4P45A

X-ray structure of human glutamate carboxypeptidase ii (gcpii) in complex with a phosphoramidate inhibitor jrb-4-73
Total Genus 262
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
262
sequence length
696
structure length
690
Chain Sequence
KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glutamate carboxypeptidase 2
publication title Design of composite inhibitors targeting glutamate carboxypeptidase II: the importance of effector functionalities.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 262
structure length 690
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2014-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 4p45A03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4p45A01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4p45A02
2CTBA 1ZG9A 1LOKA 1HDQA 4R6TA 2F8HA 1YW6A 1RTQA 4ZI6A 2IJZA 3JRUA 4MCRA 3BI1A 4YU9A 1Y0RA 3PB8X 4C9EA 1NSAA 4NGMA 4MXUA 4F9UA 4ZYQA 3CPAA 4F9VA 4Z65A 1AYEA 2FVGA 4DUKA 1YLOA 5CPAA 4C84A 3FJUA 4MCSA 3I74A 3PB9X 3PRTA 4EMEA 4P44A 3IJ3A 3I6SA 4TJXA 2V8GA 2ZEOA 1BLLE 1CP7A 5JH9A 1HDUA 2ZEFA 4UF4A 2Q4ZA 3H8GA 4YWYA 1CBXA 5JM6A 3GLJA 5LYIA 3K9TA 5CBMA 3SJEA 3WABA 1BPNA 3ISXA 2Q43A 2GU2A 3KZWA 2JEWA 4MHZA 4NFRA 1VHEA 4P45A 4PXCA 1DE4C 4WJBA 3V38A 3FF3A 4UIAA 2CTCA 4WWVA 4NGNA 2PJ8A 7CPAA 3D67A 4NGRA 3PBBA 5LYDA 2PIYA 2GLJA 4AXVA 4C8PA 1F2OA 4P4BA 3B2YA 4IAVA 3FMCA 3RZAA 2JBJA 1PCAA 4P10A 1ARMA 1KWMA 2EK9A 4DYOA 1EE3P 1FT7A 1XMBA 4OKOA 4MHNA 4OC5A 4P6YA 4PXEA 3NH8A 3T8WA 3DLJA 2PRQA 1ELLP 3PB6X 3L2NA 1TXRA 2BCOA 1VHOA 3D7HA 1Y0YA 2V8VA 5K8NA 3TC8A 4KNGE 4IHMA 4NJQA 2NYQA 1CP6A 3IIBA 2XEIA 4OP4A 1R43A 3MRUA 3ICUA 2CIJA 2HC9A 3SI0A 5LRJA 5I4MA 4P4JA 2V8HA 1BPMA 1XJOA 1XF1A 2PJ1A 3GB0A 2F7VA 4C8AA 3B35A 2PJ7A 3MN8A 2PCUA 1Y7EA 3WC7A 4G1PA 4MHYA 2PJ6A 5JGFA 5ELYA 3PB7X 4OIDA 4A38A 2EWBA 4GM5A 2AFWA 2ZENA 2EK8A 3S9NA 3KR4A 4A37A 4PQAA 2C6CA 4C8CA 3IO1A 3KHZA 1Z5RA 1CX8A 5K8MA 4Q7AA 3H8EA 1IGBA 4ZY1A 3EIFA 4UEZA 2CF4A 1UWYA 3BI0A 3S9MA 2V8DA 2AFZA 2ZEGA 2BO9A 4P4EA 1IY7A 4PXBA 2PIZA 1BAVA 5K8PA 2AFSA 5HVFA 3TX8A 4YN3A 3D66A 2ZELA 4TJVA 3DGVA 4OC4A 3FEEA 1ZG7A 1M4LA 2GLFA 1JQGA 4JZ0A 3IC1A 3FX6A 4C8UA 4OC3A 3RBUA 3SI1A 3SI2A 5D8NA 3KQXA 3KHXA 2ZEMA 1PYTB 1LANA 4UEFA 2C6PA 4MHPA 2PJ0A 4C86A 1YMEA 4W9YA 2RFHA 4O23A 4C9UA 4NGTA 5HXDA 4X2TA 4C9RA 1XFOA 4ONWA 4MCQA 5LYFA 3PB4X 2XEGA 3FECA 3HUVA 1F2PA 4OIWA 3D7GA 4C9VA 3K2KA 3BHXA 5HVGA 2AFMA 1TKHA 2PJ2A 3ISZA 2GREA 1CG2A 5J1QA 2XEJA 3CPXA 4OMEA 1AMPA 3IFEA 2PJBA 3VARA 4PPZA 3KI9A 3PBEA 4X8IA 4X3RA 2O4HA 4IK2A 1Y9ZA 1CPXA 1GYTA 3BXMA 1ELMP 5THWA 1TF8A 3VTAA 1Z2LA 3B7IA 4RUHA 2NSMA 1VGYA 5HVHA 4P4IA 2WZNA 4R8FA 1Q7LA 2PJAA 4NGQA 3SJFA 1TF9A 2G9DA 2WYRA 2ZEHA 3NH4A 2PVWA 8CPAA 1CPSA 4UIBA 2O53A 3WC6A 1ZLHA 1LAMA 4C9AA 2DEAA 1R3NA 4ZX8A 2AFXA 2RB7A 3CDXA 6CPAA 4A94A 1TKJA 3VATA 2POKA 2I3CA 3D7FA 3H8FA 5K8OA 2ZEPA 2ZOGA 2IQ6A 3S9LA 3V7ZA 5DS0A 4R76A 4BD9A 5LRKA 1FNOA 3SJXA 4FBEA 2PJCA 2ZEDA 3D7DA 3KQZA 3SJGA 5F09A 3B3VA 3FEDA 3FVLA 4OC0A 4R7MA 3B3CA 4K3NA 3KGQA 4CDJA 5LYLA 3KL9A 3WC5A 3D68A 2Q51A 4C8TA 2QJ8A 4DJLA 2ANPA 1LFWA 2QYVA 4MRIA 1QQ9A 2PVVA 1WVMA 4B6ZA 2AFUA 4JYWA 3HLPA 3FH4A 3KASA 2BOAA 1VIXA 2OR4A 3CT9A 4P4FA 1ZLIA 4ZX9A 5IB9A 1XRYA 4MCPA 3PFEA 2XEFA 1TKFA 4PXDA 2V77A 4ZY2A 3PEIA 1QMUA 1LCPA 1H8LA 2IMOA 1F57A 3WT4A 4LQGA 4CDKA 3VH9A 4C85A 4MMOA 4TWEA 3NH5A 4EWTA 2QVPA 4A39A 1Z8LA 4FWUA 3IEHA 3PFOA 2HB6A 2ZOFA 1ZG8A 3N5FA 1YW4A 3RAMA 1V6CA 4OC2A 1ARLA 4ZY0A 3QNVA 4NGSA 3B3WA 4NJRA 2PJ3A 3D4UA 4H2KA 3GUXA 1LAPA 2JBKA 3LMSA 1DTDA 4FUUA 5D29A 2C6GA 4FAIA 2J9AA 2PE3A 2ZEEA 4OC1A 4UEEA 2OOTA 1HEEA 2ABZA 4C99A 3NA6A 4TNUA 4EFDA 3KR5A 3NFZA 2PJ5A 3B3TA 1YSJA 1XBUA 2AFOA 3IWWA 4C8FA 5LRGA 4KSIA 4NGPA 4P4DA 2PJ4A 3LWUA 3I1UA 2VL1A 4CPAA 1OBRA 4F8ZA 2PJ9A 3B3SA 2C1CA
chains in the Genus database with same CATH superfamily
5E96A 2I79A 2CTBA 1ZG9A 2R1IA 1LOKA 1HDQA 1IYKA 4PSWA 2F8HA 3NE7A 1YW6A 4R6TA 2XPOA 4KSFA 1ZYMA 4K30A 1Y7RA 4H1HA 5AXIA 1RTQA 4ZI6A 1KUYA 2IJZA 1FY7A 3CXQA 3D8PA 1Z9EA 3I9SA 3JRUA 5A27A 2DLAA 1IOFA 4MCRA 2GANA 3IWEA 3P2HA 3OB1B 4ONUA 3BI1A 4PK2A 3ZJ0A 4YU9A 4YN3A 1Y0RA 3R9EA 4B5OA 3PB8X 5F48A 4C9EA 1S3ZA 1NSAA 4NGMA 3BUOB 4QUSA 4NEXA 4MXUA 4F9UA 4ZYQA 3CPAA 2VKZG 1NSLA 4B10A 4F9VA 1AYEA 4Z65A 5JPHA 4L8AA 2FVGA 2J8RA 4DUKA 1TIQA 1YLOA 4MFJA 5CPAA 4E8OA 1J3LA 3TLGB 4C84A 4NSQA 4Q36A 3FJUA 4MCSA 1NE9A 4IIYA 1Z9UA 2R98A 3HPHE 3OP0A 2J8MA 3PB9X 4QVTA 4PSXA 3I74A 3PRTA 1S7LA 2JLMA 5J8CA 2EZBA 4EMEA 4P44A 4E5SA 1QSNA 3IJ3A 1CJWA 3OB2B 2R8VA 1IICA 3I6SA 4TJXA 2V8GA 4JXQA 2DF5A 2ZEOA 1MJAA 1R57A 3R1KA 5DWNA 3TOBA 3EY5A 1BLLE 1CP7A 5JH9A 1HDUA 3GJZA 2ZEFA 3K9UA 2GIVA 2WPWA 2Q4ZA 4UF4A 3FYNA 3H8GA 1S7KA 4YWYA 1CBXA 5JM6A 3GLJA 5LYIA 3FXTA 4ZBGA 3G8WA 2BL1A 3FIXA 4YGOA 3K9TA 4NCZA 5CBMA 1BXRB 3V8IA 3VWDA 4LQ6A 3SJEA 3WABA 3BUXB 1BPNA 3T9YA 3ISXA 1CM0A 4UA3A 2CXAA 1X10A 2Q43A 3NOJA 2VQYA 1IYLA 4C2XA 2GU2A 2CY2A 3VWEA 3KZWA 2OLSA 4ORFA 4R3KA 2JEWA 4MHZA 4NFRA 1VHEA 4B13A 4P45A 4PXCA 1DE4C 4WJBA 3V38A 3FF3A 4UIAA 2CTCA 4WWVA 5AGEA 4NGNA 2OB0A 2PJ8A 4CGPA 7CPAA 3D67A 4KVME 4NGRA 1EZBA 2Z3LA 2Q4VA 3DDDA 2K5TA 2X7BA 1VKCA 3D3SA 2PIYA 2GLJA 3C26A 1JWQA 3ZNIA 4MY0A 4UWIA 4AXVA 4C8PA 5KTCA 1F2OA 4P4BA 4HKFA 3W6XA 3ZZIA 1VBGA 3B2YA 4IAVA 4A31A 5F9MA 4AVBA 3FMCA 3RZAA 2JBJA 1PCAA 4P10A 4RR2B 1ARMA 4CRYB 2Z3NA 2B4DA 1KWMA 2ARHA 3BUMB 3EZAA 2EK9A 1WK4A 4CAWA 4CRZB 4F6AA 4KORA 4DYOA 1EE3P 2ATRA 3VROA 3TO7A 5BY0A 1FT7A 1XMBA 5EMIA 3NFQA 4C7IA 3OWCA 1YLEA 2PSWA 3F0AA 4OKOA 4MHNA 4OC5A 2B0AA 1I1DA 4P6YA 4PXEA 1YQEA 3NH8A 3VRQA 3O8ZA 3T8WA 4C2YA 3DLJA 2PRQA 1ELLP 3H5ZA 3PB6X 4M6GA 2RC4A 3OAKA 3L2NA 1Y9KA 1TXRA 1X12A 2BCOA 5F47A 4LX9A 1VHOA 3D7HA 4A30A 1Y0YA 5IB0A 3KRVA 2V8VA 5FVJA 2Q7BA 1M6VB 3LACA 3EZBA 2B4BA 2FSRA 5K8NA 2C5QA 2B4DB 1NMTA 1S5KA 1Y9WA 2G3TA 4KS9A 4JXRA 4AG9A 4B14A 3TC8A 3P2FA 2QMLA 4KNGE 2FS5A 4IHMA 3EFAA 2Z3OA 4NJQA 2NYQA 1CP6A 3U1BA 3TT2A 3BUNB 3BJ8A 3IIBA 4CAVA 2XEIA 3FRMA 3T90A 4QBJA 4OP4A 1R43A 2GP4A 3MRUA 2HV2A 3ICUA 2CIJA 2HC9A 3SI0A 2Q04A 4JD6A 5LRJA 3TO9A 5I4MA 2VXKA 4P4JA 3PT1A 4KUAA 1JDEA 2D0PA 2CBLA 2V8HA 2YGWA 3TLEA 1QSMA 4CAEA 4Q38A 1BPMA 3EXNA 1NXJA 2YNCA 1XJOA 3TLYA 4CYOA 3JVNA 3TLAA 1GHEA 1XF1A 4M6IA 3CXPA 2E28A 2PJ1A 3GB0A 2D4PA 2B3UA 2F7VA 1RO5A 4C8AA 3B35A 4EYSA 2PJ7A 3MN8A 5HH1A 4XPDB 3NE8A 2PCUA 1Y7EA 3WR7A 3WC7A 2ZPAA 3DR6A 2PDOA 4LUAA 4G1PA 2CNSA 3RNZA 4C7HA 1B47A 3R95A 2FIWA 4MHYA 4CS0B 2B58A 2PJ6A 5JGFA 4II9A 4JWPA 1WWZA 2P6FA 4UFXA 3T0TA 4C68A 5ELYA 3PB7X 2FIAA 2EBJA 4IF5A 4M6HA 2DPSA 4OIDA 4A38A 2Q44A 2EWBA 4UCPA 1XMTA 4CAXA 2FL4A 4GM5A 2AFWA 2ZENA 4NXYA 2EK8A 3PLFB 3S9NA 3KR4A 4A37A 4PQAA 4CAFA 2C6CA 2P6EA 4C8CA 3IO1A 3SXNA 3KHZA 1Z5RA 1CX8A 5K8MA 2XPLA 1T36B 2P0WA 4Q7AA 3H8EA 1P4NA 1Q5XA 1ZO0A 1IGBA 2VEZA 4CGNA 4ZY1A 2P6GA 2BSWA 3EIFA 3DSBA 4KUBA 4UEZA 2CF4A 1UWYA 1XEBA 4MFPA 3BI0A 2F5IA 3S9MA 3U88C 4BPWB 5AG6A 2V8DA 2Q4YA 4MI4A 4A2ZA 4CYQA 5ISVA 2AFZA 4U9ZA 2ZEGA 5DWMA 2PQ8A 1XE4A 5AG4A 5EC4A 2VZZA 2QIRA 1YVHA 1PUAA 4MFZA 5IR2A 2BO9A 4P4EA 5JQ4A 4MI1A 4BPXB 3D2MA 3S6GA 4PK3A 3R96A 1IY7A 4PXBA 2PIZA 3TCVA 1BAVA 4AG7A 3TLGA 3LD2A 5K8PA 1CE8B 5J3XA 3MGDA 3TLBA 4KOXA 2AFSA 5FD8A 2FM4A 5HVFA 1AUGA 1KUXA 1OZPA 2EUIA 1XIXA 3D66A 2ZELA 3DNSA 3TX8A 2WSAA 4MBUA 4UWJA 2Z11A 4E2AA 4TJVA 3DGVA 3VRRA 4OC4A 3FEEA 4L89A 2HQYA 1ZG7A 1M4LA 2GLFA 1QSTA 1JQGA 1Q2YA 4PV6A 4C2ZA 4JZ0A 5HMNA 2YNEA 3FX6A 3IC1A 1YR0A 4C8UA 5G21A 4HNWB 2KCWA 2GE3A 4CGLA 4OC3A 4KOUA 5G1ZA 4B11A 5C82A 3C8OA 4KLVA 2G0BA 3R9GA 3PP9A 1C3OB 5HKYA 1Z4RA 3RBUA 4FD6A 1YREA 4HNXB 2Q7SA 5D8NA 3SI1A 2B5GA 3SI2A 3KQXA 3KHXA 4AVAA 2ZEMA 1MJ9A 5K99A 1J4JA 3T5MA 2FT0A 4KOVA 1SQHA 2WUUA 1PYTB 2OH1A 4B12A 2OZGA 1LANA 4UEFA 2VI7A 2C6PA 4OAEA 4CO9A 1VHSA 4MHPA 2PJ0A 4QC6A 5K8OA 1C30B 4C86A 4BINA 2UV8G 1ZL0A 1YMEA 4W9YA 1B87A 2RFHA 2OZHA 3E0KA 4O23A 5C88A 4NGTA 4C9UA 1KC7A 4XPDC 4X2TA 5HXDA 4C9RA 1XFOA 2BUEA 4ONWA 4NF1A 4XPLA 4MCQA 5LYFA 1KZFA 3PB4X 3TO6A 2J8NA 2XEGA 5I0CA 4JLYA 4XNHB 3FECA 1Z8WA 5G22A 1IIDA 3T05A 3HUVA 4MFKA 1F2PA 4KOWA 4JJXA 5AG7A 4OIWA 2AE6A 1IU8A 3F9KC 3D7GA 4C9VA 2B5GB 3K2KA 2Y1NA 3BHXA 2QECA 5HVGA 5BWAB 2AFMA 1M44A 2B3VA 1TKHA 4FD4A 2EZAA 4IIXA 4JVOA 2PJ2A 4MJXA 2YNCC 2GREA 3IGRA 3ISZA 3S6HA 1BO4A 1CG2A 4H6ZA 5J1QA 3QAYA 4A33A 1Z8TA 3TTHA 2XEJA 1Q2DA 2ZXVA 2Z3PA 3CPXA 4CYPA 5A28A 4RI1A 4OMEA 1XOVA 2GFQA 1AMPA 3IFEA 4KVOE 2B4JC 2PJBA 4ZGYB 3KKWA 2WPXA 3VARA 2CNMA 1KUVA 1P0HA 3A9LA 4PPZA 4A4CA 3KI9A 2DIKA 3EC4A 1YVOA 2DPTA 2VZYA 5GCNA 3PBEA 4B5PA 3HPGG 1ON0A 4X8IA 4X3RA 2O4HA 4IK2A 4KSAA 1Y9ZA 1CPXA 1GYTA 3BXMA 1M4DA 3G23A 1ELMP 2N3AB 2Z0ZA 5THWA 2AUMA 1TF8A 2R7HA 3K4IA 1Z2LA 3VTAA 4IUSA 2EO8A 3B7IA 3TFYA 4RUHA 2NSMA 4RN7A 4A95A 3GY9A 1VGYA 5HVHA 4P4IA 2WZNA 4R8FA 1PU9A 1Q7LA 3BJ7A 1LRZA 3VRPA 2PJAA 4CGMA 4NGQA 4U5YA 1YK3A 3SJFA 4BBHA 1MJBA 4KZTA 2XPPA 1TF9A 2G9DA 2BEIA 2Q0YA 1QSOA 2WYRA 2EZCA 5HKZA 3IWGA 2ZEHA 3NH4A 2PVWA 8CPAA 4HNYB 4B5PB 1CPSA 1DIKA 4UIBA 2H5MA 3CZXA 3IU2A 4A4BA 2O53A 3WC6A 1ZLHA 2FE7A 3T07A 1UFHA 1LAMA 5KTAA 2PCNA 4C9AA 2DEAA 1R3NA 5LYDA 4ZX8A 2AUNA 5H86A 5F1YA 2AFXA 4KVXA 2RB7A 3CDXA 6CPAA 4A94A 1TKJA 4YRHA 1Z4EA 1YX0A 2Y0MA 5F46A 2D0OA 3VATA 1EO0A 3RYOA 2POKA 4M3SA 1VI4A 1L0CA 2I3CA 3BUWB 3D7FA 3HMJG 5G20A 4CGOA 4YFJA 2X0SA 3H8FA 4UFVA 2ZEPA 2ZOGA 2IQ6A 5AG5A 2EVNA 4R57A 4UFWA 3UY5A 3S9LA 2PR1A 3S6FA 1S7FA 4UCNA 1VBHA 4MFQA 3V7ZA 3I3GA 2OU2A 3GKRA 5DS0A 2C27A 4R76A 5KTDA 4M8DA 3SXOA 4XNHC 1I21A 4BD9A 4FD7A 1FNOA 5LRKA 3SJXA 2JDCA 2R82A 4OLLA 4FBEA 2PJCA 3PFVA 2ZEDA 4INJA 2REEA 1S60A 3TYXA 3D7DA 2FCKA 5EBVA 1XF8A 1QSRA 3H4QA 2I00A 3JTKA 3SJGA 5F09A 3KQZA 3B3VA 3FEDA 2HWGA 3FVLA 4OC0A 4R7MA 3B3CA 5JYBA 5JVLA 1R61A 4K3NA 4X5KA 3KGQA 4RS2A 4E0AA 3QAHA 4CDJA 1I12A 5LYLA 2D4OA 3KL9A 2G3AA 3WC5A 4GS4A 3D68A 2Q51A 4MFLA 4C8TA 2QJ8A 4DJLA 5F5XA 1JDBC 1K4JA 1GGOA 2ANPA 1LFWA 2QYVA 4MRIA 1QQ9A 2ODFA 4A32A 2PVVA 2YNDA 1WVMA 1M4IA 4B6ZA 3BLNA 4MJ8A 5CNPA 2AFUA 4JYWA 2Z3MA 3HLPA 4Y49B 2FXFA 3FH4A 4AVCA 1FBVA 3KASA 2BOAA 3TOAA 1VIXA 3QB8A 2OR4A 3W91A 3CT9A 2ZW6A 4P4FA 2NMTA 3CXSA 2HROA 2YJVA 3F5BA 4QB9A 2AJ6A 2ZW4A 4EVYA 1ZLIA 4MHDA 4BMHA 4ZX9A 3GIUA 4FD5A 3W6SA 3PZJA 5IB9A 1XRYA 4MCPA 3PFEA 4R3LA 2XEFA 2HUZA 1TKFA 4GXHA 3EZEA 5J8FA 4U9YA 4PXDA 3R9FA 1CS0B 3D2PA 2V77A 5IX3A 4HPSA 4KOSA 1BOBA 4I49A 3FBUA 2REFA 4ZY2A 3PEIA 4H6UA 1M1DA 4OADA 1QMUA 3VGOA 1LCPA 2PC1A 1H8LA 2IMOA 5IV0A 3GYAA 4UBRA 1F57A 3WT4A 4LQGA 4CDKA 3S6KA 4J3GA 1N71A 2Z3KA 4M85A 1S7NA 3G3SA 3VH9A 4MMOA 4C85A 4TWEA 3NH5A 2O28A 4EWTA 2QVPA 4A39A 1Z8LA 3PGPA 3TLZA 2DXQA 1V0CA 4FWUA 4XPKA 3IEHA 3SHPA 4R9MA 3LODA 1A9XB 1MK4A 3PFOA 2HB6A 4COGA 2ZOFA 1WJTA 4BTFA 1ZG8A 4KOTA 4F0XA 1KBLA 3N5FA 1Z8XA 5F13A 1M4GA 1Q2CA 1YW4A 3RAMA 3JUWA 3DR8A 1V6CA 4E94A 4OC2A 1ARLA 4CZ1A 4ZY0A 2Y1MA 3QNVA 4NGSA 2XPNA 1B6BA 3B3WA 4H89A 4NJRA 2ZW7A 3VRNA 2PJ3A 3D4UA 4H2KA 3GUXA 3IU1A 4BPUB 1LAPA 1YVKA 1IOIA 4F0YA 5HKWA 2JDDA 2JBKA 2PR8A 4COBA 3LMSA 1NBWA 1DTDA 4FUUA 2YJTA 1IB1E 5D29A 2IL4A 3SR3A 2C6GA 1EZAA 3TLCA 2A4NA 4FAIA 2J9AA 2PE3A 2ZEEA 2MP0A 3FNCA 4OC1A 4UEEA 2OOTA 1HEEA 3F8KA 4KOYA 5F49A 5H84A 4J0NA 2CNTA 2ABZA 2PRBA 4AB7A 4C99A 3NA6A 4R87A 4TNUA 3KR5A 4EFDA 1A2ZA 2PJ5A 3B3TA 3B8GA 1YSJA 1XBUA 3FB3A 3NFZA 2VBQA 4MY3A 2AFOA 4UCMA 3IWWA 3RO0A 4GPLB 3EO4A 4DNCA 2HI6A 3TE4A 4CYNA 5LRGA 1ZRSA 4C8FA 3N7ZA 4KSIA 4NGPA 4P4DA 2PJ4A 2JEVA 2Z10A 4KLWA 2ZW5A 3LWUA 1YGHA 1U6MA 2VL1A 3I1UA 3PBBA 2OZUA 1KEEB 4CPAA 1OBRA 1RXTA 4F8ZA 2PJ9A 3B3SA 4Y49C 2C1CA
chains in the Genus database with same CATH topology
2CTBA 1ZG9A 1LOKA 1HDQA 4R6TA 2F8HA 1YW6A 1RTQA 4ZI6A 2IJZA 3JRUA 4MCRA 3BI1A 4YU9A 1Y0RA 3PB8X 4C9EA 1NSAA 4NGMA 4MXUA 4F9UA 4ZYQA 3CPAA 4F9VA 4Z65A 1AYEA 2FVGA 4DUKA 1YLOA 5CPAA 4C84A 3FJUA 4MCSA 3I74A 3PB9X 3PRTA 4EMEA 4P44A 3IJ3A 3I6SA 4TJXA 2V8GA 2ZEOA 1BLLE 1CP7A 5JH9A 1HDUA 2ZEFA 4UF4A 2Q4ZA 3H8GA 4YWYA 1CBXA 5JM6A 3GLJA 5LYIA 3K9TA 5CBMA 3SJEA 3WABA 1BPNA 3ISXA 2Q43A 2GU2A 3KZWA 2JEWA 4MHZA 4NFRA 1VHEA 4P45A 4PXCA 1DE4C 4WJBA 3V38A 3FF3A 4UIAA 2CTCA 4WWVA 4NGNA 2PJ8A 7CPAA 3D67A 4NGRA 3PBBA 5LYDA 2PIYA 2GLJA 4AXVA 4C8PA 1F2OA 4P4BA 3B2YA 4IAVA 3FMCA 3RZAA 2JBJA 1PCAA 4P10A 1ARMA 1KWMA 2EK9A 4DYOA 1EE3P 1FT7A 1XMBA 4OKOA 4MHNA 4OC5A 4P6YA 4PXEA 3NH8A 3T8WA 3DLJA 2PRQA 1ELLP 3PB6X 3L2NA 1TXRA 2BCOA 1VHOA 3D7HA 1Y0YA 2V8VA 5K8NA 2C5QA 3TC8A 4KNGE 4IHMA 4NJQA 2NYQA 1CP6A 3IIBA 2XEIA 4OP4A 1R43A 2GP4A 3MRUA 3ICUA 2CIJA 2HC9A 3SI0A 5LRJA 5I4MA 4P4JA 2V8HA 1BPMA 1XJOA 1XF1A 2PJ1A 3GB0A 2F7VA 4C8AA 3B35A 2PJ7A 3MN8A 2PCUA 1Y7EA 3WC7A 4G1PA 4MHYA 2PJ6A 5JGFA 5ELYA 3PB7X 4OIDA 4A38A 2EWBA 4GM5A 2AFWA 2ZENA 2EK8A 3S9NA 3KR4A 4A37A 4PQAA 2C6CA 4C8CA 3IO1A 3KHZA 1Z5RA 1CX8A 5K8MA 4Q7AA 3H8EA 1IGBA 4ZY1A 3EIFA 4UEZA 2CF4A 1UWYA 3BI0A 3S9MA 2V8DA 2AFZA 2ZEGA 5IR2A 2BO9A 4P4EA 1IY7A 4PXBA 2PIZA 1BAVA 5K8PA 2AFSA 5HVFA 3TX8A 4YN3A 3D66A 2ZELA 4TJVA 3DGVA 4OC4A 3FEEA 1ZG7A 1M4LA 2GLFA 1JQGA 4JZ0A 3IC1A 3FX6A 4C8UA 4OC3A 3RBUA 3SI1A 3SI2A 5D8NA 3KQXA 3KHXA 2ZEMA 1PYTB 1LANA 4UEFA 2C6PA 4MHPA 2PJ0A 4C86A 1YMEA 4W9YA 2RFHA 4O23A 4C9UA 4NGTA 5HXDA 4X2TA 4C9RA 1XFOA 4ONWA 4MCQA 5LYFA 3PB4X 2XEGA 3FECA 3HUVA 1F2PA 4OIWA 3D7GA 4C9VA 3K2KA 3BHXA 5HVGA 2AFMA 1TKHA 2PJ2A 3ISZA 2GREA 1CG2A 5J1QA 2XEJA 3CPXA 4OMEA 1AMPA 3IFEA 2PJBA 3VARA 4PPZA 3KI9A 3PBEA 4X8IA 4X3RA 2O4HA 4IK2A 1Y9ZA 1CPXA 1GYTA 3BXMA 1ELMP 5THWA 1TF8A 3VTAA 1Z2LA 3B7IA 4RUHA 2NSMA 1VGYA 5HVHA 4P4IA 2WZNA 4R8FA 1Q7LA 2PJAA 4NGQA 3SJFA 1TF9A 2G9DA 2WYRA 2ZEHA 3NH4A 2PVWA 8CPAA 1CPSA 4UIBA 2O53A 3WC6A 1ZLHA 1LAMA 4C9AA 2DEAA 1R3NA 4ZX8A 2AFXA 2RB7A 3CDXA 6CPAA 4A94A 1TKJA 3VATA 2POKA 2I3CA 3D7FA 3H8FA 5K8OA 2ZEPA 2ZOGA 2IQ6A 3S9LA 3V7ZA 5DS0A 4R76A 4BD9A 5LRKA 1FNOA 3SJXA 4FBEA 2PJCA 2ZEDA 3D7DA 3KQZA 3SJGA 5F09A 3B3VA 3FEDA 3FVLA 4OC0A 4R7MA 3B3CA 4K3NA 3KGQA 4CDJA 5LYLA 3KL9A 3WC5A 3D68A 2Q51A 4C8TA 2QJ8A 4DJLA 2ANPA 1LFWA 2QYVA 4MRIA 1QQ9A 2PVVA 1WVMA 4B6ZA 2AFUA 4JYWA 3HLPA 3FH4A 3KASA 2BOAA 1VIXA 2OR4A 3CT9A 4P4FA 1ZLIA 4ZX9A 5IB9A 1XRYA 4MCPA 3PFEA 2XEFA 1TKFA 4PXDA 2V77A 4ZY2A 3PEIA 1QMUA 1LCPA 1H8LA 2IMOA 1F57A 3WT4A 4LQGA 4CDKA 3VH9A 4C85A 4MMOA 4TWEA 3NH5A 4EWTA 2QVPA 4A39A 1Z8LA 4FWUA 3IEHA 3PFOA 2HB6A 2ZOFA 1ZG8A 3N5FA 1YW4A 3RAMA 1V6CA 4OC2A 1ARLA 4ZY0A 3QNVA 4NGSA 3B3WA 4NJRA 2PJ3A 3D4UA 4H2KA 3GUXA 1LAPA 2JBKA 3LMSA 1DTDA 4FUUA 5D29A 2C6GA 4FAIA 2J9AA 2PE3A 2ZEEA 4OC1A 4UEEA 2OOTA 1HEEA 2ABZA 4C99A 3NA6A 4TNUA 4EFDA 3KR5A 3NFZA 2PJ5A 3B3TA 1YSJA 1XBUA 2AFOA 3IWWA 4C8FA 5LRGA 4KSIA 4NGPA 4P4DA 2PJ4A 3LWUA 3I1UA 2VL1A 4CPAA 1OBRA 4F8ZA 2PJ9A 3B3SA 2C1CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CTB A;  1ZG9 A;  1LOK A;  1HDQ A;  4R6T A;  2F8H A;  1YW6 A;  1RTQ A;  4ZI6 A;  2IJZ A;  3JRU A;  4MCR A;  3BI1 A;  4YU9 A;  1Y0R A;  3PB8 X;  4C9E A;  1NSA A;  4NGM A;  4MXU A;  4F9U A;  4ZYQ A;  3CPA A;  4F9V A;  4Z65 A;  1AYE A;  2FVG A;  4DUK A;  1YLO A;  5CPA A;  4C84 A;  3FJU A;  4MCS A;  3I74 A;  3PB9 X;  3PRT A;  4EME A;  4P44 A;  3IJ3 A;  3I6S A;  4TJX A;  2V8G A;  2ZEO A;  1BLL E;  1CP7 A;  5JH9 A;  1HDU A;  2ZEF A;  4UF4 A;  2Q4Z A;  3H8G A;  4YWY A;  1CBX A;  5JM6 A;  3GLJ A;  5LYI A;  3K9T A;  5CBM A;  3SJE A;  3WAB A;  1BPN A;  3ISX A;  2Q43 A;  2GU2 A;  3KZW A;  2JEW A;  4MHZ A;  4NFR A;  1VHE A;  4P45 A;  4PXC A;  1DE4 C;  4WJB A;  3V38 A;  3FF3 A;  4UIA A;  2CTC A;  4WWV A;  4NGN A;  2PJ8 A;  7CPA A;  3D67 A;  4NGR A;  3PBB A;  5LYD A;  2PIY A;  2GLJ A;  4AXV A;  4C8P A;  1F2O A;  4P4B A;  3B2Y A;  4IAV A;  3FMC A;  3RZA A;  2JBJ A;  1PCA A;  4P10 A;  1ARM A;  1KWM A;  2EK9 A;  4DYO A;  1EE3 P;  1FT7 A;  1XMB A;  4OKO A;  4MHN A;  4OC5 A;  4P6Y A;  4PXE A;  3NH8 A;  3T8W A;  3DLJ A;  2PRQ A;  1ELL P;  3PB6 X;  3L2N A;  1TXR A;  2BCO A;  1VHO A;  3D7H A;  1Y0Y A;  2V8V A;  5K8N A;  3TC8 A;  4KNG E;  4IHM A;  4NJQ A;  2NYQ A;  1CP6 A;  3IIB A;  2XEI A;  4OP4 A;  1R43 A;  3MRU A;  3ICU A;  2CIJ A;  2HC9 A;  3SI0 A;  5LRJ A;  5I4M A;  4P4J A;  2V8H A;  1BPM A;  1XJO A;  1XF1 A;  2PJ1 A;  3GB0 A;  2F7V A;  4C8A A;  3B35 A;  2PJ7 A;  3MN8 A;  2PCU A;  1Y7E A;  3WC7 A;  4G1P A;  4MHY A;  2PJ6 A;  5JGF A;  5ELY A;  3PB7 X;  4OID A;  4A38 A;  2EWB A;  4GM5 A;  2AFW A;  2ZEN A;  2EK8 A;  3S9N A;  3KR4 A;  4A37 A;  4PQA A;  2C6C A;  4C8C A;  3IO1 A;  3KHZ A;  1Z5R A;  1CX8 A;  5K8M A;  4Q7A A;  3H8E A;  1IGB A;  4ZY1 A;  3EIF A;  4UEZ A;  2CF4 A;  1UWY A;  3BI0 A;  3S9M A;  2V8D A;  2AFZ A;  2ZEG A;  2BO9 A;  4P4E A;  1IY7 A;  4PXB A;  2PIZ A;  1BAV A;  5K8P A;  2AFS A;  5HVF A;  3TX8 A;  4YN3 A;  3D66 A;  2ZEL A;  4TJV A;  3DGV A;  4OC4 A;  3FEE A;  1ZG7 A;  1M4L A;  2GLF A;  1JQG A;  4JZ0 A;  3IC1 A;  3FX6 A;  4C8U A;  4OC3 A;  3RBU A;  3SI1 A;  3SI2 A;  5D8N A;  3KQX A;  3KHX A;  2ZEM A;  1PYT B;  1LAN A;  4UEF A;  2C6P A;  4MHP A;  2PJ0 A;  4C86 A;  1YME A;  4W9Y A;  2RFH A;  4O23 A;  4C9U A;  4NGT A;  5HXD A;  4X2T A;  4C9R A;  1XFO A;  4ONW A;  4MCQ A;  5LYF A;  3PB4 X;  2XEG A;  3FEC A;  3HUV A;  1F2P A;  4OIW A;  3D7G A;  4C9V A;  3K2K A;  3BHX A;  5HVG A;  2AFM A;  1TKH A;  2PJ2 A;  3ISZ A;  2GRE A;  1CG2 A;  5J1Q A;  2XEJ A;  3CPX A;  4OME A;  1AMP A;  3IFE A;  2PJB A;  3VAR A;  4PPZ A;  3KI9 A;  3PBE A;  4X8I A;  4X3R A;  2O4H A;  4IK2 A;  1Y9Z A;  1CPX A;  1GYT A;  3BXM A;  1ELM P;  5THW A;  1TF8 A;  3VTA A;  1Z2L A;  3B7I A;  4RUH A;  2NSM A;  1VGY A;  5HVH A;  4P4I A;  2WZN A;  4R8F A;  1Q7L A;  2PJA A;  4NGQ A;  3SJF A;  1TF9 A;  2G9D A;  2WYR A;  2ZEH A;  3NH4 A;  2PVW A;  8CPA A;  1CPS A;  4UIB A;  2O53 A;  3WC6 A;  1ZLH A;  1LAM A;  4C9A A;  2DEA A;  1R3N A;  4ZX8 A;  2AFX A;  2RB7 A;  3CDX A;  6CPA A;  4A94 A;  1TKJ A;  3VAT A;  2POK A;  2I3C A;  3D7F A;  3H8F A;  5K8O A;  2ZEP A;  2ZOG A;  2IQ6 A;  3S9L A;  3V7Z A;  5DS0 A;  4R76 A;  4BD9 A;  5LRK A;  1FNO A;  3SJX A;  4FBE A;  2PJC A;  2ZED A;  3D7D A;  3KQZ A;  3SJG A;  5F09 A;  3B3V A;  3FED A;  3FVL A;  4OC0 A;  4R7M A;  3B3C A;  4K3N A;  3KGQ A;  4CDJ A;  5LYL A;  3KL9 A;  3WC5 A;  3D68 A;  2Q51 A;  4C8T A;  2QJ8 A;  4DJL A;  2ANP A;  1LFW A;  2QYV A;  4MRI A;  1QQ9 A;  2PVV A;  1WVM A;  4B6Z A;  2AFU A;  4JYW A;  3HLP A;  3FH4 A;  3KAS A;  2BOA A;  1VIX A;  2OR4 A;  3CT9 A;  4P4F A;  1ZLI A;  4ZX9 A;  5IB9 A;  1XRY A;  4MCP A;  3PFE A;  2XEF A;  1TKF A;  4PXD A;  2V77 A;  4ZY2 A;  3PEI A;  1QMU A;  1LCP A;  1H8L A;  2IMO A;  1F57 A;  3WT4 A;  4LQG A;  4CDK A;  3VH9 A;  4C85 A;  4MMO A;  4TWE A;  3NH5 A;  4EWT A;  2QVP A;  4A39 A;  1Z8L A;  4FWU A;  3IEH A;  3PFO A;  2HB6 A;  2ZOF A;  1ZG8 A;  3N5F A;  1YW4 A;  3RAM A;  1V6C A;  4OC2 A;  1ARL A;  4ZY0 A;  3QNV A;  4NGS A;  3B3W A;  4NJR A;  2PJ3 A;  3D4U A;  4H2K A;  3GUX A;  1LAP A;  2JBK A;  3LMS A;  1DTD A;  4FUU A;  5D29 A;  2C6G A;  4FAI A;  2J9A A;  2PE3 A;  2ZEE A;  4OC1 A;  4UEE A;  2OOT A;  1HEE A;  2ABZ A;  4C99 A;  3NA6 A;  4TNU A;  4EFD A;  3KR5 A;  3NFZ A;  2PJ5 A;  3B3T A;  1YSJ A;  1XBU A;  2AFO A;  3IWW A;  4C8F A;  5LRG A;  4KSI A;  4NGP A;  4P4D A;  2PJ4 A;  3LWU A;  3I1U A;  2VL1 A;  4CPA A;  1OBR A;  4F8Z A;  2PJ9 A;  3B3S A;  2C1C A; 
#chains in the Genus database with same CATH topology
 5E96 A;  2I79 A;  2CTB A;  1ZG9 A;  2R1I A;  1LOK A;  1HDQ A;  1IYK A;  4PSW A;  2F8H A;  3NE7 A;  1YW6 A;  4R6T A;  2XPO A;  4KSF A;  1ZYM A;  4K30 A;  1Y7R A;  4H1H A;  5AXI A;  1RTQ A;  4ZI6 A;  1KUY A;  2IJZ A;  1FY7 A;  3CXQ A;  3D8P A;  1Z9E A;  3I9S A;  3JRU A;  5A27 A;  2DLA A;  1IOF A;  4MCR A;  2GAN A;  3IWE A;  3P2H A;  3OB1 B;  4ONU A;  3BI1 A;  4PK2 A;  3ZJ0 A;  4YU9 A;  4YN3 A;  1Y0R A;  3R9E A;  4B5O A;  3PB8 X;  5F48 A;  4C9E A;  1S3Z A;  1NSA A;  4NGM A;  3BUO B;  4QUS A;  4NEX A;  4MXU A;  4F9U A;  4ZYQ A;  3CPA A;  2VKZ G;  1NSL A;  4B10 A;  4F9V A;  1AYE A;  4Z65 A;  5JPH A;  4L8A A;  2FVG A;  2J8R A;  4DUK A;  1TIQ A;  1YLO A;  4MFJ A;  5CPA A;  4E8O A;  1J3L A;  3TLG B;  4C84 A;  4NSQ A;  4Q36 A;  3FJU A;  4MCS A;  1NE9 A;  4IIY A;  1Z9U A;  2R98 A;  3HPH E;  3OP0 A;  2J8M A;  3PB9 X;  4QVT A;  4PSX A;  3I74 A;  3PRT A;  1S7L A;  2JLM A;  5J8C A;  2EZB A;  4EME A;  4P44 A;  4E5S A;  1QSN A;  3IJ3 A;  1CJW A;  3OB2 B;  2R8V A;  1IIC A;  3I6S A;  4TJX A;  2V8G A;  4JXQ A;  2DF5 A;  2ZEO A;  1MJA A;  1R57 A;  3R1K A;  5DWN A;  3TOB A;  3EY5 A;  1BLL E;  1CP7 A;  5JH9 A;  1HDU A;  3GJZ A;  2ZEF A;  3K9U A;  2GIV A;  2WPW A;  2Q4Z A;  4UF4 A;  3FYN A;  3H8G A;  1S7K A;  4YWY A;  1CBX A;  5JM6 A;  3GLJ A;  5LYI A;  3FXT A;  4ZBG A;  3G8W A;  2BL1 A;  3FIX A;  4YGO A;  3K9T A;  4NCZ A;  5CBM A;  1BXR B;  3V8I A;  3VWD A;  4LQ6 A;  3SJE A;  3WAB A;  3BUX B;  1BPN A;  3T9Y A;  3ISX A;  1CM0 A;  4UA3 A;  2CXA A;  1X10 A;  2Q43 A;  3NOJ A;  2VQY A;  1IYL A;  4C2X A;  2GU2 A;  2CY2 A;  3VWE A;  3KZW A;  2OLS A;  4ORF A;  4R3K A;  2JEW A;  4MHZ A;  4NFR A;  1VHE A;  4B13 A;  4P45 A;  4PXC A;  1DE4 C;  4WJB A;  3V38 A;  3FF3 A;  4UIA A;  2CTC A;  4WWV A;  5AGE A;  4NGN A;  2OB0 A;  2PJ8 A;  4CGP A;  7CPA A;  3D67 A;  4KVM E;  4NGR A;  1EZB A;  2Z3L A;  2Q4V A;  3DDD A;  2K5T A;  2X7B A;  1VKC A;  3D3S A;  2PIY A;  2GLJ A;  3C26 A;  1JWQ A;  3ZNI A;  4MY0 A;  4UWI A;  4AXV A;  4C8P A;  5KTC A;  1F2O A;  4P4B A;  4HKF A;  3W6X A;  3ZZI A;  1VBG A;  3B2Y A;  4IAV A;  4A31 A;  5F9M A;  4AVB A;  3FMC A;  3RZA A;  2JBJ A;  1PCA A;  4P10 A;  4RR2 B;  1ARM A;  4CRY B;  2Z3N A;  2B4D A;  1KWM A;  2ARH A;  3BUM B;  3EZA A;  2EK9 A;  1WK4 A;  4CAW A;  4CRZ B;  4F6A A;  4KOR A;  4DYO A;  1EE3 P;  2ATR A;  3VRO A;  3TO7 A;  5BY0 A;  1FT7 A;  1XMB A;  5EMI A;  3NFQ A;  4C7I A;  3OWC A;  1YLE A;  2PSW A;  3F0A A;  4OKO A;  4MHN A;  4OC5 A;  2B0A A;  1I1D A;  4P6Y A;  4PXE A;  1YQE A;  3NH8 A;  3VRQ A;  3O8Z A;  3T8W A;  4C2Y A;  3DLJ A;  2PRQ A;  1ELL P;  3H5Z A;  3PB6 X;  4M6G A;  2RC4 A;  3OAK A;  3L2N A;  1Y9K A;  1TXR A;  1X12 A;  2BCO A;  5F47 A;  4LX9 A;  1VHO A;  3D7H A;  4A30 A;  1Y0Y A;  5IB0 A;  3KRV A;  2V8V A;  5FVJ A;  2Q7B A;  1M6V B;  3LAC A;  3EZB A;  2B4B A;  2FSR A;  5K8N A;  2C5Q A;  2B4D B;  1NMT A;  1S5K A;  1Y9W A;  2G3T A;  4KS9 A;  4JXR A;  4AG9 A;  4B14 A;  3TC8 A;  3P2F A;  2QML A;  4KNG E;  2FS5 A;  4IHM A;  3EFA A;  2Z3O A;  4NJQ A;  2NYQ A;  1CP6 A;  3U1B A;  3TT2 A;  3BUN B;  3BJ8 A;  3IIB A;  4CAV A;  2XEI A;  3FRM A;  3T90 A;  4QBJ A;  4OP4 A;  1R43 A;  2GP4 A;  3MRU A;  2HV2 A;  3ICU A;  2CIJ A;  2HC9 A;  3SI0 A;  2Q04 A;  4JD6 A;  5LRJ A;  3TO9 A;  5I4M A;  2VXK A;  4P4J A;  3PT1 A;  4KUA A;  1JDE A;  2D0P A;  2CBL A;  2V8H A;  2YGW A;  3TLE A;  1QSM A;  4CAE A;  4Q38 A;  1BPM A;  3EXN A;  1NXJ A;  2YNC A;  1XJO A;  3TLY A;  4CYO A;  3JVN A;  3TLA A;  1GHE A;  1XF1 A;  4M6I A;  3CXP A;  2E28 A;  2PJ1 A;  3GB0 A;  2D4P A;  2B3U A;  2F7V A;  1RO5 A;  4C8A A;  3B35 A;  4EYS A;  2PJ7 A;  3MN8 A;  5HH1 A;  4XPD B;  3NE8 A;  2PCU A;  1Y7E A;  3WR7 A;  3WC7 A;  2ZPA A;  3DR6 A;  2PDO A;  4LUA A;  4G1P A;  2CNS A;  3RNZ A;  4C7H A;  1B47 A;  3R95 A;  2FIW A;  4MHY A;  4CS0 B;  2B58 A;  2PJ6 A;  5JGF A;  4II9 A;  4JWP A;  1WWZ A;  2P6F A;  4UFX A;  3T0T A;  4C68 A;  5ELY A;  3PB7 X;  2FIA A;  2EBJ A;  4IF5 A;  4M6H A;  2DPS A;  4OID A;  4A38 A;  2Q44 A;  2EWB A;  4UCP A;  1XMT A;  4CAX A;  2FL4 A;  4GM5 A;  2AFW A;  2ZEN A;  4NXY A;  2EK8 A;  3PLF B;  3S9N A;  3KR4 A;  4A37 A;  4PQA A;  4CAF A;  2C6C A;  2P6E A;  4C8C A;  3IO1 A;  3SXN A;  3KHZ A;  1Z5R A;  1CX8 A;  5K8M A;  2XPL A;  1T36 B;  2P0W A;  4Q7A A;  3H8E A;  1P4N A;  1Q5X A;  1ZO0 A;  1IGB A;  2VEZ A;  4CGN A;  4ZY1 A;  2P6G A;  2BSW A;  3EIF A;  3DSB A;  4KUB A;  4UEZ A;  2CF4 A;  1UWY A;  1XEB A;  4MFP A;  3BI0 A;  2F5I A;  3S9M A;  3U88 C;  4BPW B;  5AG6 A;  2V8D A;  2Q4Y A;  4MI4 A;  4A2Z A;  4CYQ A;  5ISV A;  2AFZ A;  4U9Z A;  2ZEG A;  5DWM A;  2PQ8 A;  1XE4 A;  5AG4 A;  5EC4 A;  2VZZ A;  2QIR A;  1YVH A;  1PUA A;  4MFZ A;  5IR2 A;  2BO9 A;  4P4E A;  5JQ4 A;  4MI1 A;  4BPX B;  3D2M A;  3S6G A;  4PK3 A;  3R96 A;  1IY7 A;  4PXB A;  2PIZ A;  3TCV A;  1BAV A;  4AG7 A;  3TLG A;  3LD2 A;  5K8P A;  1CE8 B;  5J3X A;  3MGD A;  3TLB A;  4KOX A;  2AFS A;  5FD8 A;  2FM4 A;  5HVF A;  1AUG A;  1KUX A;  1OZP A;  2EUI A;  1XIX A;  3D66 A;  2ZEL A;  3DNS A;  3TX8 A;  2WSA A;  4MBU A;  4UWJ A;  2Z11 A;  4E2A A;  4TJV A;  3DGV A;  3VRR A;  4OC4 A;  3FEE A;  4L89 A;  2HQY A;  1ZG7 A;  1M4L A;  2GLF A;  1QST A;  1JQG A;  1Q2Y A;  4PV6 A;  4C2Z A;  4JZ0 A;  5HMN A;  2YNE A;  3FX6 A;  3IC1 A;  1YR0 A;  4C8U A;  5G21 A;  4HNW B;  2KCW A;  2GE3 A;  4CGL A;  4OC3 A;  4KOU A;  5G1Z A;  4B11 A;  5C82 A;  3C8O A;  4KLV A;  2G0B A;  3R9G A;  3PP9 A;  1C3O B;  5HKY A;  1Z4R A;  3RBU A;  4FD6 A;  1YRE A;  4HNX B;  2Q7S A;  5D8N A;  3SI1 A;  2B5G A;  3SI2 A;  3KQX A;  3KHX A;  4AVA A;  2ZEM A;  1MJ9 A;  5K99 A;  1J4J A;  3T5M A;  2FT0 A;  4KOV A;  1SQH A;  2WUU A;  1PYT B;  2OH1 A;  4B12 A;  2OZG A;  1LAN A;  4UEF A;  2VI7 A;  2C6P A;  4OAE A;  4CO9 A;  1VHS A;  4MHP A;  2PJ0 A;  4QC6 A;  5K8O A;  1C30 B;  4C86 A;  4BIN A;  2UV8 G;  1ZL0 A;  1YME A;  4W9Y A;  1B87 A;  2RFH A;  2OZH A;  3E0K A;  4O23 A;  5C88 A;  4NGT A;  4C9U A;  1KC7 A;  4XPD C;  4X2T A;  5HXD A;  4C9R A;  1XFO A;  2BUE A;  4ONW A;  4NF1 A;  4XPL A;  4MCQ A;  5LYF A;  1KZF A;  3PB4 X;  3TO6 A;  2J8N A;  2XEG A;  5I0C A;  4JLY A;  4XNH B;  3FEC A;  1Z8W A;  5G22 A;  1IID A;  3T05 A;  3HUV A;  4MFK A;  1F2P A;  4KOW A;  4JJX A;  5AG7 A;  4OIW A;  2AE6 A;  1IU8 A;  3F9K C;  3D7G A;  4C9V A;  2B5G B;  3K2K A;  2Y1N A;  3BHX A;  2QEC A;  5HVG A;  5BWA B;  2AFM A;  1M44 A;  2B3V A;  1TKH A;  4FD4 A;  2EZA A;  4IIX A;  4JVO A;  2PJ2 A;  4MJX A;  2YNC C;  2GRE A;  3IGR A;  3ISZ A;  3S6H A;  1BO4 A;  1CG2 A;  4H6Z A;  5J1Q A;  3QAY A;  4A33 A;  1Z8T A;  3TTH A;  2XEJ A;  1Q2D A;  2ZXV A;  2Z3P A;  3CPX A;  4CYP A;  5A28 A;  4RI1 A;  4OME A;  1XOV A;  2GFQ A;  1AMP A;  3IFE A;  4KVO E;  2B4J C;  2PJB A;  4ZGY B;  3KKW A;  2WPX A;  3VAR A;  2CNM A;  1KUV A;  1P0H A;  3A9L A;  4PPZ A;  4A4C A;  3KI9 A;  2DIK A;  3EC4 A;  1YVO A;  2DPT A;  2VZY A;  5GCN A;  3PBE A;  4B5P A;  3HPG G;  1ON0 A;  4X8I A;  4X3R A;  2O4H A;  4IK2 A;  4KSA A;  1Y9Z A;  1CPX A;  1GYT A;  3BXM A;  1M4D A;  3G23 A;  1ELM P;  2N3A B;  2Z0Z A;  5THW A;  2AUM A;  1TF8 A;  2R7H A;  3K4I A;  1Z2L A;  3VTA A;  4IUS A;  2EO8 A;  3B7I A;  3TFY A;  4RUH A;  2NSM A;  4RN7 A;  4A95 A;  3GY9 A;  1VGY A;  5HVH A;  4P4I A;  2WZN A;  4R8F A;  1PU9 A;  1Q7L A;  3BJ7 A;  1LRZ A;  3VRP A;  2PJA A;  4CGM A;  4NGQ A;  4U5Y A;  1YK3 A;  3SJF A;  4BBH A;  1MJB A;  4KZT A;  2XPP A;  1TF9 A;  2G9D A;  2BEI A;  2Q0Y A;  1QSO A;  2WYR A;  2EZC A;  5HKZ A;  3IWG A;  2ZEH A;  3NH4 A;  2PVW A;  8CPA A;  4HNY B;  4B5P B;  1CPS A;  1DIK A;  4UIB A;  2H5M A;  3CZX A;  3IU2 A;  4A4B A;  2O53 A;  3WC6 A;  1ZLH A;  2FE7 A;  3T07 A;  1UFH A;  1LAM A;  5KTA A;  2PCN A;  4C9A A;  2DEA A;  1R3N A;  5LYD A;  4ZX8 A;  2AUN A;  5H86 A;  5F1Y A;  2AFX A;  4KVX A;  2RB7 A;  3CDX A;  6CPA A;  4A94 A;  1TKJ A;  4YRH A;  1Z4E A;  1YX0 A;  2Y0M A;  5F46 A;  2D0O A;  3VAT A;  1EO0 A;  3RYO A;  2POK A;  4M3S A;  1VI4 A;  1L0C A;  2I3C A;  3BUW B;  3D7F A;  3HMJ G;  5G20 A;  4CGO A;  4YFJ A;  2X0S A;  3H8F A;  4UFV A;  2ZEP A;  2ZOG A;  2IQ6 A;  5AG5 A;  2EVN A;  4R57 A;  4UFW A;  3UY5 A;  3S9L A;  2PR1 A;  3S6F A;  1S7F A;  4UCN A;  1VBH A;  4MFQ A;  3V7Z A;  3I3G A;  2OU2 A;  3GKR A;  5DS0 A;  2C27 A;  4R76 A;  5KTD A;  4M8D A;  3SXO A;  4XNH C;  1I21 A;  4BD9 A;  4FD7 A;  1FNO A;  5LRK A;  3SJX A;  2JDC A;  2R82 A;  4OLL A;  4FBE A;  2PJC A;  3PFV A;  2ZED A;  4INJ A;  2REE A;  1S60 A;  3TYX A;  3D7D A;  2FCK A;  5EBV A;  1XF8 A;  1QSR A;  3H4Q A;  2I00 A;  3JTK A;  3SJG A;  5F09 A;  3KQZ A;  3B3V A;  3FED A;  2HWG A;  3FVL A;  4OC0 A;  4R7M A;  3B3C A;  5JYB A;  5JVL A;  1R61 A;  4K3N A;  4X5K A;  3KGQ A;  4RS2 A;  4E0A A;  3QAH A;  4CDJ A;  1I12 A;  5LYL A;  2D4O A;  3KL9 A;  2G3A A;  3WC5 A;  4GS4 A;  3D68 A;  2Q51 A;  4MFL A;  4C8T A;  2QJ8 A;  4DJL A;  5F5X A;  1JDB C;  1K4J A;  1GGO A;  2ANP A;  1LFW A;  2QYV A;  4MRI A;  1QQ9 A;  2ODF A;  4A32 A;  2PVV A;  2YND A;  1WVM A;  1M4I A;  4B6Z A;  3BLN A;  4MJ8 A;  5CNP A;  2AFU A;  4JYW A;  2Z3M A;  3HLP A;  4Y49 B;  2FXF A;  3FH4 A;  4AVC A;  1FBV A;  3KAS A;  2BOA A;  3TOA A;  1VIX A;  3QB8 A;  2OR4 A;  3W91 A;  3CT9 A;  2ZW6 A;  4P4F A;  2NMT A;  3CXS A;  2HRO A;  2YJV A;  3F5B A;  4QB9 A;  2AJ6 A;  2ZW4 A;  4EVY A;  1ZLI A;  4MHD A;  4BMH A;  4ZX9 A;  3GIU A;  4FD5 A;  3W6S A;  3PZJ A;  5IB9 A;  1XRY A;  4MCP A;  3PFE A;  4R3L A;  2XEF A;  2HUZ A;  1TKF A;  4GXH A;  3EZE A;  5J8F A;  4U9Y A;  4PXD A;  3R9F A;  1CS0 B;  3D2P A;  2V77 A;  5IX3 A;  4HPS A;  4KOS A;  1BOB A;  4I49 A;  3FBU A;  2REF A;  4ZY2 A;  3PEI A;  4H6U A;  1M1D A;  4OAD A;  1QMU A;  3VGO A;  1LCP A;  2PC1 A;  1H8L A;  2IMO A;  5IV0 A;  3GYA A;  4UBR A;  1F57 A;  3WT4 A;  4LQG A;  4CDK A;  3S6K A;  4J3G A;  1N71 A;  2Z3K A;  4M85 A;  1S7N A;  3G3S A;  3VH9 A;  4MMO A;  4C85 A;  4TWE A;  3NH5 A;  2O28 A;  4EWT A;  2QVP A;  4A39 A;  1Z8L A;  3PGP A;  3TLZ A;  2DXQ A;  1V0C A;  4FWU A;  4XPK A;  3IEH A;  3SHP A;  4R9M A;  3LOD A;  1A9X B;  1MK4 A;  3PFO A;  2HB6 A;  4COG A;  2ZOF A;  1WJT A;  4BTF A;  1ZG8 A;  4KOT A;  4F0X A;  1KBL A;  3N5F A;  1Z8X A;  5F13 A;  1M4G A;  1Q2C A;  1YW4 A;  3RAM A;  3JUW A;  3DR8 A;  1V6C A;  4E94 A;  4OC2 A;  1ARL A;  4CZ1 A;  4ZY0 A;  2Y1M A;  3QNV A;  4NGS A;  2XPN A;  1B6B A;  3B3W A;  4H89 A;  4NJR A;  2ZW7 A;  3VRN A;  2PJ3 A;  3D4U A;  4H2K A;  3GUX A;  3IU1 A;  4BPU B;  1LAP A;  1YVK A;  1IOI A;  4F0Y A;  5HKW A;  2JDD A;  2JBK A;  2PR8 A;  4COB A;  3LMS A;  1NBW A;  1DTD A;  4FUU A;  2YJT A;  1IB1 E;  5D29 A;  2IL4 A;  3SR3 A;  2C6G A;  1EZA A;  3TLC A;  2A4N A;  4FAI A;  2J9A A;  2PE3 A;  2ZEE A;  2MP0 A;  3FNC A;  4OC1 A;  4UEE A;  2OOT A;  1HEE A;  3F8K A;  4KOY A;  5F49 A;  5H84 A;  4J0N A;  2CNT A;  2ABZ A;  2PRB A;  4AB7 A;  4C99 A;  3NA6 A;  4R87 A;  4TNU A;  3KR5 A;  4EFD A;  1A2Z A;  2PJ5 A;  3B3T A;  3B8G A;  1YSJ A;  1XBU A;  3FB3 A;  3NFZ A;  2VBQ A;  4MY3 A;  2AFO A;  4UCM A;  3IWW A;  3RO0 A;  4GPL B;  3EO4 A;  4DNC A;  2HI6 A;  3TE4 A;  4CYN A;  5LRG A;  1ZRS A;  4C8F A;  3N7Z A;  4KSI A;  4NGP A;  4P4D A;  2PJ4 A;  2JEV A;  2Z10 A;  4KLW A;  2ZW5 A;  3LWU A;  1YGH A;  1U6M A;  2VL1 A;  3I1U A;  3PBB A;  2OZU A;  1KEE B;  4CPA A;  1OBR A;  1RXT A;  4F8Z A;  2PJ9 A;  3B3S A;  4Y49 C;  2C1C A; 
#chains in the Genus database with same CATH homology
 2CTB A;  1ZG9 A;  1LOK A;  1HDQ A;  4R6T A;  2F8H A;  1YW6 A;  1RTQ A;  4ZI6 A;  2IJZ A;  3JRU A;  4MCR A;  3BI1 A;  4YU9 A;  1Y0R A;  3PB8 X;  4C9E A;  1NSA A;  4NGM A;  4MXU A;  4F9U A;  4ZYQ A;  3CPA A;  4F9V A;  4Z65 A;  1AYE A;  2FVG A;  4DUK A;  1YLO A;  5CPA A;  4C84 A;  3FJU A;  4MCS A;  3I74 A;  3PB9 X;  3PRT A;  4EME A;  4P44 A;  3IJ3 A;  3I6S A;  4TJX A;  2V8G A;  2ZEO A;  1BLL E;  1CP7 A;  5JH9 A;  1HDU A;  2ZEF A;  4UF4 A;  2Q4Z A;  3H8G A;  4YWY A;  1CBX A;  5JM6 A;  3GLJ A;  5LYI A;  3K9T A;  5CBM A;  3SJE A;  3WAB A;  1BPN A;  3ISX A;  2Q43 A;  2GU2 A;  3KZW A;  2JEW A;  4MHZ A;  4NFR A;  1VHE A;  4P45 A;  4PXC A;  1DE4 C;  4WJB A;  3V38 A;  3FF3 A;  4UIA A;  2CTC A;  4WWV A;  4NGN A;  2PJ8 A;  7CPA A;  3D67 A;  4NGR A;  3PBB A;  5LYD A;  2PIY A;  2GLJ A;  4AXV A;  4C8P A;  1F2O A;  4P4B A;  3B2Y A;  4IAV A;  3FMC A;  3RZA A;  2JBJ A;  1PCA A;  4P10 A;  1ARM A;  1KWM A;  2EK9 A;  4DYO A;  1EE3 P;  1FT7 A;  1XMB A;  4OKO A;  4MHN A;  4OC5 A;  4P6Y A;  4PXE A;  3NH8 A;  3T8W A;  3DLJ A;  2PRQ A;  1ELL P;  3PB6 X;  3L2N A;  1TXR A;  2BCO A;  1VHO A;  3D7H A;  1Y0Y A;  2V8V A;  5K8N A;  2C5Q A;  3TC8 A;  4KNG E;  4IHM A;  4NJQ A;  2NYQ A;  1CP6 A;  3IIB A;  2XEI A;  4OP4 A;  1R43 A;  2GP4 A;  3MRU A;  3ICU A;  2CIJ A;  2HC9 A;  3SI0 A;  5LRJ A;  5I4M A;  4P4J A;  2V8H A;  1BPM A;  1XJO A;  1XF1 A;  2PJ1 A;  3GB0 A;  2F7V A;  4C8A A;  3B35 A;  2PJ7 A;  3MN8 A;  2PCU A;  1Y7E A;  3WC7 A;  4G1P A;  4MHY A;  2PJ6 A;  5JGF A;  5ELY A;  3PB7 X;  4OID A;  4A38 A;  2EWB A;  4GM5 A;  2AFW A;  2ZEN A;  2EK8 A;  3S9N A;  3KR4 A;  4A37 A;  4PQA A;  2C6C A;  4C8C A;  3IO1 A;  3KHZ A;  1Z5R A;  1CX8 A;  5K8M A;  4Q7A A;  3H8E A;  1IGB A;  4ZY1 A;  3EIF A;  4UEZ A;  2CF4 A;  1UWY A;  3BI0 A;  3S9M A;  2V8D A;  2AFZ A;  2ZEG A;  5IR2 A;  2BO9 A;  4P4E A;  1IY7 A;  4PXB A;  2PIZ A;  1BAV A;  5K8P A;  2AFS A;  5HVF A;  3TX8 A;  4YN3 A;  3D66 A;  2ZEL A;  4TJV A;  3DGV A;  4OC4 A;  3FEE A;  1ZG7 A;  1M4L A;  2GLF A;  1JQG A;  4JZ0 A;  3IC1 A;  3FX6 A;  4C8U A;  4OC3 A;  3RBU A;  3SI1 A;  3SI2 A;  5D8N A;  3KQX A;  3KHX A;  2ZEM A;  1PYT B;  1LAN A;  4UEF A;  2C6P A;  4MHP A;  2PJ0 A;  4C86 A;  1YME A;  4W9Y A;  2RFH A;  4O23 A;  4C9U A;  4NGT A;  5HXD A;  4X2T A;  4C9R A;  1XFO A;  4ONW A;  4MCQ A;  5LYF A;  3PB4 X;  2XEG A;  3FEC A;  3HUV A;  1F2P A;  4OIW A;  3D7G A;  4C9V A;  3K2K A;  3BHX A;  5HVG A;  2AFM A;  1TKH A;  2PJ2 A;  3ISZ A;  2GRE A;  1CG2 A;  5J1Q A;  2XEJ A;  3CPX A;  4OME A;  1AMP A;  3IFE A;  2PJB A;  3VAR A;  4PPZ A;  3KI9 A;  3PBE A;  4X8I A;  4X3R A;  2O4H A;  4IK2 A;  1Y9Z A;  1CPX A;  1GYT A;  3BXM A;  1ELM P;  5THW A;  1TF8 A;  3VTA A;  1Z2L A;  3B7I A;  4RUH A;  2NSM A;  1VGY A;  5HVH A;  4P4I A;  2WZN A;  4R8F A;  1Q7L A;  2PJA A;  4NGQ A;  3SJF A;  1TF9 A;  2G9D A;  2WYR A;  2ZEH A;  3NH4 A;  2PVW A;  8CPA A;  1CPS A;  4UIB A;  2O53 A;  3WC6 A;  1ZLH A;  1LAM A;  4C9A A;  2DEA A;  1R3N A;  4ZX8 A;  2AFX A;  2RB7 A;  3CDX A;  6CPA A;  4A94 A;  1TKJ A;  3VAT A;  2POK A;  2I3C A;  3D7F A;  3H8F A;  5K8O A;  2ZEP A;  2ZOG A;  2IQ6 A;  3S9L A;  3V7Z A;  5DS0 A;  4R76 A;  4BD9 A;  5LRK A;  1FNO A;  3SJX A;  4FBE A;  2PJC A;  2ZED A;  3D7D A;  3KQZ A;  3SJG A;  5F09 A;  3B3V A;  3FED A;  3FVL A;  4OC0 A;  4R7M A;  3B3C A;  4K3N A;  3KGQ A;  4CDJ A;  5LYL A;  3KL9 A;  3WC5 A;  3D68 A;  2Q51 A;  4C8T A;  2QJ8 A;  4DJL A;  2ANP A;  1LFW A;  2QYV A;  4MRI A;  1QQ9 A;  2PVV A;  1WVM A;  4B6Z A;  2AFU A;  4JYW A;  3HLP A;  3FH4 A;  3KAS A;  2BOA A;  1VIX A;  2OR4 A;  3CT9 A;  4P4F A;  1ZLI A;  4ZX9 A;  5IB9 A;  1XRY A;  4MCP A;  3PFE A;  2XEF A;  1TKF A;  4PXD A;  2V77 A;  4ZY2 A;  3PEI A;  1QMU A;  1LCP A;  1H8L A;  2IMO A;  1F57 A;  3WT4 A;  4LQG A;  4CDK A;  3VH9 A;  4C85 A;  4MMO A;  4TWE A;  3NH5 A;  4EWT A;  2QVP A;  4A39 A;  1Z8L A;  4FWU A;  3IEH A;  3PFO A;  2HB6 A;  2ZOF A;  1ZG8 A;  3N5F A;  1YW4 A;  3RAM A;  1V6C A;  4OC2 A;  1ARL A;  4ZY0 A;  3QNV A;  4NGS A;  3B3W A;  4NJR A;  2PJ3 A;  3D4U A;  4H2K A;  3GUX A;  1LAP A;  2JBK A;  3LMS A;  1DTD A;  4FUU A;  5D29 A;  2C6G A;  4FAI A;  2J9A A;  2PE3 A;  2ZEE A;  4OC1 A;  4UEE A;  2OOT A;  1HEE A;  2ABZ A;  4C99 A;  3NA6 A;  4TNU A;  4EFD A;  3KR5 A;  3NFZ A;  2PJ5 A;  3B3T A;  1YSJ A;  1XBU A;  2AFO A;  3IWW A;  4C8F A;  5LRG A;  4KSI A;  4NGP A;  4P4D A;  2PJ4 A;  3LWU A;  3I1U A;  2VL1 A;  4CPA A;  1OBR A;  4F8Z A;  2PJ9 A;  3B3S A;  2C1C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...