4P46D

J809.b5 y31a tcr bound to iab3k
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
217
structure length
199
Chain Sequence
FEAQKAKANKAVDHFVYQFMGECYFTNGTQRIRYVTRYIYNREEYVRYDSDVGEHRAVTELGRPDAEYWNSQPEILERTRAELDTVCRHNYEGPETHTSLRRLEQPNVVISLSRTEALNHHNTLVCSVTDFYPAKIKVRWFRNGQEETVGVSSTQLIRNGDWTFQVLVMLEMTPRRGEVYTCHVEHPSLKSPITVEWRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords H-2 class II histocompatibility antigen, A-B alpha chain
publication title Effect of CDR3 Sequences and Distal V Gene Residues in Regulating TCR-MHC Contacts and Ligand Specificity.
pubmed doi rcsb
source organism Mus musculus
total genus 40
structure length 199
sequence length 217
ec nomenclature
pdb deposition date 2014-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
D PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4p46D02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 4p46D01
5E2WH 3UXFA 5FB8B 5LKNA 1FZMA 1F8TL 4U6XB 1AE6H 3T4AA 3KPRB 4LLDA 1MWAA 1KIPB 3VXOB 3QIWD 1CFTA 2NY3D 1NGPH 5TE6L 1GHFH 5D7IE 2MPAH 4UU9B 3HG1D 3P0GB 4OCRH 1OAZL 2GCYA 3LZFL 4I5BB 1BM3L 1BEYH 1A9EB 1FQ9C 5KSAD 2EECA 1BMGA 2QSQA 3P0YL 3O6FA 4OLEA 2C3VB 2XTLA 3DJ9A 5DD0H 3DTXB 3BKCH 3QIWB 3SE3C 1MF2H 1Z3GH 3UO1H 1JF6A 1GVIA 3VJ6A 2FGZA 1BECA 5EPMA 4JZJB 1NSNH 4MLSA 4AEHH 1PW3A 4KXZI 4LHJB 3VWKD 4NWTH 3B3IA 1W8OA 3LSOA 3NCYP 1FYTD 3BYTA 3DX9B 2VDOH 4XNQA 4HHAB 4HUWB 2ESVE 1I1RA 4NHCH 2E9IA 2EYRA 1X5HA 2BDNH 3S5LA 3NACL 4HKXA 3DSFL 5IMOB 1SEQH 5JIIA 1A7NL 4XCCH 4YHIB 4O2FB 4FMFA 4Z8FL 1U58B 4LP4A 4XBPA 5C07A 3BW9A 1SJVA 5D1ZC 3SKOA 1GYAA 1RZKL 1I3GL 3FRPA 5E1AB 4RAUA 2BVPA 1G1CA 1V3KA 1KFAL 2JTDA 1KT2A 3FO2B 5D7LD 4RFNC 1KGCD 4HWBL 4PJCA 1UT9A 1NFDE 4NO3B 2AXFB 3BZFB 4E41D 3GRWL 3TT3H 3REWA 1Q0YH 1H3WM 3U7YL 3JV6B 4JFQB 1AR1D 1BZ7B 3HI6H 3IS0X 4LSRL 3ET9F 2C1OA 1A21A 2AJUL 4CNIA 2X70A 3BPCA 2EDLA 1T2JA 1K8IA 4E41B 1OAKH 4RGOH 3VXMB 1OWRM 3UCRA 1NCBL 1OLZA 3K2MC 3V5HB 3HC3L 1YNKL 4UIKH 4ENEC 3QQ9C 3S6CA 4H1LH 4DGIL 5K9QI 1PEZA 3ARBA 3CMOL 5DI8A 1T4KB 5FOBA 3TBVA 4F7EB 3TVMB 1RSFA 5BQ7A 4KHXL 1QFWH 3MRQB 4LU5L 3EDEA 3NCJL 4PYHA 3MRJA 2J6EH 5DJ6B 3QULB 1VFUA 2RAMA 4NZUL 4P2OA 1R5WB 3RKPA 3LQAC 3GNMH 3K8KA 4G9DB 2GITA 1DQML 3SDYH 1JPSL 5I1GL 1MCLA 5KTEH 5IOPB 3OXRB 2VXQL 2EC9T 5DR5L 4D3CL 4L1DA 3QUXC 2P4AB 4FRWA 4QY8A 4M7JH 4BFGA 3VI4F 4JREB 1RUAH 3H6JA 3N1GC 4H0GA 2W9EH 2HVKB 1RIHH 2Q8BL 4M9PA 1YQ2A 1EO5A 3RTQA 4LK4A 4IMLA 3BQUA 2BHUA 3GI9L 4FQHA 3LPWA 1G7PB 4WEMB 1RFDH 3TWCL 4K7FB 5FKAB 3IDXH 3IFLL 1GZPA 1UEYA 3VGHA 2WIIA 3ARPA 5C0GA 2EH8L 5C0CD 1P7QB 1WBZA 5TQ0L 4M02A 5DO2C 2DDQL 1FNGB 3REVB 3GBNL 2IF7A 4FP8H 2DL9A 4EUPH 1UM5H 2H8PA 3Q3GB 3T3MF 3KDMA 4PJ9C 4IRSD 4ZS6D 3ZHLA 2JB6B 3UTSE 4NM4L 2QQQA 2M1KA 4PJHA 3VXRB 1M71B 3PF2A 5A3ID 2EZ0D 5KN5B 3VE0B 4POZD 4OCNC 1FN4A 3P4NB 5HI4C 4IS6B 5HPOA 1FG2B 3BP6B 1MRCH 1MAML 5CEZD 1ZOXA 4HGWA 3LN9A 4MJIB 4M6AA 4W70A 4Z7WA 2VC2L 3TNMA 1YY8B 4X5WA 3FO9B 2NXYD 4X5XB 1CCZA 1MCIA 4U1MA 4PRPD 1I9RH 5AYUH 1EFXD 2FGWH 3NPSB 4EI6B 3VG9B 4UQ2B 3VFRB 5E5UB 1HK6A 1IJ9A 3JBG7 5FYJE 4UINH 2Y5TA 1G1YA 2ZG2A 3VCLA 3W39B 2HMIC 5D93C 2NW3A 1KPVA 4ODVH 1MQKH 2FIKB 4JFDD 1NMBL 5FGRA 5BO1L 5EZJB 3K1DA 3TFKD 1FLRH 1A6ZB 4WUUB 4IM8A 5EO0B 2VLJE 3B5TA 5L2KD 2W59A 4KV5F 1E6JL 4NSKA 4N68A 1KACB 2D9QB 3O2WL 1KJ2L 4OGXH 1BZ9B 3F58H 1H3XA 2V7HA 5GGSA 4L4VD 2VWEE 2F15A 1CICB 3EBAA 1NBVH 1J88A 2MHAA 2LV4A 4ZS7L 1Z9LA 2AJZB 5JW4M 2AJXL 1AGFB 1JHLL 2OBGA 3IDJA 1HH6A 4IMKA 4WCYL 3VGDA 4JLRB 2VDQL 1IM9D 4R2GB 3HAEA 3VGGA 4I1NB 1RIUL 1X5ZA 4AYFA 3SE3A 4JY4A 1N59B 1UB5B 4X8JA 5MEOB 1X4ZA 4NOFA 2CMRL 4UB0H 3MLZL 3DRTA 4X7DC 43C9A 4PG9A 3HUJA 4GW5B 1DVFB 1UB6A 4O2EB 5D9SB 5C0DB 2H6PB 4GW4A 1IM9B 4X6CB 3LB6D 3O4OC 4ZAKA 3RQ3A 1X5AA 3E8UL 2NX5D 3GKWL 3N06B 3BRGC 1YNTB 1QRNB 5C0EA 3OG6B 5IV2B 1ZTXL 3BFOA 4NRZB 2ERJC 4KKLC 1H3PL 1Y6KR 1G7MB 3P9LA 4PJDB 2PYFA 4XPHL 3OF6A 4OZFB 4RFEB 2D03L 2R4SH 3VGAC 4QCIB 3CFDA 1QLRA 4JR9H 3RPKA 3UTPD 3SDCD 5GRUL 4XMLH 4ZSOE 1AHWB 2F19L 4PPTA 5T5NF 4HC1A 2R0KH 5IVNA 3PGCA 3UTTE 4TVPD 1N26A 1XGQB 3SDCB 2BNQB 4JPWH 1KB9J 2IPUG 3MRCB 5C0AE 1UCBH 3P30L 1Y6NR 2NMSA 3GMMB 4KAQL 1SM3L 5A40E 4HEPG 4FS0A 4Y19D 1A1MB 1YYML 3MJ6A 3NFSL 4UT9L 3L3HA 1E27B 1QFOA 4FQQA 4O58L 4ETQA 1MVUB 4F57L 3TH2T 4I77H 2LFGA 3EYSL 3PQYB 4WTZA 3LIZL 1NLDL 3VRLE 3C5ZC 4FQ2H 1BFTA 4L9LC 3GSNB 1K4DA 1IGMH 4PP1D 4I3GA 1BFOA 4L8BB 3RA7H 4XVSL 3SE9H 1F00I 5HXMA 4HS3A 1P4LA 5IHZA 4UQ3B 4NN6C 4NNPH 2BSSA 4NRYB 2P7TA 3BGFB 3VI3E 4JFFE 4JPKH 5DQJA 5DMIH 3E0GA 4Z77B 5GGSY 3GO1L 3RAJL 5JOFB 2W07A 4QOKA 1S8DA 2N1KA 3DXAA 4XI5C 2NY0D 2AGJH 3IDIB 2G5BA 4EBQH 4LKCA 1KENH 4N1CA 5E2UL 5JW4N 2F58L 2IALA 3MBEC 1LK2A 3RNQA 5J3HD 3EDKA 4XMPL 3T09A 1CLOH 4FG6C 4CKVX 1ZE3C 1MNUH 2B1AL 4NKMB 2X4RA 2O5XL 2OK0L 2KZ1B 3GBMH 1DLHB 1K5NA 5IBTL 3O3DB 2I5YH 2A83A 4MB4A 1GOGA 1KBGH 3QIBC 2V2TA 3O3BB 5EOCH 5CJXC 4ZUSA 1QBAA 1RZIA 2E7BA 1EO7A 3MNVB 1KULA 4A6YL 4G80A 2XIDA 4BUGA 5F89A 3MV9A 3EHBC 1F4XL 2WBJC 4HEME 2AEWA 4P5TD 1IKFL 2GY5A 4ZFOA 1BVKA 1RZJC 2P24B 3D39A 5EU7C 3TBTA 3O4LB 4LCCC 4P5KB 3IAQA 1KLGA 5IESL 3FT4A 1ITBB 1ZS8A 2OL3L 5JMRA 5AEAA 3MRHB 1I8MB 4OF0A 1M05A 4NP4H 4Q7DA 2XTJE 3GHEH 1A3RL 4HIHB 4Y4FB 4P5TB 4E5XB 1A1OA 1L6ZA 2VKWA 3QDGB 3SJVD 2XA8H 4GAFB 2MOVA 2B8OT 4OFYD 4C4KO 3TT1H 2QR0A 1EA9C 4PJBA 1BIIB 2AQ2A 4BSVA 4O9HH 5CD5C 4CMHB 1GOHA 4XPTH 1JFQH 3IDGA 4U6VL 3DO7B 1IC1A 2QADC 4IDLA 4D8PB 4U1LB 2CLRA 4J12A 3VXSD 1YEDA 1CBVL 1G7HA 4JHAL 3VDBA 3MFGB 1A6AB 4Q74A 1WFOA 3RVVD 4YJZL 2EYSB 5FYLL 1XGUA 1JGEB 8CGTA 2XWJA 4NNXB 5CP7A 3E3QC 43CAA 3U79A 5F3HB 1I1YB 5T1LD 4FQJL 1QKZL 3QJFB 3BVNA 1I75A 1LILA 2EDOA 5C6TL 1RK1B 3G6JE 3DROA 1QLFA 1J5OH 1QSEE 4AMKL 1QA9A 1UQSB 2OXHA 3I6LD 4C56D 3B9KD 5D5ME 4MNQE 3G5YA 4QRUA 4MHHG 3LEXB 3HI1B 2KBGA 3T0EC 2GJZB 2R4RL 3MRNB 1JGLH 3ISWA 5T1DH 2QQNL 4P9ML 1UC6A 2OTUB 2HJLB 1U41A 3U4BH 1C08A 4C56B 1TVBA 4X6EA 4C57C 3X3FL 3KJ4C 3CVIL 1XZ0B 1KJVA 1VFBB 2P46B 1HHHB 2DD8H 1VCAA 5IWLC 2YC1B 1D9KA 2D31B 3WJJC 1T7YA 5HD8C 2W0PA 4X4XA 5E5MB 3TN0D 4OZGE 2NY7H 1MCEA 3KS0H 3KNBA 4L3EA 5E24E 3EDJA 1PSKH 5CGMA 4NZTL 3I02A 3QPQD 3QDMD 3WIHA 1ZA6B 2IC2A 3W9EB 2L7JA 4DJMA 5DVOA 4DN3L 2GEEA 1CK0H 3LKQA 5D1ZB 5DFVD 2JJVA 4MA3B 3VFTA 3EYOA 3STZA 3TN0B 2PN5A 4TOYH 3UJTH 3VFUA 3QAZC 4M1GH 5I1JH 5EU6D 4RFNB 3OSKA 4NPYB 5JNYA 4S1SH 2HLAA 3QIUD 4HUMB 3MLYH 2XZZA 4PLJC 1ACYH 2ZOKB 2Y5EA 5IFJB 3GSOB 1MY5A 1T5XB 3WIFA 4MCYA 5EA0H 2X05A 5EDXA 4KJPC 1UZ6F 5T3XL 3VMNA 2E7LC 4TUKL 5F1IA 5KVMC 4QWWD 1A1NB 2R2HB 4LVNC 4LARH 4LRIA 5T5FH 3MRIA 3RL1A 3QIUB 1NC2D 4IOSD 3RIFF 1HIMH 1RY7B 2IQ9H 3CNKA 1NCWL 3KYOA 4K23L 5JXAH 5DS8A 4UDUA 1HHJA 1YN6A 3OJ2C 2VDPL 3G5ZB 1KTLB 3MV01 2NY3C 1B90A 1QR1A 1AI1L 2R2EB 3NCCB 5TF1L 3MODL 1WTLA 4HKBB 3UYRH 3KPSB 5BJTA 1R0AH 1VEPA 3MUJA 4GBXC 1NC2B 4NO5B 2C5DC 1ZLSL 5J11C 5KSAC 4ETYA 2E8ZA 1IQDA 2APXA 3BYYA 4YDJA 3NZHH 3ARFC 4LSUH 3TA3D 2AQ1A 3HNVH 4JO3H 2HKFL 4XPAH 4IHOA 4AM0B 3VWKC 3QUXB 2DB8A 3D25A 1OQOA 2PYED 3ZKMD 4XXDB 1LEKB 5DRXA 3LQAH 4YXHH 1ZVYA 4Q9RH 3OMZA 4P2CG 3WDIA 4YNYB 1IKNC 1J0YA 2A6DB 2DQFB 5KVGL 1QTYT 3SCMA 1FZOA 2ZG1A 3N9GL 5B4MD 3LKNB 1JF1B 1TVHB 4XBGB 4BQ8A 1AY1L 2YKLL 5I73B 4NKQB 4CW1B 4KZDH 4RNRB 4PRBA 5CJBA 3AREC 3HKFA 5IMKB 3TM6A 1MHEA 3VGFA 4YR6B 1QFUL 5CJXA 1D5IH 5C0BE 3QDJA 4PJ9B 4XP9H 4KMTL 4XP1L 4M5YH 1L7TH 5HI3D 2EEBA 1Q1JL 2CUHA 4M6OH 5IB5A 4P23A 4JG0H 4MSWA 1A6PA 4HIEB 3OKNA 4RAVB 4N0YL 2X5PA 4XMKL 5D7JA 3RHWK 3FZUD 2YN5A 4JDVA 4PGBA 1I7ZB 2JJTC 3LAFA 4GS7B 4KPHH 5ISZA 3VRIB 5JXEA 2VXTL 2JIXD 3A67L 3ZYJA 3UYPA 3RDTA 3UDWC 3FFCA 4FZEH 5HYSA 1OHQA 2F8VA 1EAPB 1G9NC 1I1FB 5KS9A 4ZDHB 3W9DA 4QHUA 1C16A 5GHWL 1A2YA 4DN4L 5GIRA 3KG5A 4U33A 2R0ZL 1NC4A 2YPKB 5GS3A 2XG5A 3ZO0A 1MCOH 1F11A 1AKJD 2DLFL 1U8NB 3WFEH 5D93B 1PQZA 3QCTL 4S1QL 1UVQB 5FECA 2VQ1B 1F13A 1IVLA 2V5MA 5AUMA 4RFOH 1NAMH 5D2NA 5KAQG 2XZCL 1RJYB 3EO0A 4M7KL 3I84A 1DQDL 2GK2A 5DRNB 5SWZA 4WW1B 5T3ZL 3S34H 3C6LC 2HFFB 5I8EA 4MXWL 2HG5B 4WNQB 2Z31C 2R2CA 5CSZB 5I8OL 5E8NA 3WD5L 3INUL 3DWTA 3KXFB 3LKRB 2FWOA 2HLFD 4G8GA 4OCXL 2H26A 4WI9A 2VB5A 2FL5A 3S4SB 3G5XB 4HG4J 2ID5A 3LV3A 1A7QL 5B39G 1YMMB 4JFED 3L3IB 3MJ7A 4KY1H 5DJYA 3PDOA 1HSAB 5BVPL 1OPGH 5C0IB 3ULUH 1II4E 3L5XH 2EE6A 3VFSB 2GJ6D 2VDLL 2QEJA 1IGFH 4IRSC 4KK8D 2ORBL 4UAOB 3MRPA 3GM0A 4L5FH 3BPNC 3TIEA 3PDDA 4RGND 5L2JA 3IVKA 1DSFL 4POZC 5JHDE 3TJEH 1FVCB 1IAOB 5IWLA 4AT6B 5JOPD 5MHSE 3QA3A 1NUDA 2A73A 1QSFD 3OR6A 4HX1B 1MCDA 2ERJB 1U92B 4Z7VE 4X7TA 2OCFD 5ID1A 4M93B 3EYVB 1LDPL 3ZKXC 4P99A 1N0XH 3QRGH 2A9NH 4M62L 1FFOA 4DVRL 5J6GA 3S96B 1SY6L 4K9EL 1A6UH 4HV8B 1K2DA 3FO0L 3VFMB 3VGAB 5DD6B 5LGKA 1JNLH 4Y5YC 1KEGH 3QYCA 4QO1A 3S35L 3WIHH 3ZSTA 2OJZL 1EZVX 4KHTH 3QI9C 5JW5B 1BD2D 5FB8A 2P5WD 4M8VA 5BZWB 1Q9LA 3RIAF 3KPRA 1HQRB 3OPZH 3TFKC 2MCG1 3DGGA 1MI5E 3TLRA 3UBXG 2BNRB 4ELMB 1KTDA 4UU9A 4KQ4L 3WKML 2EIDA 1OW0A 2J8UA 1X5GA 2AK4D 5LG1A 5E0QA 1S7QB 1A9EA 1GPOL 3GB7B 4P59L 1AJ7L 5ANMB 1HSBA 1RUQH 1M6OB 2C3VA 3QISA 2LU3A 2AKRB 4PBWD 2FJFB 4GMSL 3DTXA 1CTOA 2NPLX 3QIWA 1HILB 1F45A 2X9XA 3O9WC 4G42B 4X9GA 5LWYH 4PY8I 4NCDA 3S9DB 3EJZD 5DFWH 3L3GB 4NQXB 5FYKH 1BX2A 1BLNB 4JZJA 3SOBL 2B1HL 3HG1A 1CTNA 4LVHC 4RMWA 3GSXB 5I18L 4PJIE 1VGEL 1J8HE 1L0YA 3IETB 4JFPB 5KSAA 1I1AD 2AV1B 3ARZA 5IJKC 1JE6A 1MAKA 3NFPA 4HHAA 2ATPB 1NAKH 4HUWA 4NN6B 4YHZL 1QHOA 5FO9A 3Q6FB 5IMOA 3HFML 1JGVL 4YHIA 5EN2B 2DTMH 3E2HC 1U58A 2XXMB 3LB6C 1FYTA 3OKMB 4OUUB 1UWEH 3F7YB 4CADA 2VLKB 3MUHL 4M03A 4PTUA 1PZ5B 2ADFL 3G9VA 2EDQA 1CXFA 4EKXA 5TE4H 3MBEB 3DETD 1WZ1H 2G75A 3DPBA 12E8L 3V2AR 4HSQA 4NO3A 4PG2A 3BZFA 4K8RC 1KB5A 4L3CA 4DQOL 4EDWH 1QBML 4RIRB 4D9LH 4LLUB 4YWGH 5HDQH 3HS0B 4G6FB 1CFVH 4KI1A 5JA9A 4X7SH 1BZ7A 1S7XB 4H25B 4LDOB 2VYRE 1BIHA 1V7ML 5EZLB 3MLVL 5D7LA 2XRAH 4ODHH 4XNMA 3KJ6H 1TZIA 3RY4A 5BRZE 4E41A 1YPZF 5F44A 5BXFB 1YMHB 5J1AA 3I2CH 2WBJB 5E08H 3VXMA 1DCLA 3TYGH 3MJ9A 3V5HA 3EZ8A 5DJDB 4LCCB 3U46B 1T4KA 3MRKB 4F7EA 2CK2A 3F7VB 3WS6C 3KPLB 5DJ6A 3ULUF 1ORSB 5D2LB 3TH3T 3MJ8B 2VSCA 1PBYA 4J23A 3LS4H 5MP6L 3FTGA 1R5WA 2F54D 4JZOB 5DUPH 4KJYA 3WFZA 3U48A 2YMXL 5J9PA 1CT8A 4NN5C 3VI4E 1S7RA 4WVRA 2Q7YA 5IOPA 4DKFL 1IQWL 2QADB 5GGVY 3JTSB 5E03A 4J3UA 5B39A 4U1KB 3MR9B 4XAWH 4HDIA 2WLZA 3M45A 5E2WL 5J0BA 2D3VA 1A4JB 3OXSB 4PJ8C 3S8WA 2F54B 2GT9B 2HVKA 2VZOA 4Y4HB 4JFYB 3KPQA 2LTQB 2B39A 4TVSa 1AE6L 4XBEL 3RY5A 1XR9B 4IBLT 4JG1H 1G7PA 3AM8C 5FKAA 1GHFL 3C5SB 3I3EA 1U95B 2FB4H 2MPAL 4LCYA 2NY0C 4OCRL 2VDRH 1FH5H 1TJGH 4PV8B 4DTGH 4WHDA 1BEYL 4JRXE 1UJ3A 3EO9H 3T3ME 4X6BB 4OSUH 4Y4KC 5DD0L 3Q3GA 3V4UH 3BKCL 3CFJB 3MLSH 1MF2L 5T33L 1Z3GL 1D5BB 1R5VB 2DQUH 2JB6A 2CQVA 4MA8H 3ARDD 5C0CA 3QUYC 4KDWA 4JN2B 3SBWC 1M71A 2UYLB 4NWTL 4LVEA 5CAYB 5KN5A 3QCUH 2D0HA 1TETH 3SKNB 2VDOL 1UKQA 4K3EH 4YXKH 3T8XB 4EI5D 3MV7B 3P4NA 2LQRA 4CL7A 5IMMA 4IS6A 3KJ4B 1JI1A 1FG2A 4KFZC 4NHCL 4QNPE 2FR4A 3DARA 2BDNL 1T66C 1CLZH 1YY8A 1SEQL 3IRPX 2FBOJ 1IM3B 5D7KE 5F1OB 3FO9A 4X5XA 3FT2B 3VFRA 2XWBB 4LSVH 1ZLUH 1U3HC 4K71C 4IRZH 1NMAL 2PO6D 3W39A 4EEEA 5L7XH 2C1PB 5M7QA 2E8YA 2W60B 4HUXA 3O45B 2FIKA 1DUZB 15C8H 1MREH 4OD3H 3MRRB 2X1PA 1UWGH 2A0LD 1CDYA 3TT3L 3U82B 4PRPA 4OCLC 4FQ1H 1S7VB 4WUUA 4Y5YA 3AS0A 3H9SB 1V7NH 1HH9B 4JM2B 5EO0A 3S88L 3HI6L 2EE9A 2J88L 4N5ED 2Z92B 5JLZB 3U9PH 4JFHD 5EBWB 1YECH 4RISL 1QSVA 1BZ9A 1E4JA 2QQLH 5KSVB 4RGOL 3DX7B 2EIBA 1J05B 1CICA 3ULVC 4G8EB 4G9FE 5L2KA 2V9TA 3K3QA 4ZFFA 4QRSA 1RUPH 2AJZA 3W0WE 1AGFA 1JV5A 5BZDA 1QFWL 3CVHB 4RGMC 1CXHA 4JLRA 2R9HC 1P7KB 2CR6A 3HPLB 3PWUB 2AEPL 1FVDB 1OCWH 2PXYB 3B9KC 1N59A 1UB5A 1CFNB 3B8SA 4GBXB 3GNML 4WHYG 4Y5VC 5ID0B 3SDYL 4GW5A 1DVFA 3DECA 4O2EA 5C0DA 4C59B 5L0QC 5J11B 4KI5C 4IRJC 2HWZH 1IM9A 4X6CA 2DF3A 4M6MH 3UTZB 5JPMB 4CMMB 3K8MA 4M7JL 1LO4L 4NQED 3LY6A 1QRNA 2W9EL 1MLBB 1RIHL 3HB3D 5IV2A 3MLXH 4E42B 4YXLH 1FYHB 4IOFD 4N9GA 5FDYA 3KPPB 1SYSA 3WDJA 3IS1X 3EYFB 1IT9H 5FGBA 2H32B 4AJ0A 1G7MA 1RFDL 5FM4A 4N1EA 3IDXL 1UFUA 4KKCC 4RFEA 4BKLB 4ELKB 4QCIA 1S9KC 3MACH 3HMWH 4D0CB 1OGAE 1MFDL 4IJ3C 3QG7H 3S37H 2WW8A 1UZ8B 5K59F 5I17B 4QHNB 1AHWA 1JPST 1GGIH 4NQDE 2UZXB 5E6ID 5J12B 1CDHA 1MCBA 2A6JB 3JVGC 2DM4A 4M61B 4P4KD 5FK9A 5I71B 1XGQA 5D72H 3SDCA 2BNQA 2R0WL 4LQ1A 1KB5H 3MRCA 4V1DD 5EOQH 4HJGB 4UZGA 3ZT6A 3D2UD 3GMMA 4F37F 3A6OA 5HGDB 4PJEA 3LMJH 1MRCL 2Y6SC 4XVUD 4J3OC 3RVWD 3KAAA 5HHME 4XWGL 1MVUA 4QWWC 4LCUB 4M7ZC 2KQNA 3MV8E 5L88H 2C4XA 1QYGH 4V1DB 3BRDA 5AYUL 5TPWH 2FGWL 3KYAA 1BFVH 1RUML 4RQQA 4J8RA 4UINL 1FNSH 2F53E 3UJJH 5FOJA 5I15H 1HEZA 4WGWB 5KSBB 3GSNA 1HCFX 1KCRH 3GBLA 1UM4H 4L8BA 4BUHA 2BRQA 1KPRA 4WFEE 1W2KT 5CGTA 4ZUVB 4YFLI 5ERWB 5AG8A 4NO2A 4NRYA 2L4OA 2VITB 4YEEA 2F74B 2KQMA 3GZKA 1Z9SA 1OARH 1MCWM 5JOFA 3TEUA 5IW6B 4ZXBB 4MQ7B 3MSPA 1CL7H 1YEJH 3U4AA 3TA3C 3QEQE 5C3TA 5BS0D 4OGXL 4JQVA 3F58L 3L5HA 5CCKH 4GH7B 4KMLB 3KYMB 3BDBA 4QHLA 2HFTA 1CLYH 1MHHA 1FLTX 4LBEB 3C6LB 3GSRB 4MJ6A 1NBVL 4IDJL 2Z31B 1DLHA 5IVZA 1YEEH 4JCLA 4WHTB 5K93A 3SDXA 3MGTA 2B4CC 2Z35B 3T77B 1CGYA 3R0NA 1F2QA 1YY9D 5BS0B 4U1IA 5JW3H 1MCQA 2GIYA 1Q0XL 3C09C 1ZVHA 3MNVA 4R4BB 4O51A 4HS6B 4F7MB 3WFBH 4OUOA 1RIVH 5E7FA 3G04B 3QPXH 3HZVA 1T0NA 4UB0L 3RZCD 3WXVH 2H2PD 3CJJA 4TNVK 1NL0L 4M43H 4P5MB 2P24A 3O4LA 4QRQA 1LEIA 4NQSB 1AQKH 1D6EB 4RBPH 3MRHA 3W5NA 1RK0B 3ZLQC 3DUSB 1RJZB 3BPNB 1T04A 5CMAB 3QQ4A 3RZCB 4P5TA 3PWVB 2BC4A 2J8UF 5D71L 3IJYB 3AB0B 2QBWA 1N2RB 3GKZA 1I3UA 2K3TA 1BIIA 3SY0B 2R4SL 1JI2A 4JR9L 2CIKB 5M95B 3TYFA 4LCWE 1FE8H 3MGAA 4XPFL 5T1MB 4NT6B 4XMLL 3P40A 3SJVA 1IAKB 1OP3H 4UUJB 4OFYA 2KKQA 5A1AA 2I9TA 3MRGB 2P47B 3U1SH 2EYSA 2R0KL 3PP3H 5CEZH 3CU7A 1JGEA 4NNXA 5DGRA 4XWOD 5F3HA 1I1YA 3QI9B 4JPWL 3C5JA 1B0GA 5C07E 4Z7UB 1UCBL 3H0TB 3VXSA 5I1EL 3GJFB 3MUGA 4IEFB 1V3MA 1XGPA 1X4XA 1CWVA 4WV1C 1UQSA 4AEIH 3MBXH 5HHQB 5HYIA 1DBJH 3ILQD 3HI1A 1A6VL 4ZYKB 2GJZA 5EUOB 2QLVB 5E2JA 4FQ2L 5C0ND 2OTUA 2HLFC 3O9WB 3C9NA 1AD9B 1OAUH 1IGML 1MVFA 3H3KA 3RA7L 3SE9L 4C56A 5DHXB 4XHQA 4LVHB 2IJ0C 4NNPL 1WJ3A 5DK0B 3VA6A 4CGTA 4OV6F 1DANT 1XZ0A 4JPKL 4ZFZB 1VFBA 5DMIL 1HHHA 3BP7B 2YC1A 2D31A 3H7LA 2EH7H 3DBXB 1WIPA 2ICWI 5E94A 2AGJL 3HA0A 4KK8C 3UROR 3RJDA 5KAQF 2P8MB 4HH9B 2CRYA 3MRFA 1VACB 4EBQL 5GGRA 5JORA 1JL8A 4RGNC 4PP2B 2BMKB 3W9EA 2FHCA 2NY1D 3FQXB 3NFNB 4MA3A 3GBML 5D1QD 3TN0A 1R3KB 2UUDK 1U6AL 2KL6A 5AZ2H 4FXGA 2VAAB 4NPYA 2DS4A 5EOCL 3OAZK 4PLKC 3QDMA 2B20A 4PTTA 1UZ6E 5FYJU 5IFJA 1R3JB 1UXWB 3GEWB 5D1QB 1T7WA 4GG8B 2ED9A 3GSWA 4M9OA 2R29L 1U36A 1QLEH 5E9DD 2R2HA 1FORL 2DWDB 4JFXB 5JDSA 1RJLB 4YDLC 3QIUA 3T65B 4BELD 4FFWC 4NP4L 1H3VA 3HE6C 3TPUB 1NUFA 3GHEL 5F7DB 4BQ6A 3G5ZA 2XA8L 4JPVL 1A6TA 4K07A 4HKBA 5BCAA 4H0IA 3KPSA 5E9DB 3WIIH 3TT1L 4DAGL 3EYUH 2JB5H 1NC2A 4NO5A 5SV4A 4PJHE 4HKJB 4HWZB 2NYYD 4XPTL 5JZ7C 3BD4A 3DUUA 5CUSH 3R8BB 5F7EL 3FONB 3V7AG 4YDIH 1IZJA 2VLRB 3MCKB 3NAAH 1AD0A 4PGEB 4L4TB 5IEHB 1ZV5A 1CL7I 4M6NH 5IB4A 4Z7WE 5GS1C 3HI5H 2VWEC 3VFPB 3WE6B 3MX0A 4HZLB 3B9VA 3OKDA 4LKXA 4C58B 4J1UB 5IJVB 3VWJC 2X2YA 1MIEH 4R7NB 4YNYA 2WNGA 2A6DA 4TSAH 1G7JA 3OX8A 1J5OL 2PYEA 1MCHA 1TVHA 2F5BH 4X7FC 4CW1A 3NIFE 4CVWA 5B38G 1NCTA 4Q9QH 2DTSA 3U6RA 3SQBA 5IMKA 2GFBB 3ARSA 1JGLL 1OGTB 4ZTPH 5T1DL 2HTKC 1U8HB 1MCSA 5FCSH 1ZT4B 5I30H 3U4BL 1FP5A 1M7IB 1HOCB 5IK3B 5MEND 3FL7A 4HH8A 1KN2H 4JB9H 3E6HB 3I6KA 5HGBA 1T0MB 1O7SA 3MFFB 4BFEA 4ODXB 4Z7UF 5F3BA 4U2ZA 4PB0L 3VRIA 5DUBB 3D6GA 2NY7L 4Q9CA 1DFBH 2NCMA 4XP4L 3IDNB 3HR5B 5ECJE 3F12A 4YDVB 5JIHA 5IT2H 2OQJB 2CJUL 2EYTB 1B0RA 3F8UB 3PL6C 4AQOA 4ZDHA 3GIZL 1CK0L 4GUPB 4OF5A 1JHTA 2YPKA 3HUJE 3EKCA 3UBXI 1U8NA 4M1GL 3CSBA 4AG4H 1YEIH 4UIMB 3SPVB 1UVQA 1LDSA 2EDFA 5I16B 4S1SL 3MLYL 4DW2L 4OZIB 3CCHB 1ACYL 5DJ8B 5ENWB 5C3LD 4AZ8A 1RJYA 5EA0L 2ZUWA 3MNZB 4PJXA 2CGRH 5B3NA 3J7HA 4ODWB 1AKJA 1LP9B 2JCCB 3SN6N 4WW1A 2YPLB 3UPRB 5A2KH 2GAZB 3PWPB 2B5IC 1JHKH 3GFUA 3KWWA 1S5HB 1F90H 4LARL 5T5FL 4WNQA 2CLVB 2WWMD 3ROLA 4XPGL 5CSZA 3WEXB 3LH2H 1HIML 2IQ9L 3JUZA 4XNUH 1VSCA 3KXFA 4WHYH 3LKRA 4XHJC 3QJHB 3MZGB 4WW2C 3L5JA 5BV7H 4PJGB 1CFSB 2Z91A 2ITCB 3S4SA 3IGAB 1I85A 1KB9K 4RGMB 4CU6A 2DQTL 3L3IA 4PGCB 4F7TB 1QUNA 3O41A 1HSAA 3WLWD 5JR1L 3BN3B 1H5BA 1Q9KB 3UC0H 3ULVH 5C0IA 3OKOB 3KPMB 4LIQH 5TFSH 3VFSA 2JELH 3PHQB 5L0QB 3HNVL 4JO3L 3RWJA 3ARDC 4IRJB 3STBA 4XPAL 3CFBA 4JFEA 3GHBH 4JQXA 5DJXB 3V4VH 3CAFA 1FVCA 4AT6A 3LQAL 4YXHL 5HGHB 1NCAH 4Q9RL 2GJ6A 4MD0B 4GRWB 3QUMA 3MRBA 3O2DH 1U92A 2E9WA 2MMXA 3PWLA 3EYVA 5ABDE 1RPQA 3B5GA 4D94A 3SDAD 4HV8A 3VFMA 5DD6A 1FVEB 1EPFA 4IJ3B 1QSFA 4KZDL 2PO6C 5ESVB 5HYQB 1CQYA 4OFIA 2JJWA 4QOKE 5JW5A 3ES6A 1B4RA 3DXAE 3VFOB 2X4SB 4XP9L 2MNUA 1J9CT 4M5YL 2A0LC 5BZWA 1KJMA 5DJ2A 1VENA 1HQRA 5CJQH 2XZAH 4JG0L 2XTJC 3O8XD 1IC5H 4F58H 1DBMH 4X9HA 1NDGA 4FTVB 1A6WH 5I75B 2XWTB 2GTWB 4G8IB 2RHEA 4X80H 4OLZH 1BD2A 4KPHL 5E4IA 1S7QA 4KTDH 2P5WA 3TBYA 5ANMA 3GB7A 1RZ7H 3VXUD 3EFDL 1T2QH 2YK1H 3V52H 1QPPA 4HUUB 2P5ED 3FRUB 4S2SB 2AKRA 2FJFA 4FZEL 4LLMA 1KEML 1HILA 3SDXF 4LMQE 3O8XB 4G42A 3FQTB 4I18B 4JRYB 2VUOA 1YEGH 1BLNA 5I8CB 3VXTB 3MV9E 3GSXA 3GJFK 2GK0B 4X6FB 4LQFH 3IETA 4JFPA 4NC0B 3VXUB 4YHYC 3WFEL 2AV1A 3N1MC 3D39E 3ZKND 5EFIA 1NAML 3OKLB 3M1BB 5A2LH 5DMKB 1EGJH 1FNEB 3Q6FA 1Z0NA 3S36X 4HLZG 3MA9H 4F9LC 3B2VH 1G7IA 1I1AA 2DLGA 3CH1A 3F7YA 1I9IL 2Q86B 3IXTB 1PZ5A 4QKXB 1PFCA 1ADQH 4IOFC 3FCTB 3ECBA 5IBLC 1ZHLB 1TNNA 4Z7OF 2ZP0T 1FGVH 4LRNL 4I0CC 3MYJB 4XC3H 3HS0A 5AZEL 4PRDB 1AO7E 3GMPB 3QNZB 5FO7B 5IROA 1S7XA 4KY1L 1KPUA 1N64H 1J12A 5EZLA 5I1KL 4UILL 4ZO9A 5T1KD 2UZIL 3L5XL 5IFHH 3BJLA 5BXFA 1WFNA 1YMHA 2ESVB 1FL6B 1F4WL 3EOTH 2WWKT 3ZTNH 2BSRA 1IGFL 2B4CH 3D1MC 3HE7D 4ZNEA 2FX7H 4P4KC 2NQCA 4L5FL 3MUZ1 4EN3C 4KUZL 5SWSD 4NJAL 3U46A 1O5DT 1EX0A 3TJEL 5T1KB 5GZOC 3ULUE 4PJ7B 1KIUA 3IU4H 3F7VA 5C09D 5DSCA 4GKSB 1OP5H 1Z5LA 3HRZA 4I0PB 4UV7H 3KPLA 1CXLA 5F7YC 5HYEA 2XFXB 3ULVF 1TCMA 3UJIH 3HE7B 1ORSA 4XVUC 4YPGB 3MJ8A 4X4YB 1GXEA 4QRRD 5FHBL 1DQQA 1UJTA 1NFDB 3QRGL 2A9NL 3VDCA 1C5BH 4Z5RB 1C12B 3U7WH 4CDGC 4KC3B 4Y5XB 2WUBL 3UTOA 1EVUA 3GIVB 4U7MA 3KGRA 1JNLL 2G9HA 3DI2B 3JTSA 3ZDXF 1KEGL 4GAYA 4YIQB 4U1KA 2CUIA 1OT1A 3D0VB 3MR9A 4HULB 4KHTL 3QXDA 3OXSA 1A4JA 5SX5K 1WZLA 2F54A 2GT9A 1K8DB 1FO0H 5GGTA 4MAYD 5I1LB 4L3EE 4URTB 4WI7A 1Q72H 1XR9A 1LWRA 5FXCH 2NTFB 3AC0A 5CLTA 5KANG 2EXWD 4XVTL 5LGHH 5L8KB 1IARB 2X40A 1HN1A 3OKEA 2R56L 5IW3A 2ITDA 2OM5A 2WBWB 2MQCA 1EUUA 3CFJA 3RUGF 1JJUA 2FO1A 1AXIB 1D5BA 1R3IL 5LWYL 5CBEB 1R5VA 4WEBH 5DMYA 5H94B 4ZOCA 4JGMA 1AFVH 1P6FA 2AW2A 2ZKHH 2V2WA 4R0LA 4DGYH 3VU2A 4R4NC 4UNVA 5CZVH 3T8XA 2WUCH 1ZVSA 4D0BA 4ZPTA 1NAKL 5FYKE 3EUUA 5ESAA 1DBAH 4HMEA 2H2PC 1BBDH 1IM3A 4WWKD 1P9MC 2DTML 3UX9B 3FT2A 1UWEL 3DO3A 1JGDB 2R1WA 4EI5A 4MYWB 3BWUC 3KPTA 4CN6A 3RX5A 5DMGD 2BXZA 1QRKA 5TE4L 2DJSA 4G7VH 4FQXD 2C1PA 2W60A 1QBBA 3O45A 1AGBB 4YC2C 1DUZA 2RJMA 3S97C 3S98A 4Y1AE 2NZ9C 5MERA 3QUMH 1FFNB 4EDWL 3UTSB 4YWGL 5HDQL 1S7VA 4I9WD 6CGTA 4JM2A 1HH9A 4PJAF 4X7SL 1JTTA 1DUYB 4YHKL 2PO6A 2Z92A 1TITA 3O6FD 5JLZA 3B8YA 2XRAL 4ODHL 5D1XD 4TNWF 5EBWA 4JDTH 1INEH 2IMNA 3I2CL 4P2RD 5KSVA 5E08L 4GAJL 3TYGL 4Y89A 4EJ1C 4XH2B 1J05A 3MJGX 1CD9B 1MJUH 3RVTC 4G8EA 4XNYH 5D7IF 4QTIH 5A16B 1WGOA 4ZUUB 1DEDA 3CVHA 3H3BC 3HE6B 3WFCL 4GQPH 1MY7A 1T7VA 1MLCB 1MCFA 2XKUA 4P2RB 3MOAH 3FB5B 5E8DH 4Z95H 3TZVD 3P3YA 1JRHI 3NCYS 3LS4L 2OZ4A 1RZJL 2PXYA 3IXAB 3QDJE 5DUPL 5AAMA 1CFNA 4HK0A 3FHQA 1BOYA 4MVBD 3WLBA 4M4PA 3GMQA 3ARQA 4OCMC 4FNLH 5HI5D 5FYJH 3RWDB 3WNKA 2VLJB 3L3JB 1JYNA 1UCTA 4L1HA 3UTZA 25C8H 3TZVB 2GSGB 2IBZY 4XAWL 2OXGA 2DM7A 1N5YH 4X4MA 2W38A 5ISZE 1WWCA 4G7YH 4E42A 3FN9A 3SEPA 3SKMB 1OY3B 3QG6A 1BQLH 3EYFA 3FFCE 4JJHA 3CSYA 3K4AA 4JG1L 5CD3A 5KS9E 4JPIB 1V05A 3VWJB 2IH3A 2FB4L 4WI2A 4BKLA 4ELKA 2AEIT 4LSPH 2FSEA 1FH5L 2VDRL 1TJGL 5LCVH 4LPCA 4DTGL 4XVJH 4PY7A 3EO9L 5CWSA 1UZ8A 4AIZB 5HVHB 2X4UA 5I17A 4OSUL 4KKNA 3TCLA 1B2WH 2NY6C 2NY1C 4N8VG 3MLSL 1KELH 1HKFA 4TRPH 5DVKA 4HK3N 5D2NE 3VRJA 5D4QA 4MA8L 1EHNA 1DBKH 2AJ3A 1ZEAH 4TYUA 5SWZE 4APQD 2VR9A 4BFIA 4JKMA 1A7RH 4R7DB 4K3EL 1ZLVK 4PJXF 2GQHA 2VDKH 5KSUA 4HMCA 5E6IA 4HUNB 1EO8H 2VLLB 4OQ1A 2V6HA 1CLZL 2ARJQ 1JTPA 1AXSB 4G8GE 2VZ3A 2ZUQC 4LCUA 3WL9B 4DUVA 4K3JH 4DZ8A 4OCWH 4APQB 4V1DA 2HJKB 3DVGB 1EDQA 3L3KB 3OR7B 3OKKB 5EIIA 5DQDL 4TSBH 5DHYA 2R39A 2XKNB 4IRZL 4U0QB 3OJMB 4NHUB 1BBJB 3T0EE 4B7LA 5FO8B 2Y23A 1IGCH 4LGRB 3PL6B 5KSBA 5L7XL 3VGBA 3RGVC 1JCKA 3VXNA 1K4CB 15C8L 4ZUVA 4OD3L 3WN5C 1UWGL 4EIGB 3MLUL 3OAYH 5DWUH 2VITA 4FQ1L 3BSZH 3BIKB 4JKKA 2K1MA 3I85A 2Z8WC 3OTTA 5F1NB 1T83A 5IW6A 1MCRA 4MQ7A 5JO5B 5IVOA 2BK8A 5C0AB 1IAIH 2XNAB 3U9PL 1MHPH 1ODAA 1EXUB 4ODTL 2A6IB 2QQLL 3KYMA 3IF1A 1I8KB 3NIGF 3HZMB 2I07B 3CX5K 5DEGB 3QH3B 1OTUD 1RUPL 3LKOB 4WHTA 3FMGL 1L4IA 4X9BA 2Z35A 1G0YR 4XX1E 3T77A 1KG0B 3F7RA 5BS0A 4U3HA 2CK0H 2P8LB 1F6LL 5IM7A 3KPNB 3KLAB 4HS6A 3JV5A 5I1AB 3O0RH 1YNLH 3GMOA 4H20H 2XQYK 1C5CL 1HNFA 4OGYL 1U2CA 1S9YB 3BP5B 2MQ3A 1IL1B 2UWEA 3MOBH 2HWZL 2KUTA 2OR7A 3BT2H 2BOBB 1RVFL 3DMMD 3EO1B 2YD4A 4OLWL 1D6EA 1HDMB 2J8UE 4B5EA 1RK0A 5DLML 3DUSA 1BF8A 3MLXL 1XIWC 4YXLL 3RZCA 3L7FB 2Y25A 3HC4H 3QBTB 4FFZH 5DRWA 1T5WA 1IT9L 3IJYA 5F7NC 4F8QA 1N2RA 2D0GA 1PY9A 4OFKA 4CUCA 2ZCHL 2C3WA 3SY0A 3HG1E 1E4WH 2AAVA 5C08D 5K9QG 3ZL4H 3HMWL 3T1FB 4I2XE 1ZMYA 1VGKA 3OZ9H 5FUZH 3QG7L 3D3VD 5T1MA 3S37L 4NT6A 4MQTB 3AMKA 4FQLL 5F7MC 2DL2A 5GJSH 4NUJB 1IAKA 1GGIL 5F6IC 2VTFA 2E9BA 3MRGA 1RULL 3HHRB 3IT8D 4O02H 3V6OC 1EHLH 1A7OH 1A3QA 1LQSR 2IFFH 4CN1A 5D72L 4OAWB 3D3VB 4JN1L 4MD5A 4MA1B 1FYTE 1XF2B 2XICA 2FATH 5B3JF 3GJFA 3ELAT 3JV4A 3LMJL 1E4XH 4UNTA 2XTJB 2PTTB 5ICZB 4YBQD 4OTXL 2FJHB 3PNWB 5KVDL 3BH8B 4Z76A 3ME0A 1A0QH 5HHQA 2H2SC 2XACC 1VFAB 5L88L 4ZYKA 3NABH 5TPWL 3T0DA 4LHUG 4LLWA 5EUOA 1BFVL 2CDEB 1FNSL 5I15L 3VMPA 1AD9A 1OAYL 5D7LE 2JJSA 4WY7H 5LAXA 1KCRL 1KGCE 2H9GA 1UM4L 1ZHNB 4HLZH 5BW7A 4R8WH 4E41E 2EE3A 1NGXB 3CZFB 3TBWA 1LEGB 5FYLD 5CJOL 5I74C 3UPCA 4N8VA 4YX2H 1L9NA 2YSSB 3BDYH 4ZFZA 3WLWC 1EV2E 3ARWA 4IIQC 2A77H 2OZ4H 3ARGC 1OWWA 1OARL 3FQUB 3QXWA 3HC0B 4PRHD 3RU8H 1G9NL 1R24B 5CBAA 3EDFA 1KXVC 1GSMA 1GRWA 1YEJL 2D9CA 1QFPA 4QXWA 2GY7B 2P8MA 1HXYA 1EFQA 5DJAA 3UZVB 1VACA 3LS5L 3QEHB 4L8SC 4Q6IC 4Y16C 1QSEB 4LGPB 3QFJD 2O26U 5IVXB 1ZWIB 3F6LA 3FQXA 3NFNA 1QO3B 1S5IH 4KROD 4MNQB 5DC0A 4EDXB 2X4PB 3IJSB 1R3KA 4JAMB 5IIEA 1YEEL 2VABB 1UENA 2V5YA 2VAAA 1T89A 5JW3L 1C8PA 5C7XL 1ZANH 3BUTA 1F97A 5FGCE 3QFJB 3SDAC 1VFOA 1NQBA 4D0DB 3WFBL 1RIVL 1S7WB 1UXWA 3RWHB 3QPXL 2ZOLB 3FO1B 3PGFH 5D1QA 2KPNA 4KK6D 4LASH 4GG8A 1WIOA 5IG7A 4L29B 1G9MC 3R1GH 3WXVL 4DKEH 5HHPA 4YH6A 4M43L 2AS5M 2DWDA 1NJ9B 4JFXA 1GH7A 5EORH 1AQKL 1HINH 5I1DB 3BKML 3T65A 2AEQH 3TPUA 2CLZB 4EN3B 5F7DA 4MQXD 2Y36H 5HY9B 3V5DB 4R96A 3O6LL 3CK0H 4PS4H 2ZUTA 3E1F1 1I7RB 5E9DA 4U1GB 3T2PA 5JUEH 4WW2F 5C0CE 2YUVA 4HKJA 3ALXA 5FCUH 4TSCH 1OAQL 1FE8L 2E5EA 3FONA 2VLRA 4XNZC 1ZGLP 2NNAB 4PGEA 4HS8H 5IEHA 3LD8B 2W0FB 5DEFA 1FNHA 1ND0B 4PJFB 3GUTB 1IAII 1P69B 2HJFA 5EU5A 2UZYB 2BFVH 2J5LC 2NY5C 3VFPA 5IQ9B 1JN6B 3B6SA 4RSVA 4NQUA 5IJVA 1CE6B 4R7NA 3T0VA 1QQDB 5CEZE 5HGAB 1LO3H 5D6CB 4KZEL 1T0PB 4IOIB 2QKIB 4AEIL 4ERSH 3MBXL 5K9OB 1UADC 3F7PC 1DBBH 4F7CB 4PRPE 1HKLH 5ACZB 2FO4A 2R2BB 3GMLB 4DCQB 4QGTA 4QXGH 5F9OH 5C71A 5J57B 4WUUE 3GM8A 3BPOB 2GFBA 1OGTA 4HKZA 3MCLH 2F9BT 1U8HA 1AGEA 4PRNB 3ZT7A 1OAUL 1M7IA 4JFDE 1HOCA 1DTUA 4RX4D 5ADPH 1TZGH 3FB6A 3E6HA 5IFAL 4ODXA 5F7FA 2NY4C 3ZDZE 5L2KE 2EH7L 35C8H 4R3SB 5DUBA 3KR3H 4WEUD 1KXQE 3HR5A 3OG4B 2UVEA 4YDVA 3UZQA 3KPOB 3RWEA 5IUSA 2OQJA 4L4VE 2EYTA 2P8PB 2WP3O 2XV6B 1KCSH 4GUPA 1W72B 1P1ZA 4F15B 1WBYB 1XF1A 2IAMD 1T1WB 3SGDH 1SVZA 3WUWB 4HFWB 2QTEA 4X6CE 1L0QA 2YA2A 3SPVA 4AQ1B 5AZ2L 1AQDA 1IEBA 3HMXA 5CHNB 5I16A 1WC7B 5C0BB 5FM5O 2XOTA 4YHNB 4OZIA 3CCHA 1X5YA 5DJ8A 1W72H 1QZ1A 5ENWA 4AEFA 1ZA3B 3M8OH 4TTDC 3VH8B 1KTRL 3U83A 3PHOB 4YGVB 5HHOD 2V5TA 4HWEH 1NUGA 1JWUB 1LP9A 2JCCA 4R97C 2YPLA 3UPRA 2GAZA 1E4XI 3D85B 4K8RL 2CLVA 5CIPH 5DJZB 1NCNA 2NX5E 3VXPB 3G6JF 1JGUH 4O2CA 4ESKA 6FABL 2VERN 3AY4C 5D5MF 1CVRA 4U3CA 2ITCA 2VR4A 1AGCB 3IGAA 2IFGA 3L95A 3WIIL 4WIQA 2JB5L 4F7TA 3WFHA 5JPNA 1N3NA 1GGUA 3UTPE 1Q9KA 3U36B 2WM0A 3G9AB 3OKOA 5CUSL 5EC1B 3KPMA 5I1CH 4P46B 4EUPG 4G5ZH 3PHQA 2X1QA 1MHCB 1RZ8B 2DQDH 4J6RH 1FZJB 2BXYA 4PJEE 1EEYA 5GRJH 1I7UA 4PY8J 5KG9B 5MI0C 5GGUB 3BEVB 4LF3A 4M6NL 5DJXA 5T3ZD 4QXUL 1R3LB 5IB3B 4TVPE 2NY2D 3VD7A 4OZGF 5HGHA 4MD0A 4QTHB 3WCYA 5ETUB 3GK8H 2X4QB 3QZWG 1MIEL 3ZZ1A 1J10A 2Y07H 2YBRA 4S1RH 5E95B 3X11B 3PV7A 4Y19E 4WWKC 4M48L 3BPLC 3OJVC 4G43B 2NY2B 3IDYB 1J11A 1MEXH 3QNYB 1PX3A 3GSUA 1FVEA 4GAGL 3LHPH 4JFZH 3HCVB 2BSTB 1F3JB 2QHRH 3V4PH 5GS0C 4Q9QL 5ESVA 5J4MA 5CGYC 5F9WC 4FQXC 1VEMA 4ZTPL 5TQ2H 1T1YB 3GMNB 1LD9B 2EDYA 2EDKA 3VFOA 2X4SA 1FPTH 4ZQKB 4Y2DB 4K7PY 4WTXA 2PW1B 5HGGS 3LRSB 3ULSB 4WWID 4JB9L 2PTVA 3O6FC 3S3SA 2XWTA 5D1XC 4G8IA 5EC2B 1EEQA 5KW9H 2O61B 1JZ5A 4P3WA 5FV1L 1QNZH 5MEPB 3SDXE 3TO4D 4YHOL 1DFBL 4HUUA 4Z7VB 4FZ8L 3DV6A 4GMTH 1VHPA 5IT2L 4S11A 3O8XA 5J13C 2DBJA 3BP4A 4I18A 2AV7B 4JRYA 1IRAY 4WFHD 5I8CA 3B2UD 3VXTA 4K7PL 1KXTB 2GK0A 3AU1B 4RMUA 1TENA 3WV0A 1W0WA 5DTFB 3TO4B 5KANI 3VXUA 1AGDA 1CDIA 4AG4L 1YEIL 4LLQB 3DGCR 5DUMH 4UOJA 4RRPA 2XT1B 5E6ZA 4PV9B 5DRZA 1BJMA 3OKLA 5H2BB 2UWEF 3QHZH 1T1XB 4WRLA 3FAXA 1FNEA 1MI5B 5HI5C 1XH3A 4NZRL 5ACLA 3CLEH 5I1HH 4KU1A 4G8FB 4Z7OE 1JHKL 3IXTA 3BN9D 4MXVE 1JNNH 4U1NB 2F8XC 1CFQA 3HNSH 4XNUL 3FCTA 4X9FA 3BGMA 2VN7A 1N7MH 2D7PA 3LDBC 4U49A 3SJVE 4H0HB 5CJ8A 3ZDYF 5D7JD 2VLMD 1P4BH 3MYJA 3TP4A 3S5LG 5A2JH 1MFEL 3GMPA 3QNZA 5FO7A 3BMWA 1S7TA 1X44A 3RVXD 1J8HB 4U6YB 1YEKH 4NM8L 1HYSC 3ULVL 1WWBX 2Z0BA 3AS3A 3UC0L 3RX8A 1NKRA 2ESVA 1MQ8A 2FEDD 1FL6A 2DMCA 3OGCB 4R90H 3ARBC 3RPIB 2JELL 3VXSE 4S0SD 4AH2B 1AXTH 1XMWA 4HGMA 1HZHH 1U8JB 1T03L 2PUQT 3GJEA 5E99H 3GSVB 3V4VL 4ZMAT 1W0VB 1T3FB 5T1KA 4P2OC 4PJ7A 3IDUA 4HCRH 4LIQE 1IC4H 1HHIA 4GKSA 1BZQK 3MYZA 1NCAL 3UZEA 3TO2A 4J3SA 2XFXA 3SKJL 3HE7A 3O2DL 5I6XB 4X4YA 4MMZC 3OJDB 3KVQA 3V6ZB 3SGDI 4PRID 1NFDA 5DVMA 4OLXH 1C12A 3ZYIA 3I6LE 4C56E 5K9KB 3SDDD 1FZKA 1O0VA 4HBQA 4Y5XA 1OD9A 1CG9B 1YEFL 3NMEA 5C09A 4DEPC 3GIVA 5HDOA 2D2OA 1TJIH 5EBLB 5DHVB 3CLFL 4YIQA 4KRMB 1CDGA 3RTQC 4WO4B 4HWBA 3BQUC 3V6FB 4QRRA 2NR6D 4LNVA 3PABB 3RWFB 5F6IB 1K8DA 1YQVH 2C9AA 2GTZA 3GRWA 5DYOA 3SDDB 3QEUB 1A3LH 5CJQL 1OSPH 1X6NA 2XZAL 2MSPA 5FKPB 5DHVH 3WBDA 1NFKA 4F58L 1DBML 3IU3B 3Q5TA 3ABZA 1A6WL 4OQTH 4GLRH 1EAJA 4OLZL 4KVNH 1SEBB 2J4WH 4ZUWB 3RUGE 2XZQH 4MAYA 1MFAH 2H41A 1T2QL 2YK1L 5D70H 3V52L 4J3WA 5E2TH 1NEZB 1QVOB 3BEWA 3EOYG 1OTTC 3KYKH 3QDME 3EFFB 5CBEA 5H94A 1YEGL 1MAJA 4WI3A 5JW4Q 1P2CA 4LQFL 5EU6E 4MS8C 2EIEA 3BZDA 1UWXH 5DXWA 1J0HA 3C60B 1EGJL 1PG7X 3MMEB 2PETA 4F9PA 1SJHA 3B2VL 4QRTA 1WAAA 1F58L 5GRVL 4Z7VF 4JRXB 3KPRD 3WHE0 1ADQL 2BHYA 2XXCB 3P2TA 4Y2OA 1AGBA 3D87B 4WWKA 1FGVL 2Q20A 4ONGH 1GGBL 2DQIH 1FFNA 4W4OA 2WLYA 4XC3L 4AENB 3LEVH 1WT5A 5IHLB 1GGCL 1MFBH 1DUYA 3DRQA 1IGYB 1N64L 1P4IH 3EJYC 2OTWB 4MZ3A 4PLOB 4FQXA 3MROA 5HHXH 2I9LA 3EOTL 4YUEH 4MMXC 3ZTNL 4X0KB 4GKNA 5D96C 4IMKC 1JZ3A 2FX7L 3VD4A 1UACH 3MLWH 4YBHA 2PYEE 1FRGL 2EXYD 5D1XA 3IFOB 4JVUA 4ZUUA 2DOCA 3FB8A 4G6JH 3QR2A 1G9MH 1MLCA 4P2RA 3U30B 3OB0H 3WO4B 3UJIL 4C4KT 4L4JA 4YBQC 3D9AH 1H0DB 5SWQB 3Q5YA 4WJ5B 2I25N 3IXAA 1C5BL 1JZ8A 4KTEL 4ZAKC 3U7WL 4Z7QE 1MCPL 2Z4QB 3DX6A 2ZSWB 4PJIF 5A43C 3MXWL 3Q6GL 2AJYL 4ODUA 2VLJA 3L3JA 1CD1A 4TPRL 1C7SA 1WCBB 3TZVA 4DFIA 1CU4L 5I2IB 3C2AH 1U8PA 1LO0H 1S7SA 2LAAA 4MGXA 5TJWK 1FO0L 4R4FH 1M7DB 3HAEG 2DBLH 3W5MA 1Q72L 1ROWA 4GG6A 4FFVC 3W0WB 1HI6A 4GRLD 4TULH 5F72S 4KKBD 1KJ2A 3VXMD 1Q38A 4XCYA 3STLB 1OF2A 1RJCA 2NY5H 5EWIL 4NFDA 4BZ1H 5F7KC 3OL2A 4H1LB 1BP3B 2LABA 1Y18B 2D0FA 4KROC 4WEBL 3TNNB 1HQ4B 3TVMD 1F8TH 1S78D 4GRLB 1FBIL 3PGDB 3L3OB 1AFVL 4JHWH 4EOWH 4PJXE 5KVEL 4DWHA 3I9GH 2ZKHL 1QSZA 2HN7B 4DGYL 2JK5B 2Q76B 1X7QA 5F97E 3F65A 5CZVL 3IAPA 4MJ5A 1OAZH 2X4OB 1T7XA 4Q97A 1BM3H 1QFWM 2ICCA 4KK6C 1XF4B 1JUFB 1DDHB 1BBDL 2XKSA 3LRGA 4APQA 2HJKA 2AJSL 3DVGA 2CIIA 1DN2A 3OR7A 3BKYL 3VXQB 4H26B 2A74B 1OGAB 4NHUA 4M8QB 4GOSA 1G7QB 4MQXC 4G7VL 3R0MA 4XTRD 2CDFB 3FJTA 3HPJA 4NQDB 4PGZA 2XQBH 2Y06L 1YUHA 2AABH 1N8ZB 1OP9A 1P7QD 3MTRA 1Y0LB 3BIKA 3O6ML 4JFEE 4N0FB 1S7UA 2I60L 5F1NA 4JY5H 4Z8FH 5JO5A 1ZLWK 4WTWA 2OI9C 5C0AA 3NIGE 4EUPB 1EXUA 4WTZG 1H8OA 2GJ6E 4JDTL 1JNHB 1E28A 1RD6A 1G7LB 1G6RH 1I8KA 2VO5A 4GLRI 3VXRD 4R97B 3HZMA 3F5WA 5DEGA 5TE7H 3QH3A 2DIAA 1MJUL 4RGNE 5KZCB 4XNYL 4A2LA 5TDPA 1FL5A 3U7YH 4NNYB 5JOPE 3D69B 1KG0A 1QSFE 3EGSB 5HYJD 3BGAA 3MOAL 4LSRH 3KLHC 4MJID 5F1SA 5E8DL 4Z95L 4QRPD 1PAMA 2VUYA 1NGZB 5I1AA 3ZYOA 1UGNA 2B2XH 5E70A 3QDAA 1S9YA 3WHE1 3O81A 1NCBH 4DOHE 3V7AE 5IQ7H 1IL1A 1VESA 3HC3H 2CKBH 4X98A 1PKOA 4FNLL 5DDHA 5FYJL 3SHSA 2BOBA 5HYJB 2DI8A 2E27H 3EO1A 4ONHA 4L8CB 4QRPB 5HDBF 4KHXH 1HDMA 4QNPF 1BD2E 4LU5H 3QEQB 2P5WE 4G7YL 2W0LA 5ANME 5HHVH 4LHQB 3L7FA 5JTWA 4WUUD 4KDVA 4X8XA 1TPXB 2FHFA 4HXAL 2GI7A 2X4NB 3VG0L 2NXZB 1VKXB 3DMMA 1GC1C 2ZSVB 3IKKA 3BZEB 4BFBD 1CLCA 5I1GH 1NMCC 3MV11 4PBVC 4U1HB 3ROOA 2AK4E 5LCVL 1IGJB 4XVJL 2ICEB 4JY6A 4LAJH 4YBLC 3I6GB 2ICWJ 4XCNA 3BPLB 2DM3A 1CICD 5JW4R 1B2WL 4N0CC 5I66B 1KELL 4NWUH 4MCZB 1FZMB 3OQ3B 3T4AB 2YN3A 5C08A 4F2MA 1DBKL 4R2GD 3GI9H 5B3JE 3IKCA 1ZEAL 1CFTB 8FABB 3D3VA 1XF2A 4GRMB 4Q2ZB 1A7RL 4KJWD 4A6YA 2C3HA 4HFUH 3ULUC 4ONOA 4OCSH 4GW1A 2E6JA 3BUYA 5GS0H 2DDQH 4ZO8A 5ICZA 1DVFD 3GBNH 2IWGA 1EO8L 2FJHA 3PNWA 3BH8A 1MWAH 2JJUA 3JV0A 5DD1H 4JDZA 4XPBH 4ALAH 4K3JL 4JGUA 1URLA 4OGAC 1VFAA 3VJ6B 2OL3A 1BQSA 2HT3D 1QRND 4OZHA 1LO2H 5IEKB 4OI7A 3QUZD 1A5FL 3OAUH 2E7CA 4LCWB 5CSGA 2QJDA 3LSOB 1F3RB 1X5XA 3BAEH 3DI3B 2FRGP 1SBBA 1D9KC 3CZFA 3DX8B 1LEGA 2EYRB 3S5LB 1QG3A 4I3SH 4ZNEE 3NZ8B 3BSZL 3SO5A 3QUZB 4FA8A 3UMTA 4H88H 3H3PH 3HC0A 1R24A 4MXQC 4LPYA 2AQ3A 1IAIL 1S9VA 4LVOC 3BO8B 1MHPL 2YRLA 1ZGLB 5IHUH 1KLUA 3NN8A 2IG2H 2OMBA 5IVXA 1ZWIA 4M1CD 2BNQD 1NMBH 5FYKU 1QO3A 2B7DT 4LOUD 4MNQA 5BO1H 4PRHA 1AP2A 1KCKA 4EDXA 2X4PA 3IJSA 4JAMA 2VABA 4YE4H 1U9KA 5F1KC 3BKJL 2IH1B 1ZGLM 3O2VH 3D18A 2C1OB 3QFJA 4CNIB 2F54E 2ZCKL 1YNLL 4KRPD 4LRIC 5B8CB 2ZOLA 3FO1A 4H20L 3PQYD 4L29A 4OKDA 1TQCB 2AK1H 4LPWA 2YD9A 3NVQA 3MOBL 1NJ9A 1JHLH 3ARBB 5FOBB 5BQ7B 3JZ7A 1A4KB 5E8EA 5GSRA 1MUJA 2VDQH 2XI9A 4KRPB 1WV7T 2CLZA 5K9JL 3BE1H 2CPCA 5HY9A 3PWJA 3HC4L 4FFZL 3NIDE 2Y72A 3SE8H 3IFNH 3JTTB 4KK5C 4HIIA 1T80A 1H3TA 2DQGL 1E4WL 4J3XA 2J1KA 3ZL4L 1NGYB 1ZT1A 5EBMB 3DHJA 2AP2A 1CIUA 4QY8B 5F7LB 5IF0A 3E8UH 1Q94A 5GJSL 2NNAA 3GKWH 1J18A 4DEPB 1MRFH 4JKLA 4Y7MA 1ZTXH 1ND0A 4PJFA 3GUTA 4KWUA 1MPAL 1T22B 3NCEB 3RY6A 3IAGC 3RTQB 4O02L 5INCB 4RMRA 1A7OL 1MCKA 1H3PH 5IQ9A 4BQBA 1B4JH 4WGVB 3RFZC 7FABL 4FQHB 5DFTA 1JN6A 4MB5A 4GFTB 3LCYA 3SCMC 1GZPB 2FX9H 1CE6A 3LN4B 2FATL 1CQKA 1WBZB 1FJ1B 3DVNB 1UA6H 5E8OB 5HGAA 4GT7A 5GRXG 1DN0A 2HKHH 2C3GA 4QHMB 4IOIA 2F19H 1A0QL 3O4LD 3KDMB 2VRAA 2VZVA 1EHXA 3X17A 2PR4L 3NABL 4P23C 4P3DB 4Y4FD 1QPXA 2RBLA 4HIJA 3QDGD 4PRNA 4LNRB 4WY7L 5D7JC 3P30H 4R8WL 5F7HA 4OIAA 4BA8A 1VA9A 3TIDA 4ZFGH 1SM3H 5JXEC 1RHHA 1KJ3L 4LLYA 1MCWW 1YYMH 3VFWB 2BCKB 3CUPA 3BDYL 4UT9H 4AIOA 3TNMB 4WDIB 3RDTC 4U1JA 1A7PH 5E7BA 3RU8L 4R3SA 4ZUTB 4XGZB 4JFHE 3EYSH 3EOAA 2BHZA 1F4AA 3KPOA 4RX4A 1DQJB 3VCLB 4NRXA 3GSQA 2ED7A 2P8PA 2OLDA 4G3YH 1KCUH 1ZSDB 4OT1H 2YEZB 1S5IL 1HHKA 5LBSH 5D2NC 2RB8A 3HTLX 3WUWA 3MZTA 2QQKH 3RAJH 5AAWA 1WC7A 5ILTH 1ZANL 1OT2A 1MJ8L 4X4ME 2Q1EA 4NSKB 2XN9D 1ZA3A 1REIA 3VH8A 3PHOA 4LSSL 2IAMA 4LASL 5HYSG 1JWUA 3R1GL 5DD5H 4DKEL 2J12B 3X14B 4RMVA 2YD5A 3FOMB 2HYMA 2O5XH 3D85A 3CFEB 2MHAB 5FGSA 5LGJB 1MJ7H 3IDJB 4Z78A 5EORL 4NQEE 3T2OA 4JQIL 2XN9B 2CDGA 4S1DC 4DKAA 4GG6F 1U3JA 3RNKB 5HHOA 5J6HA 4PJCF 2DYPB 2Y36L 5FA3B 4HAFA 1BQHA 2LU4A 5IW1B 1AGCA 3CK0L 4PS4L 1KCVL 1Q9WB 4X8JB 5JUEL 2VISA 2FHBA 43C9B 1EBPA 1UB6B 5FCUL 4TSCL 2IMMA 5EC1A 5F6HI 3HAEH 4P46A 3SGJA 4ZAKB 4X9IA 5HDLA 2OL3H 3CH8A 1MHCA 1RZ8A 3KLSA 5D1ZD 4HS8L 4OLVH 5KG9A 4N0UA 5KJRL 1IGTA 2BFVL 5IB1A 1FG9C 4NKIH 3L1OH 2DICA 2PYFB 4V1DE 1TNMA 4QTHA 2ENSA 2X4QA 1QLRB 1DL7H 1FSKC 3VD5A 3X11A 5KSBE 1LO3L 3AFLA 1RI8A 4G43A 4HT1H 4ERSL 1RUKH 4O5LH 5I19H 5F8QC 2OYPA 4K3DH 1DBBL 1JBJA 2E6QA 2DJ4A 1HKLL 2V5SA 1F3JA 4MDIB 2C7UA 4QXGL 5F9OL 1VADA 1ZXQA 4ENED 3QQ9D 5K33A 3H9HB 1T1YA 1FNFA 1LGVA 2EE2A 3GMNA 4FQJH 4F33B 1LD9A 3MCLL 3QSKB 4PUBL 3VFVB 3P73B 4ZQKA 2EIZB 5C6TH 4Y2DA 4BH7A 1OW0C 3KPSD 2UV3A 4HC1H 3U4EB 3LRSA 2D7TH 5ADPL 2D7OA 3HRPA 3ULSA 1TZGL 4ACPA 4CVZB 4YHLH 4FQQB 4ETQB 1JMZA 1MIMH 1WITA 4NDMB 1NANH 1IAMA 5EC2A 3QIWC 3PJSB 2O61A 1F42A 4HWNA 35C8L 4XX1G 4M5ZH 5MEPA 3KR3L 3V7MA 1RV6X 4JZJC 2R4RH 3CXHJ 5BS0E 1A14L 4JZNB 1DP0A 3QUXD 3ZTJG 4XT1C 1PG7W 1WTGT 5J56B 4AL8H 5F70A 2VXVH 1KCSL 1H3UA 1P4LB 2DKSA 4PJHF 4YGAB 3BZ4A 4RMTA 2P7TB 5DTFA 3TO4A 4N1HB 2ADIA 1IGIH 5DQJB 2UWEE 5TDOA 3L5WB 4WI5A 2FYYB 4PV9A 4QOKB 1S8DB 4OJFH 1SY6A 1W72L 4K94C 1T1XA 2HH0H 3L7EB 3DNKA 4YFEA 2XY2A 4DKDC 5DO2D 1MI5A 4Z7WF 1KIRA 4HWEL 2IALB 3WMSA 3C8KA 3GMRB 4UBDD 2N4IA 1INDH 3RKDD 2NW2A 1L0XA 3P11H 2IBGA 3FQNB 4G8FA 1WEJH 4PG2C 4MNGB 2CO7B 2VDNH 4PJ9D 1K5NB 5F8RC 4OLYH 3AROA 2ARJB 3ZDYE 3CPLA 4OD1H 5C0JB 3VFGH 2CRIA 3H42H 3O3AB 1KLFA 3DHMA 4NQVA 1CE1H 5HI4D 4G80B 1GGTA 3NIFF 5F89B 3MRLB 3MLRL 1J8HA 4U6YA 4KRLB 1OB1B 1RMFH 4ZFOB 4JRWA 1AR1C 3D39B 5AD0A 1KLGB 5CEYB 1OLLA 3OGCA 4XB7A 3FT4B 4YQXH 2G5RA 2DQDL 4AH2A 4J6RL 4P2QB 2WANA 1U8JA 5GRJL 5DURD 3TJHD 5E00B 1OD7A 2HMID 2R8SH 3GSVA 1C5DA 1AI1H 1W0VA 2CKNA 4FHBD 4HMDA 5TF1H 4X6DA 4F80A 1RU9L 1AC6A 4G6AD 2QR0B 5CFHA 1NAMB 4POUB 1ITCA 3GK8L 5EUOE 3IDGB 3OJDA 2Y07L 3V6ZA 3I3BA 5DURB 1TCRB 4H5SA 3L9RB 4OZHF 2ADJB 4P3CH 5TF0A 2COQA 1U42A 1WCQA 1QEWB 1CG9A 3P4OB 3HR6A 1MEXL 3HUJF 4L8DB 1T6WA 2R1YA 1AO7B 4F8TA 3LHPL 2QL1A 1FL3B 4FOMA 5EBLA 1XGUB 3X12A 1YPZB 1OAXL 1F2XK 3KXFD 3AUVA 5CP7B 3V6FA 5ICXA 4PRIA 3PABA 3RWFA 3BVNB 1GC1H 1FPTL 5CP3A 5LXGH 3SDDA 3QEUA 1J0ZA 1TFHA 1YMMD 1YA5A 4FMKA 3TPKA 5B22A 1NBZB 4J3VA 3DROB 1UJ3C 3GGWB 1AR2A 1BQUA 3IFPB 4JO1H 2OX5A 3M17B 4YZFF 1AY1H 2FZ3B 4QRUB 3U0PB 5KW9L 2VSDA 5JHLH 1PZUB 1NKOA 1QNZL 2P45B 1FAIL 1YC8A 1V3JA 3RIFK 1PDKA 1QVOA 2CUMA 1PKQB 3HZKB 5C92A 4KMTH 4HPOH 5E8PB 3EFFA 3RI5F 1C08B 5DJCA 4MA7H 1TVBB 1U8MA 1D5MB 1XF5B 3DSNA 3LQZB 4C54A 4ZS6C 4KKLD 1Q9OB 1XAUA 5DUML 4N5UA 5A3IC 3EDDA 2EZ0C 1I4FA 3O4OB 2IPKB 5C0RH 4X4XB 2ZJSH 4GQ9H 4NKOB 1TTGA 2PTUA 3A67H 3NPSC 3QHZL 3VG9C 3KNBB 3C60A 3TV3L 2VJXA 1VPOH 1SQ2N 1K3ZA 2FDBP 3CLEL 1H15A 1ONQB 5GHWH 5H37G 2MFNA 2IANB 4I4WB 5E9DE 1FGNH 3QEGH 1JNNL 2NXYC 2DKUA 4LSTH 5TGBA 3HNSL 5HVFB 4OM1H 1WLHA 5C1MB 1FDLL 1N7ML 2BNRD 3BWAA 2DAVA 5H35A 1INQB 2M8XA 3DVIA 4JKPL 4C83B 4Y8DC 1YEHH 1MELA 1P4BL 2BY1A 3WIFB 2WK2A 4OCYH 4M7KH 4OF8A 1DQDH 3MRMB 4U6XA 1IGYA 1YEKL 4I0KA 5CZKA 5T3ZH 1KIPA 3VXOA 1CICC 4UTAH 2X1XR 4XP6L 1BJ1H 4R90L 4MLIA 2YS4A 1NANI 1AXTL 3INUH 3C5ZD 4I5BA 4R2GC 2C3XA 4OCXH 4E0RB 5E99L 4U6TA 5F88B 1QR1B 1DJSA 5E5RB 3IFOA 4HCRL 1IC4L 5BJTB 4R26L 5BVPH 1DVFC 4ZTOL 1A02N 5LQBL 1XCTB 3K46A 3C5ZB 5SWQA 4WJ5A 4L9LB 3V0WH 1CGUA 3NTCL 2IADB 4OLXL 4XI5D 4BH8B 3DX9A 1BAFH 4Y1AB 1VERA 2MCPH 2VLKD 2HFGL 5J1TC 2ZSWA 2ORBH 2FX8H 2HT3C 1CDBA 4IHOB 4NFBA 3MBED 1PLGL 4UT7H 5I2IA 2DKMA 2PW2B 3C8HA 1OQXA 5FGBC 1TQBC 4O2FA 4HBCL 4EIZC 2HRPH 1M7DA 1A3LL 4OD2B 4G6FD 5C6PB 5ADOH 2KH2B 1EMTH 4UMGA 5E1AA 1LDPH 5MENE 5I8KH 1S3KH 5FDWB 2Z9TA 3FO2A 4HIXH 3V0VB 1SY6H 4PJBF 1AHWC 3FO0H 4OQTL 2AXFA 1H9VA 3VD3A 3QRFM 3QCVH 5TH2B 3WXWL 2WBJD 2J4WL 2XZQL 4CU7A 4PRBB 3S35H 3OV6A 3JV6A 2UY7A 4JFQA 3QIBB 2IBBA 5JQHC 2AXGB 4ONFH 4FFYH 3SDCC 1EEZB 3QDJB 3KYKL 3TNNA 1HQ4A 4MAUL 3AMLA 4GRLA 3ARUA 3CX2A 3PGDA 2KZWA 4LMQI 5IB5B 3CDFA 4MSWB 3V6OE 1LP9E 2A6KB 2JCCE 1TIUA 2Q76A 2Q3ZA 1I3VA 3OKNB 4WFGD 4OZFG 4KQ4H 3CD4A 1TLKA 4BJLA 5CD5D 4Y0GA 1AJ7H 3TVMA 1XF4A 1JUFA 3MRQA 4UT6L 5ALBH 2QADD 2VXUH 2PF6A 1DDHA 2X41A 4MX7B 2OJEB 2DRUA 3WUZA 3QULA 2VDMH 4UNUA 3W9DB 1G6VK 3SOBH 5F96L 2V7NB 3BESR 4Y4HD 3VXQA 1ZHKB 5I18H 4G9DA 1NC4B 2JF1A 1VGEH 4M8QA 1G7QA 1JYXA 3LEYH 3OXRA 5D6DA 5FECB 1R5IB 2YA1A 2DQIL 1N8ZA 4PP1C 1FCCA 1Y0LA 3LEVL 4JQVC 4N0FA 3CDCA 1NLBH 4AY0A 3LKPB 2VNCA 3I75B 2W9LA 2EKJA 2GJJA 4M7LH 5I8EB 1NGPL 2ADFH 1ERNA 4K7FA 1JNHA 4GRWE 1GCFA 2R0LH 2YD1A 1G7LA 5E8NB 1P7QA 1KCLA 12E8H 2FWOB 1UACL 1FNGA 3MLWL 3REVA 2H26B 3RIAK 5CP3H 1QBMH 2FL5B 5J3HC 2EDJA 4NNYA 1C7TA 3MV7D 2A38A 3QUKB 4U4BA 1QD0A 3UO1L 3WHXB 5IR1B 5GGQH 3B9EA 3T0EB 1G9ML 2OSLB 5DJYB 2YD7A 3PDOB 1NSNL 4AEHL 1CGWA 3VXRA 3VE0A 3ZE2E 2AERT 5HDBE 3BP6A 5H8DA 5E6YA 5HYJA 4Y4FC 4P5TC 2BY3A 4L8CA 4MJIA 3IVKB 3CFIC 2YRPA 4QRPA 1U2HA 5CZXD 2WZPD 1F6AB 4XCCL 3QA3B 5DZLA 2VH5H 3OR6B 4XRCB 4HLJA 2VQUA 4R4FL 4EI6A 4UQ2A 2AVGA 4X7TB 2X7LB 5ID1B 1LNUB 3H9SD 4JM2D 2JKXA 1VFMA 1AC0A 1VKXA 2CSPA 4PLJD 5J6GB 2ZSVA 3V9FA 3F62A 1K2DB 4TULL 3NOIA 4NC2B 4U1HA 5EZJA 1IGJA 4KJPD 4D9RD 3VXUE 1Q0YL 3QAZB 3I6GA 1A6ZA 2P5EE 2ILLA 1HE7A 4BZ1L 5I66A 4W4NA 1I7TB 3UPAA 5BV7C 5I76B 4MCZA 1Q9LB 2ZUSA 4XBEH 3B43A 4JHWL 1OAKL 4EOWL 5M94B 3DGGB 3I9GL 3RVVC 5BVJB 8FABA 2J8HA 1A9BB 1KTDB 4GRMA 3VD9A 4Q2ZA 4G6KH 3ZTJH 2PXYD 4UIKL 4B50A 4LVNB 2DQCH 2J8UB 3VFNB 4P0DA 4GBXD 1ORQB 4JO4H 4LPUA 4P57B 4OFPA 1HSBB 5GGVH 3K80A 1Z6JT 4ZPVB 1X5FA 3C6SB 1ZKAA 2RR3A 2J6EL 2K7QA 2NY3B 5T33H 3X3GH 3ARFD 5EBGA 1BX2B 3WNMA 3HG1B 1J0IA 4KQ3H 5IEKA 4B53A 5MEOA 4LCWA 4I2XB 4OV5B 2YUWA 1BFSA 3B9DA 5D9SA 5KSAB 2H6PA 1HWHB 5KTEL 2ICWB 3NFPB 1TDQA 1CXEA 3DX8A 2XQBL 2AABL 3ARFB 1RUAL 3T08A 3NZ8A 1YNTA 4WFFD 5FO9B 4LL9A 3QUZA 4LSDA 3UTQB 3VWKB 4JY5L 4NRZA 2OP4H 1FYTB 5DT1H 4PJ7E 4CADB 4FQCH 3BO8A 4S0TD 4PJDA 4PTUB 3S35X 1NMAH 4OZFA 3TN0C 2DQEH 1ZGLA 3ARED 5GJTH 4FQIH 1G6RL 4X6DF 2G75B 1F4YH 4YFLF 5TE7L 5KS9F 7CGTA 5EZIH 5SWSE 4ZO7A 1TZHB 1KB5B 4L3CB 3QPQC 4FP8L 1UM5L 4K94H 4ODSH 3OGOE 4OF6A 1CIDA 5C09E 2FLBT 2IH1A 5DFVC 3S88H 2IPUK 2XY1A 1XR8B 2J88H 3AREB 3SGEH 5D7LB 4QRRE 4XNMB 3TCXA 2LVCA 1TZIB 3ILPB 4RISH 4U3XA 3C08H 4HUKB 5B8CA 2B2XL 3O6KH 5J1AB 3QIUC 2WQRA 5IQ7L 5HBBA 2CKBL 1A1MA 2E27L 1YZZA 1E27A 1L7IH 2O93L 2APVA 1A4KA 2E9JA 4WUKH 5GXBB 5HHVL 1I9RL 3PQYA 2VMFA 3T0WA 3MJ9H 1QBLH 3MO1B 2AEPH 3FTGB 4ZXBD 4KJYB 5J9PB 1CT8B 1EJ6A 3JTTA 1QP1A 4ODVL 1MQKL 4J4PA 9CGTA 1S7RB 4KDTA 3SE4A 2Q7YB 4O00A 4UQ3A 1NGYA 5EBMA 5B39B 2DM2A 4U1SB 4Z77A 1FLRL 1LO4H 1A47A 1N6VA 3C6LD 4HDIB 5FGCB 4PRAB 1XCQB 5IBUG 2Z31D 4GXVH 4NWUL 3KPQB 1T22A 4NQCD 3SGKA 1P84J 3IDIA 5INCA 3K81A 1SMAA 2YUZA 3ZKMC 1I1CA 3G6DH 4OFDA 1WAAE 4LCYB 5I73C 3LN4A 4NKMA 4HFUL 4OCSL 1D6VH 1FJ1A 3DVNA 1MFDH 3O3DA 1KF9B 5GS0L 1CS6A 1UJ3B 5E8OA 4NQCB 2FECI 4QHMA 1MWAL 4UBDC 1UYWH 5DD1L 3RKDC 3O3BA 4XPBL 4ALAL 5B4MC 3BHBB 4N0RA 4XAKD 5C0CB 3E6FB 1LO2L 4P3DA 3OAUL 5C6WH 1D5ZB 2R0WH 4LNRA 1WBXB 4P2YA 3BAEL 5EU3B 5IMMB 2APBA 4P5KA 2FEEI 4GS7C 1R6VA 1J0KA 2FR4B 1FFRA 4IRSB 5H37H 4I3SL 5HI3C 2BCKA 3VFWA 1I8MA 4I9WE 2W65B 4Z9KB 4WDIA 4XWGH 3ZKQD 1WWWX 4H88L 3H3PL 4HIHA 4Y4FA 4E5XA 3AAZB 3QDGA 4ZUTA 4XGZA 4HWUA 3UBXB 3FZUC 1RUMH 1TVDA 4P2RE 1DQJA 4RCAA 1IC7H 5IHUL 4V2CB 3TJHC 2IG2L 4GKZB 4HUXB 3ZKXB 3DO7A 4XXCA 1ZSDA 3QI9D 1JPFB 1A22B 2YEZA 2X10A 2BY2A 4D8PA 4U1LA 2SEBB 2NXYB 4G6AC 5AYQA 3QT2A 4PRPB 1EFXB 4YE4L 4Y5YB 1A6AA 3O2VL 3LPGA 2D7QA 5A2FA 4JFDB 3QJFA 3OHXB 1JWMB 1RK1A 4HUVB 2AK1L 2OS7A 3X14A 3FOMA 3O9WD 2R23B 4GG6E 3CFEA 4IDJH 5L2KB 1KSRA 4ZFFB 4QRSB 3KYNB 5LGJA 4PJCE 1JV5B 5BZDB 3V79C 1I85C 2XN9A 5ICYB 3WO3B 1MFCH 1TMCB 3LEXA 3BH9B 3RNKA 1N0LA 1Q0XH 1RZFH 2DYPA 2XYCA 3BE1L 4I77L 3MRNA 4GJTB 4L4VB 5FA3A 5IMLB 3QO0B 4F37K 1H5BC 3FT3B 5IW1A 4DVBB 2HFEB 3VW3H 4KK9D 2HJLA 1Q9WA 2O5YH 1P53A 2YPVH 2IEPA 3SE8L 3IFNL 3V6BR 4UAOC 4LP5A 3VA2C 1NL0H 4PJ5D 1TTUA 4JQXC 5FAAA 4XNXH 2ICES 2HT2D 1WFTA 4ORGB 1MRFL 3LVEA 5DMJB 4OLUH 5E5MA 3ALPA 2P48B 1PYWB 4N9GB 1SYSB 1BOGB 4P9HC 5D71H 4M93C 4NYLB 3S4SG 1B4JL 4PJ5B 3LN5B 4HJJH 1KENL 4RDQG 4K8RD 1PJ9A 1J1OH 1TQBB 3E2HB 4PB9H 1ZA6A 1CLOL 2FX9L 3MGOB 3WFDH 1MNUL 2NX5B 5MEQB 5D1ZA 3HZYB 4XPFH 1UA6L 2EC9U 2I5YL 1ZLUK 4ZNCD 1KBGL 2HKHL 1SJEB 1U3YA 1B6DA 4M3KB 2CRZA 4OZFH 3SGEI 3QWQB 4MDIA 2ZOKA 5FF6B 3GSOA 1T5XA 3TH4T 5FK9B 3MRDB 3H9HA 4F33A 3BIBX 3VFVA 3P73A 2EIZA 1A1NA 2EC8A 2VZUA 1GIGH 5I1EH 1MJJB 4ZFGL 3DYOA 4PJEB 3U4EA 4BM7A 4N90D 5CINH 2NLJB 1QFWI 4CVZA 5CSBA 4NDMA 3PG2A 1A7PL 3JWDC 3F7QA 3PJSA 1KTLA 4TUOB 2VLRD 1A6VH 2R2EA 5E56A 1ED3B 4L4TD 2IQAB 2DQHH 4RQQB 4JZNA 4J8RB 3UAJD 4O9HL 1HEZB 4R9HA 4Y19B 4G3YL 1JFQL 1JYWA 5IP4A 4PJ8D 1KCUL 4TVPH 2GUOB 4OT1L 3VMOA 1KPRB 4NO2B 4NN5B 5LBSL 3EJZC 5F9DC 3L5WA 2QQKL 4AM0A 3QUXA 2FYYA 1MH5B 3QXAB 5ILTL 3GSNH 1M4KA 3TF7C 1I1AC 4XXDA 4ZODA 4HXBH 1LEKA 4PJ8B 3IDMB 3L7EA 4YHMH 4QHLB 4Y4KD 5DD5L 1MHHB 4PYGA 3GMRA 1MOEA 1KV3A 3FQNA 2DQFA 5IB2B 4MJ6B 1KUMA 4MNGA 5FHAH 5IVZB 3LKNA 1JF1A 1MJ7L 3S36H 4XBGA 3SDXB 2ARJA 2NY0B 3QUYD 3MGTB 1BREA 1U6AH 5C0JA 4U1IB 4RWHA 5IROC 5JQ6H 4J3TA 4RNRA 2D7MA 4RWYH 3DETC 2BVQB 3O3AA 4O51B 4Y4KB 1NGWB 1XF3B 1T2XA 3HLAB 1CI5A 4YR6A 3W2DH 3LRHA 2N7BA 1V8HA 4PJ9A 4J7RA 4Z6AT 3HZVB 1T0NB 3MRLA 1T66D 3JWNC 1KYOJ 2R29H 3QUYB 3EJJX 4GO6B 5C08E 4E9LA 1OB1A 4HIEA 3D3VE 1FORH 5HPMB 4QRQB 1LEIB 5CEYA 4RAVA 2R1XB 2DD8L 1U3ZA 3T3PE 4P2QA 1U3HD 3D0LB 4OLVL 3G08B 1I7ZA 2BY0A 1IE5A 1T04B 3QQ4B 3WSQH 2E7MA 2M2DA 5E00A 5C9JB 2BC4B 4LSQH 3ZDZF 1PSKL 4JPVH 4FN0A 4NKIL 3L1OL