QA 3WSWA 2G3YA 4C5AA 1PGQA 3ZCTA 4QZVA 3WDSA 4MQBA 1FZTA 5E0OA 2R4TA 4M99A 1LD3A 2QTBA 7GPBA 3M6FA 1XELA 1R4ZA 1FFXB 2FFBA 4LGYA 3C39A 1W9HA 1RAAA 4OHRA 2FN4A 3O8RA 3WLPA 1Z2OX 4R2XA 4F8EA 1JQDA 4BKUA 3JX9A 3OI7A 1GCAA 4KR0A 4A23A 1Z38A 5DNWA 3OT1B 1QRUA 5C5EA 4Q16A 4OV6B 2QRKA 4Q3DA 4YJHA 3TW8B 2ZVQX 2PJDA 4OP3A 3CRW1 4QXMA 5TF0A 4C7JA 1PJTA 3CLTC 1XK6A 3O83A 4MV8A 4N3CA 5DTQA 1DKPA 1F1JA 2ZW9A 1MP0A 4KUGA 4QDTA 3VFDA 2WZCA 2DQYA 1RKUA 4L50A 5EJ5A 1ISRA 4E6PA 3OPYI 5DHTA 2Y1DA 1G8FA 4Q7LA 4OUDB 3P97A 2R79A 4WTOA 1IAQA 1PFUA 1RWPA 3LLCA 4XSHA 4LZPA 3EG9B 4YMLA 5KNDH 3V4LA 4M9CA 2XNJA 4UW9A 3EVTA 1R0YA 2BGMA 4YASA 2XGJA 3FE2A 5DLYA 1G5TA 3L7OA 4MI1A 3UFBA 2QRJA 3PTZA 5JASA 1KZ9A 1TVKB 4FGSA 3AIOA 5H3HA 5CNMA 4CIAA 1LFAA 1P73A 2AQHA 2WYWA 3D7KA 3WK5A 1ECJA 3ENZA 2ON6A 1G41A 2WP0A 3VSCA 3KYDA 3JAMA 2QD5A 5IAJA 4YCLA 4FCWA 3U44A 2FSIA 4NSNA 1M76A 5DW0A 5IJ0A 5I47A 1DMSA 1XDUA 5CW2A 5AVRA 5HWSA 1R4AA 3H8JA 1JB1A 1E62A 2ES4A 4Z1MA 3V6LA 3ZHSA 2HO5A 1K0FA 3GLRA 4Z3KA 5JSHA 4MCIA 1B1CA 4GRAA 1XTQA 4EQZA 3EA5A 4KLNA 3E9EA 1AA6A 3FPAA 1PFKA 4WUVA 1OWNA 2D5BA 3BOSA 3UY4A 2FUNB 1M7BA 1SM4A 1A88A 1A3CA 3QU7A 5GWXA 5CDTA 2Y0EA 2QPTA 2YASA 4DCOA 5JEDA 2YWJA 1GP2A 2V45A 2WOOA 4ZJZA 4ZV4A 5JS7A 2VJCA 4C76A 4F1JA 1SC3A 2OT3B 2O2JA 2IP2A 1KWKA 4XM0A 5JFTA 4YRNA 3C7CB 3J7TA 2G4VA 3GZ4A 3PX7A 3QV2A 1LSJA 1PQWA 4AG3A 4ZJPA 1XWWA 1T6ZA 2BM9A 4UCFA 2HOQA 2FSVA 3D3KA 3U60B 3V2IA 4EB0A 3LK6A 3AOGA 2OHOA 2QQ0A 1GKUB 4MZXA 1JF8A 4CTJA 4F7WA 2VWHA 2PIAA 2MSKA 3HDQA 5FUXA 4EVSA 4Z4EA 1TQ4A 3UH1A 1NZDA 1W5AA 3JWEA 2DLDA 4J1SA 4N54A 1ODIA 4PANA 1X7GA 2DYKA 3UZUA 3CKMA 3Q7QA 4AO7A 5IVKA 1P3Y1 3DEHA 2PSSA 2YHAA 3RFUA 4DCTA 3OZXA 4K2AA 5DMHA 2YICA 1HUQA 1E0AA 3OC0A 5EJ6A 3UNXA 3QUCA 1XP8A 3Q87B 5DU2A 5BMOA 3QTBA 2YOGA 2VQ6A 4LHSA 3IQGX 3GCGA 1GQRA 3OM1A 1BA3A 1CR2A 4WH0A 4YEDA 2BUBA 1H2WA 4IGAA 4WN3A 3DE6X 4FOTA 3ZWNA 1DAFA 1H66A 1DEXA 5EVCA 3HYCA 1P9LA 1E3JA 1XMIA 4L51A 2ZYRA 4MUNA 3UQZA 4CUKA 3KZOA 1SBCA 3FCOA 3NFRA 3Q9SA 1OLOA 5A1TA 4Q9NA 2ZQZA 5F7OA 1Y3AA 3ECSA 1LVHA 2FZEA 4KDCA 3T94A 2AE1A 2X58A 1XMVA 2Z58A 4RKFA 5C34B 3R9XA 2C59A 2ZAOA 3HO6A 3BK1A 4P7BA 3VI3B 5CFLA 3UTCA 3U7GA 4LS3A 2WKPA 1P3DA 1DHRA 3JAKA 3TXAA 3EOBI 4HNUA 1YJXA 2VO1A 1O7JA 2FG5A 4GNRA 5U9CA 2RAFA 3I23A 3SJ7A 1E99A 5KU1A 1PEYA 1XD9A 2UYYA 4F96A 3WSTA 2BHNA 1U7OA 2GESA 2X5KO 4HZUA 3EQ7A 3SQWA 2RJNA 4LC9A 2YIMA 1WXFA 5J4KA 1ULUA 2W4QA 3ON5A 1NXTA 3BGVA 1B15A 3KP1A 2PL9A 4HN2A 5B7GA 1JVBA 1MG5A 4K9NA 4MRAA 4KJZA 1N3YA 3L1HA 3TRHA 3UG6A 2RHGB 3TRDA 2JI7A 2HSEA 4J0GA 1VZ2A 3IVGA 5H59A 4JJIA 3ZWXA 4UATA 1SA0A 2ZETA 2D13A 2EL9A 2NWQA 1C50A 1JHQA 3DF9A 3DLTA 1HTBA 2EYQA 4GT1A 3PNPA 4H7IA 5LQAA 1FC0A 1KF0A 3KB8A 4F72A 1Q0SA 2Y92A 4CKBB 2IYSA 3LUKA 2C84A 3NUGA 3ZHUA 1UP6A 4OL9A 4EUKA 5JZOA 3DOEA 1YQEA 3DTNA 4LRSB 4J16C 1JDBB 3ER8A 1Y4AE 3M5DA 1MOSA 3EXEA 2EZ4A 1I4EB 2GPBA 1MC5A 3LBYA 3MWJA 4C4OA 5LIPA 1IBLB 2H11A 1J56A