4P47A

Crystal structure of a trap periplasmic solute binding protein from ochrobactrum anthropi (oant_4429), target efi-510151, c-termius bound in ligand binding pocket
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
320
structure length
320
Chain Sequence
EIRSQTIKFAAANSKGHPQVTGMEKFAELVKEKSGGQINVKLFPGGVLGSDPQTLSGLQGGVVEMTVMNAGILSSTVKAFEAVDLPFLFNSGEEADKVMDGPFGTNLMKRLPDTGLIGLAYWELGFRNLTNNRHPVAKLEDIAGLKIRTLQSPVPVALFNALGANAVPLPYTELYTALETGTVDGQENPNANIINAKFYEVQKYLTLTRHQYNPQIVMISKKFWDRLNDEEKAVIEQAAVEARDYQRKVSREQDATALDEIKKTGMQVTELTPEETTRLRDAVKPIIDKFTAEIGAETVDELFAELKKVRGENAENLYFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRAP dicarboxylate transporter, DctP subunit
publication title Experimental strategies for functional annotation and metabolism discovery: targeted screening of solute binding proteins and unbiased panning of metabolomes.
pubmed doi rcsb
source organism Ochrobactrum anthropi
molecule tags Solute-binding protein
total genus 122
structure length 320
sequence length 320
ec nomenclature
pdb deposition date 2014-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03480 DctP Bacterial extracellular solute-binding protein, family 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 4p47A00
4X8RA 4OA4A 4N17A 4PGPA 4P1LA 4MNIA 4OVSA 3B50A 4PETA 2WX9A 4N8YA 4OVPA 2HZKA 4UABA 2XWKA 2CEXA 2VPOA 4PFBA 4PAKA 4O8MA 2ZZXA 4MAGA 4N8GA 4PDDA 4P1EA 4P56A 3U65A 4MEVA 5IZZA 4NF0A 4N4UA 4N6KA 4MMPA 3GYYA 4NGUA 4PGNA 4LN5A 4N91A 4P9KA 4N15A 4NHBA 4OVRA 2V4CA 2CEYA 5IGAA 2XWOA 4N6DA 4MNCA 4NG7A 2XWVA 4YZZA 4P47A 4PC9A 2ZZWA 4OVQA 2WYKA 4DI4B 4OVTA 4PFRA 4PE3A 2XWIA 4PAFA 5IM2A 5CM6A 4MCOA 2XXKA 4MNPA 4X04A 5I5PA 4OANA 2PFYA 4MX6A 5LTCA 4P3LA 4PF8A 4MHFA 2XA5A 4P8BA 2HPGA 3FXBA 2WYPA 2PFZA 4XFEA 4XF5A 4PFIA 4NQ8A 4PAIA 4YICA 4DI3D 4NAPA 2HZLA 4PF6A 4O94A 5I7IA 4XEQA 4PDHA 4NN3A 4O7MA 4MIJA 4PCDA 4PBQA 4NX1A 2VPNA 4PBHA 2ZZVA
chains in the Genus database with same CATH superfamily
1A8EA 2PVUA 2AIXA 2P2AA 2QPQA 4XIGQ 2RCAA 3NOHA 1NUXA 5DVIA 3E13X 2IEEA 3MPLA 3QK6A 5L9MA 3KFMA 1LFHA 4JVIA 3C9HA 1QUJA 3CRBA 3FJMA 4G68C 2VPOA 3MWBA 1YPNA 4H46A 4PFBA 1QUKA 1WVJA 1UIUA 1QKBA 1JW5A 2ZNTA 3SETA 3RNNA 2CZIA 4MMPA 3GXAA 5AA3A 2QRYA 4Q0CA 3V83A 2V4CA 1MM7A 4X48A 4JB7A 4MNCA 1URGA 3IK6B 3MZ9A 1SYIA 4OENA 5EQ9A 5EQAA 5EYGA 1XS5A 4OFLA 3T66A 3C33A 2Q88A 3FZVA 2UYEA 2XWIA 3R26A 5IM2A 1NV0A 3W9WA 2FIEA 1Y1ZA 4O3BA 5JTYB 4NWCA 5J1DA 3VXBA 1LBBA 2Z8EA 4GD5A 1NV4A 1N0TA 1Y4TA 2O6AA 3S2VA 4C0RA 2I4CA 3KN3A 4ELQA 3OMBA 4I1DA 3LBSA 4IGRA 4DIGA 3IORA 4RYAA 3D4CA 4PFUA 2BJJX 5I2KB 4QHQA 3KSJA 3CG1A 1OQHA 2NXOA 1NFTA 2AL5A 3M3FA 1S50A 4ZE8A 4BDQA 4NTLA 3DLNA 1LBVA 4WKMA 1FTKA 1B40A 3T9VA 4H67A 4HS7A 1LGBC 3MVZA 5FHNA 1NV7A 2O68A 4GLIA 5IZ3B 3C36A 4RPNA 4P1EA 4NF8A 1MY2A 3TCGA 3C32A 4LP2B 4YKPA 4ZZAA 2ESNA 4PQJA 2I48A 1B51A 2WKYA 1FBHA 3R7XA 3USDA 1H44A 2A5TA 4GWSA 1QGXA 2OWSA 3G3HA 1OLAA 4N15A 3LSFB 2CEYA 2XXQA 4NF5B 1DOTA 4YB6A 5LDZA 4EF1A 3KOTA 4H5FA 4BLAA 5DVFA 4YZZA 4GBVA 5FTIA 3G3KA 4OQOA 3EHTA 4OEUA 1FPEA 3TTRA 4F1UA 2H25A 3MPKA 4MCOA 2RC8A 1JEVA 3PPOA 1PDAA 2F78A 2PFYA 4RJZA 1JNFA 1B46A 4PF8A 4NWDA 1RDZA 4HCYA 4QXDA 1FQDA 4EXLA 4ZEKA 3S9NC 3VVEA 2CMOA 3QIMA 2XXYA 1QULA 2P1SA 3PGFA 1WODA 1UQWA 1FSAA 3ROJA 4P11A 4O3CA 3LC8A 2Z8DA 1JW1A 1R9LA 3V5AA 2VPNA 4DE8A 2ZNSA 3PUVE 2VT5A 2UVIA 3UORA 3OSQA 1SW2A 3OXNA 3EN3A 5AA1A 1IXGA 1GV8A 5IAIA 1ZMGA 1OLCA 1QW0A 2DSFA 2Y7PA 5F7VA 4GWUA 2OK2A 1I6BA 3FVOA 3SKPA 3EQ1A 3U65A 3TODA 3EHUA 3C4MA 5H8SA 3PV0E 4LQ2A 4F19A 1A40A 4OVJA 5F1QA 1B32A 4F31B 4QFLA 2LAOA 2OJTA 1EZPA 3O6GA 2GHAA 3MVXA 4N81A 3OO6A 4ND9A 4KFQA 3TTNA 4KYDA 5ELVA 4OVTA 4XKNA 3EKIA 2DP8A 3O6HA 4F3SA 4H6DA 3KOSA 4YMAA 3IOTA 5L8DA 1IQ7A 3SDFA 3VFJA 5TPAB 2ABHA 1MRPA 5L9OA 2QS1A 1Y3PA 3H6UA 2B3BA 1G0HA 4QFPA 1N04A 4NF8B 1B4HA 5ET6A 4KXPA 3WAEA 3RPWA 2A5TB 4TLLB 4YKJA 2DE4A 3H6TA 2RKMA 2A5SA 3N5LA 4R6YA 1EYKA 1LAFE 3U94A 4ESXA 1DMBA 5I57A 4UACA 2ZYOA 5CC2A 3H6WA 4OA4A 3U8QA 1B0LA 2V3QA 4EQBA 3PPPA 1AIVA 3KC0A 1LAHE 1B4ZA 4O3AA 5BWJA 2Q8MA 3ODBA 4PAKA 4LA9A 4MAGA 3ZS6A 3B6TA 3FJGA 1ZJLA 4GX3A 4MEVA 3T9HB 1SDXA 4GX4A 2R71A 4GOTA 3S9LC 2AL4A 4NHBA 3RLFE 1UIVA 4LONB 1FTAA 1NV3A 4R9FA 1POTA 4KYEA 1QVSA 1OQGA 1JP4A 1SQYA 4XXUA 1KA0A 4E0WA 1D3KA 1XVXA 2QS2A 1FPFA 3QAXA 5FBPA 4OVQA 3TZAA 3OENA 2KQZA 4RY1A 4OWDA 1A99A 2HAUA 5J16A 3N6UA 3IX1A 1R6ZA 3PU5A 4OANA 3DELB 4OTEA 2F35A 4U22A 3T22A 3M3LA 4BDNA 5FHOA 3THIA 2HHMA 2QMWA 3MSTA 4BDLA 1PC3A 4OHNA 4OETA 2ALUA 1IMCA 1N76A 4GWWA 1MY3A 1FPGA 4O94A 1MPDA 3GBBA 3IL1B 2XX9A 4JXIA 5EQ7A 4LATA 4ZDMA 3IOUA 1FQEA 4H0WA 4ONYA 1MXUA 2XXVA 1MXWA 3O2AA 4QFNA 1UTHA 1SW5A 2WBDA 4N8YA 2HZKA 2XWKA 3T93B 3M8UA 5TU0A 5JEIA 1NNPA 3I3VA 1R9QA 1VFEA 3CI8A 2DWHA 2WEFA 1LB8A 4GVOA 4P56A 1NL5A 5CBRA 3VLVA 3VVDA 1UTBA 5H8QB 3CFLA 1MQHA 1QJMA 4IO4A 4P9KA 3T0JA 4LQ5A 2F34A 3BIGA 3IOWA 2OZZA 4YKIA 4R72A 1MDQA 2B4LA 2VGQA 2QVUA 4AQ4A 4RK2A 3UIFA 4FBPA 3HHGA 5IKBA 1XHYA 1LLSA 3TCFA 3VE1B 1Q1KA 3LUZA 1FTOA 4F3GA 2R8TA 5I57B 5ET7A 2FA7A 4M1VA 3R6UA 5K2XA 1USYE 3O9PA 3D4GA 1MQJA 5EHSA 1B5JA 1FBCA 3MBPA 1IXCA 4QBAA 2H99A 4GWYA 2CZLA 3PPQA 1ZBMA 2O1MA 3IFAA 5LTCA 5DEXB 4MH5A 3TDJA 5L9SA 1S9TA 3CVGA 4YICA 4F1YA 2M8CA 3K2DA 4C1UA 1A7LA 4KCCA 3W9VA 1LFGA 3CFXA 2I58A 1SVXB 2VP1A 4PBHA 3ECRA 2XXRA 3CR9A 4PGPA 4X9TA 2FHYA 2V3TA 1FPDA 1JEUA 4HE2A 4IO6A 5CBSA 2CEXA 3UP9A 3H7MA 4U4SA 4K3FA 1LBZA 1O63A 3E9XA 1ZIUA 1B58A 3CSGA 4X1DA 2VD3A 2XXHA 3B6QA 1VDWA 2DDKA 4NF0A 1MH3A 1GGGA 1URSA 1N7WA 2F8DA 4PGNA 1YAEA 4NMYA 1LSTA 2D21A 3PUYE 1LBXA 3ONMA 3CG3A 3MJNA 1N7XA 3A3UA 1MPBA 4L17A 3BIHA 2QSXA 3K6WA 4DI4B 4YKKA 4PE5B 1ANFA 4PAFA 1ZTYA 2Q2CA 5B7DA 2UYFA 1NMUA 4WEDA 4HTGA 4XKPA 1UTHB 3LUYA 3OD7A 1RYXA 1VR5A 1B9JA 4TOZA 3ILTB 2X7QA 4G68B 2PCRA 2KR0A 2H5YA 1H43A 2OWZA 2H9BA 2RC7A 4XFEA 3DP4A 3G7WA 3IJOB 3FD3A 2PT2A 3E78A 3BKIB 1UTBB 5H8FB 2H98A 4NN3A 2ZYKA 2DXRA 1FQAA 2O7IA 3A3CA 1B3GA 2OX3A 5HPQA 4FORA 3SZPA 3U72A 3B50A 2I6EA 4PETA 2RC9A 1JETA 2O51A 1MS7A 2ONSA 3FV2A 5M2VA 5ITOA 1B7HA 2WBBA 4U4XA 5HM4B 1SYHA 2Y7KA 3TTMA 2XD3A 3FV1A 5A5LA 1NUWA 4NF4A 3IJXB 3GZGA 4LN5A 1MM6A 5AE4A 2Y7WA 2HXRA 4QF9A 4GBWA 2XD2A 4NEDA 3VXCA 1SI0A 1IMDA 1YZ0A 4ISUA 2VHAA 3FXQA 1FBPA 1TFAA 3MQ9A 5CI5A 5A5XB 1D4NA 2DWJA 1N3WA 4PE3A 1FTMA 1JVXA 4JWOA 1O7TA 3IAZA 4KPTA 1B1HA 1OMPA 3TTKA 3LV0A 4IO2A 4F1VA 1MH4A 4RXLA 4AS5A 3HSTA 2V25A 3RT8A 1PEBA 2XXUA 3N94A 1ZU0A 4JSOA 2YLNA 1B2HA 3S9MC 4QSCA 3H6VA 4XEQA 5AA4A 2Y5KA 2F6GA 4NX1A 1BIYA 2P3VA 1FJ6A 4KHZE 2ZNUA 1LEVA 3PPNA 1NV5A 3DM0A 1JW4A 4UABA 3LSXA 3Q26A 3QUJA 2ZZXA 1LBYA 2MKZA 3TQWA 3C31A 3MC2A 3HN0A 2Y7RA 4ZEDA 4IO7A 4N6KA 2Y7IA 3LSWA 4U23A 4EXKA 4N91A 4OFJA 1EZOA 3KG2A 1IXHA 4G61A 5I59A 3PMWA 4BDRA 1IUDA 4FEBA 3EHSA 1XOCA 3O6IA 4ZE9A 4WEPA 4EUOA 1EZ9A 4RPOA 2ZZWA 2GHBA 1IMAA 1ZKBA 1I6QA 3Q25A 4OXVA 2XXWA 5I3SA 1INPA 3KJTA 5ESYA 4PFWA 4U21A 5HBCA 2XA5A 5ET8A 3P7IA 1PB8A 1FQBA 2DWIA 2WYPA 2FYIA 1Y20A 3SEUA 4PFIA 1D9VA 3A09A 3TUSA 2R9JA 3DP6A 4R9GA 4G2ZA 4NF4B 3CIJA 3SESA 4U1OA 2X26A 4F3BA 1HSLA 3G3GA 1MY4A 4ECFA 5ITPA 3G3FA 3IB0A 1A55A 2P3NA 4IGTA 4N17A 1TFDA 3FATA 3PD8A 3K1PA 3TFLA 2XXXA 4OVSA 3OO9A 1DK4A 4THIA 4ZEBA 4GF8A 3L6HA 4XKQA 3FUZA 2PYYA 3O28A 4N8GA 1LAGE 3L6GA 4POWA 1LB9A 4HXVA 5DT6A 2VOZA 3HO7A 3RYDA 4FATA 3TCHA 1OIBA 4YB5A 4PTKA 2W7YA 4MJOA 1B7ZA 2O69A 4JSDA 4Q8RA 1O64A 2F7AA 4N6DA 3JZJA 4QRZA 1CB6A 4JBZA 3BFTA 1JQFA 4ZECA 3LSLA 4IY6A 3QYTA 4R2BA 4U2RA 4N6PA 1LCTA 5I2NA 2E1SA 4TQUQ 4OFOA 2O84X 1GR2A 4BDMA 4YB7A 4LVQA 5F24A 3OSRA 1SBPA 2UVJA 1DBZA 4WXJA 1MQGA 2Q2AA 4FECA 4H8IA 3FXBA 3A29A 3T9XB 3TTLA 1NUZA 2DOJA 1QKAA 4F18A 4NQ8A 1XI6A 2XXTA 3T9UA 4FEDA 5CRYA 1IMBA 4G8NA 1MQIA 1P1NA 1Y9UA 5I59B 1SI1A 4IO3A 2L5VA 2UVHA 2FVZA 5KZTA 3SEVA 3KJ7A 3TAJA 2I3WA 1B3FA 1ATGA 4Q5TA 4KCDA 4GQOA 1N3XA 3LR1A 5K2YA 5I56A 1OVBA 4BDOA 4GWOA 3EPEA 3KGCA 2JJKA 4R2FA 1WDNA 3HHFA 4OEVA 4I3YA 2PBWA 3KZGA 3SEWA 2PT1A 1POY1 1P1OA 3FVNA 2I49A 4LZ8A 5CMCA 3KN7A 3Q27A 4EQ9A 1P1WA 4DDDA 1FRPA 4MF3A 1HSEA 4Q30B 4EQ7A 3K1MA 2D3IA 2F3DA 5I58A 2IA4A 1H3DA 4GL0A 4P47A 1NV1A 1SD3A 3MVWA 2BJIA 1USYH 3VLWA 1B3EA 3U1OA 2Q74A 3MP1A 4JVCA 2PMSA 2E0SA 2F7CA 1FJ9A 1Y4CA 2DYXA 1IEJA 2QVVA 3VVFA 5JK4A 4QFKA 1KWHA 2ONKE 2HPGA 5H8NA 2DWAA 1NNFA 3K01A 4AS4A 2NWJA 4TLMB 1NH8A 4QSEA 1BTJA 4NAPA 2F7BA 3RGYA 4GXSB 4PCDA 3OOAA 5CMBA 2I4BA 2F5XA 1VE4A 3GBAA 1B5IA 3MZBA 2QFLA 1J1NA 4ESWA 3K6XA 3H3GA 4DXUA 3PUZE 4RK9A 3M3KA 3PD9A 3H03A 1YXIA 3E4RA 4C1TA 2OLBA 5DW8A 1XVYA 2Q8JA 4PDDA 2R6GE 3HCQA 1ELJA 4X1BA 1T0KA 4N07A 3TQLA 1YCJA 1RDXA 4QFOA 4I3EA 4NGUA 5IZ3A 3IO4A 3RPLA 2ONRA 1NV6A 5ISUA 1ZLQA 5IGAA 4ELOA 3PPRA 1URDA 1YTVA 3MZ1A 3T1BA 3PMXA 3HFUA 2O1LA 2THIA 3QXMA 5FTHA 5KDTA 4PC9A 1R1NA 4F22A 4G8HA 4F29A 4FJPA 1B52A 2B4MA 1BLFA 3RQTA 3N26A 3W15C 1EU8A 4H5GA 2AYSA 4IO5A 5I56B 4MHFA 1MXZA 1GVCA 1Y3NA 3CHGA 2FBPA 4XF5A 3B8BA 3I6VA 2HCAA 1IXIA 3JYRA 4H8JA 4H65A 4NE4A 1FBFA 3BFUA 3PTYA 1FTLA 1FQCA 2HAVA 4KI0E 5CMMA 2XHDA 5I58B 3TMGA 1LCFA 4OMBA 5I84A 4AB5A 1XC1A 3FASA 3O29A 2RINA 4GRKA 3SERA 1KA1A 3UK4A 1I69A 4O8MA 1TWYA 2XXPA 1Q35A 3BBRA 1QUIA 3DP8A 3C35A 4POXA 1IITA 5EQ8A 3MAMA 3UN6A 1RKMA 2ANJA 4R6HA 4DZ1A 2DVCA 4GIZA 2QS4A 5H8NB 1FPIA 1MG1A 2Z23A 3RT6B 3KBZA 1EYJA 4XKRA 1B6HA 2NOOA 1CE2A 2GRVA 4H1XA 4PP0A 2DS9A 3IR1A 2YJPA 2WYKA 4IY5A 1D9YA 4JVDA 4OYVA 4N13A 3HV1A 1IZ1A 1M5BA 1LBCA 1B7UA 3RY3A 3WAFA 3QMFA 3CSBA 1Z7NE 1M5FA 1JVYA 2V3UA 4JWXA 1IIWA 1US4A 2HEUA 1MY0A 2Q89A 2RF1A 1F9BA 3FBPA 5TPAA 3IOVA 1MY1A 4DI3D 1FBDA 4GWXA 2REJA 5I7IA 4GX6A 4O7MA 3RPLB 1H45A 5T3JA 3HPIA 4GWZA 4YU0A 4F2OA 4IB2A 4YAHX 1MXVA 4GXAA 3T96B 3GLBA 1M5CA 5KDTB 2QVRA 1DPEA 5FHMA 4HW8A 4LUBA 4DCYA 4DXBA 4ELPA 3S4UA 3G3JA 4N4UA 4P0IA 2HFBA 1OVTA 1B3LA 2RCBA 3K6VA 2V84A 2OCUA 4OVRA 4I9DA 4MLQA 1LAXA 2G29A 4HCWA 2X7PA 1NUYA 4OESA 4KYSA 1MPCA 4KQPA 1FBGA 5EYFA 4ZS9A 3S9EA 4LZ5A 3Q29A 5H8HA 3VLUA 4MNPA 1P1QA 1VFDA 4DLDA 2FNCA 3MVYA 1RDYA 3JV9A 4P0GA 2OWTA 4R73A 4P3LA 2V93A 3OO7A 3K1NA 2XX8A 3U92A 5LOMA 1D9QA 3B7DA 5AA2A 4R75A 3KEIA 4PAIA 1DTGA 4IR8A 3ZSFA 1FPLA 2F3BA 1NNKA 4NF6A 3EF7A 2F97A 1DTZA 1FQFA 2Y84A 1FTJA 4PFYA 4PBQA 2ZZVA 2REGA 3B6WA 1M5EA 1GTKA 3ZKLA 3N6TA 5AA2D 1DSNA 3SEYA 1H76A 1EYIA 3E79A 4EDPA 1FCKA 4LZ7A 1US5A 3TELA 3TKDA 1Y1MA 3CFZA 1B3HA 1PBPA 3RTWB 3E3KA 3MP6A 3V8XB 2P0SA 1MXXA 2KLFA 3GYYA 4HE1A 1MDP1 1SW4A 4M4GA 2I3VA 2XX7A 3KSXA 1NKXA 2XWOA 3VDFA 2UVGA 5B70A 1BKAA 5H8QA 4NG7A 1NH7A 3O66A 4GFRA 2I0CA 2PX1A 4PFRA 3U93A 2HXWA 1PB7A 2HQ0A 2GH9A 4G8MA 5CM6A 3FXUA 2XXKA 4ZZEA 2O7UA 4X04A 1CNQA 2ZYNA 4ZEIA 4I62A 4KR5A 2F6PA 3IB1A 5DYHA 1K9ZA 4P8BA 1II5A 4FIMA 2FIXA 3K4UA 2VD2A 5AA4B 3MW0A 5DVJA 1A54A 1TT1A 3FVGA 1B05A 2D5WA 5DEXA 3K02A 2HZLA 3H06B 5TP9A 1FPJA 2GQ1A 3O97A 4QSDA 1B0HA 1DPPA 2NVUB 1LFIA 1Y3QA 1BP5A 3FGSA 4U1ZA 4X8RA 1YYZA 1I6AA 1IMFA 1FPBA 2ZXTA 2DE3A 4OVPA 3PMVA 5H8HB 3K6UA 3MP8A 4G4PA 1Z7ME 3IB2A 2CZKA 4ZEFA 1SPIA 1L5TA 4FE8A 4DXCA 2QMXA 5IZZA 5EYHA 2H4IA 1LBWA 4MFIA 4RNSA 2Q9TA 2QS3A 3D1RA 4FAJA 5KCJA 2CZHA 5BUUA 1KZ8A 2GFEA 5AA2B 3G3IA 3FVKA 5EHMA 1XT8A 3UGWA 1BK4A 2F36A 3QUFA 4OERA 2Y5LA 2XWVA 4YMBA 4NF6B 1N84A 1FBEA 4XTCQ 2ZYMA 2DE2A 4MBPA 1IMEA 3ISPA 2DVZA 4PFTA 5I5PA 4RA1A 1AL3A 2UXAA 5ICTA 4MX6A 5ET5A 1G0IA 2YPNA 5IZ1A 2Z8FA 2PFZA 3KC1A 3KN8A 3IFCA 1MXYA 4Z7EA 4EF2A 1SW1A 3TEPA 2QL3A 4G68A 1VSOA 3TPAA 1DCUA 4F2QA 4O7IA 1AH5A 1RYOA 3K0VA 4G77A 3IO6A 2B65A 3Q28A 1AOVA 1B1XA 4P1LA 3I5OA 1MQDA 5H8FA 4MNIA 4Z0IA 5JTYA 4JWYA 5DTBA 3FJ7A 2WX9A 1P99A 3K00A 4KD5A 4OZ9A 1FPKA 3VV5A 3FIRA 1M5DA 4E0XA 2DXYA 4UA8A 1EH3A 3QSLA 4R6KA 3RN8A 2DQVA 3V89B 4AB6A 2ZMBA 5I2KA 3MUQA 3RUMA 2G93A 2NUVA 1NNTA 3AXFA 4F39A 4MLVA 1NI9A 4R74A 5CMKA 2B3FA 3F11A 1FW0A 1PB9A 5I2NB 1Q9DA 5TP9B 3OO8A 1TXFA 4H45A 3OEKA 5ICQA 3MYUA 3PUXE 4HE0A 5A5XA 1B5HA 3TYHA 4I40A 1AWBA 1P1UA 1A8FA 1HSJA 3H4ZA 3OEMA 1AMFA 4I8CA 4ELRA 2XXIA 1NV2A 4NF5A 3SEXA 3UA8A 2QJEA 3PUWE 4JDFA 4F3PA 4GL8A 3RTFB 1S7YA 3C34A 3OELA 4PF6A 2OBGA 1K9YA 1PBQA 3ZKKA 4PDHA 4MIJA 2Z22A 5KCJB 3ILUB 2I0BA 3KBRA 3FXRA 4DCXA
chains in the Genus database with same CATH topology
2P3NA 4N17A 2QPQA 3NOHA 1NUXA 4OVSA 4JVIA 2WBDA 2QVRA 4N8YA 1DK4A 2HZKA 2XWKA 2VPOA 4PFBA 4H46A 4N8GA 2WEFA 4P56A 2CZIA 4N4UA 4HXVA 4MMPA 3RYDA 4P9KA 4PTKA 3T0JA 4MJOA 3BIGA 4OVRA 2V4CA 4HCWA 4N6DA 2B4LA 2QVUA 1NUYA 4MNCA 4FBPA 5EQ9A 5EQAA 1FBGA 5EYGA 3LUZA 2R8TA 2XWIA 5ET7A 4M1VA 5IM2A 1NV0A 3W9WA 2FIEA 4MNPA 1FBCA 4QBAA 5F24A 4GWYA 1RDYA 5J1DA 3IFAA 5LTCA 4P3LA 1NV4A 1DBZA 3FXBA 3A29A 1D9QA 1NUZA 4F18A 4NQ8A 4PAIA 4YICA 1XI6A 4IR8A 1FPLA 1IMBA 2F3BA 3W9VA 4PBQA 4PBHA 2L5VA 2FVZA 2ZZVA 4PGPA 1LBVA 4X9TA 2FHYA 1FPDA 1EYIA 4HE2A 3E79A 1NV7A 2CEXA 2JJKA 5IZ3B 1LBZA 4P1EA 4I3YA 1VDWA 2DDKA 4NF0A 1FBHA 3GYYA 4HE1A 4GWSA 1QGXA 4PGNA 1FRPA 4N15A 2CEYA 2XWOA 5LDZA 1LBXA 2F3DA 4NG7A 4YZZA 4P47A 1NV1A 3BIHA 4GBVA 2BJIA 4DI4B 4PFRA 2Q74A 1FPEA 4JVCA 4F1UA 4PAFA 5CM6A 4MCOA 2XXKA 4X04A 1CNQA 1FJ9A 2PFYA 2QVVA 5JK4A 1K9ZA 4PF8A 1RDZA 4P8BA 4HCYA 2HPGA 2KR0A 2PCRA 4QXDA 2FIXA 2OWZA 4XFEA 4AS4A 3E78A 4NAPA 2HZLA 1FSAA 3ROJA 1FPJA 2GQ1A 4NN3A 4PCDA 2F5XA 2VPNA 2OX3A 4X8RA 2VT5A 2QFLA 1YYZA 3SZPA 1IMFA 3B50A 1FPBA 4PETA 1YXIA 2DE3A 4OVPA 5DW8A 2WBBA 4PDDA 4GWUA 2CZKA 1SPIA 3U65A 5IZZA 5EYHA 1RDXA 5A5LA 1LBWA 1NUWA 2Q9TA 4I3EA 4NGUA 4LN5A 3D1RA 4F19A 5IZ3A 3RPLA 1NV6A 2CZHA 2HXRA 5IGAA 1KZ8A 4GBWA 3T1BA 1BK4A 1IMDA 2Y5LA 1YZ0A 3HFUA 2XWVA 4N81A 1FBEA 4PC9A 1FBPA 2DE2A 4OVTA 1IMEA 4PE3A 3ISPA 3EKIA 2DVZA 2B4MA 5I5PA 3LV0A 4F1VA 4MX6A 5ET5A 1G0IA 4AS5A 4MHFA 5IZ1A 1G0HA 2PFZA 3KC1A 3CHGA 2FBPA 4XF5A 3IFCA 3B8BA 5ET6A 4KXPA 1FBFA 1DCUA 2DE4A 4XEQA 2Y5KA 4O7IA 3PTYA 4NX1A 1EYKA 2P3VA 4OA4A 2V3QA 4P1LA 3KC0A 4MNIA 1FJ6A 1LEVA 2WX9A 1NV5A 4UABA 2Q8MA 1KA1A 1FPKA 4PAKA 4O8MA 2ZZXA 4MAGA 1LBYA 2MKZA 4GX3A 5EQ8A 4MEVA 4GX4A 4N6KA 4N91A 1FPIA 4G61A 4NHBA 1FTAA 1NV3A 3KBZA 1EYJA 1NI9A 1JP4A 1KA0A 1Q9DA 1FPFA 5FBPA 2ZZWA 4OVQA 2WYKA 4H45A 4JVDA 2KQZA 1IMAA 3MYUA 5J16A 4HE0A 5I3SA 1INPA 5ESYA 4OANA 4I40A 3QMFA 1AWBA 2XA5A 5ET8A 2HHMA 2WYPA 3MSTA 1NV2A 3FBPA 4PFIA 1IMCA 4GWWA 4DI3D 1FBDA 1FPGA 4PF6A 4O94A 1K9YA 4GWXA 5I7IA 4GX6A 4PDHA 4O7MA 4MIJA 3RPLB 5EQ7A 5T3JA 4GWZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X8R A;  4OA4 A;  4N17 A;  4PGP A;  4P1L A;  4MNI A;  4OVS A;  3B50 A;  4PET A;  2WX9 A;  4N8Y A;  4OVP A;  2HZK A;  4UAB A;  2XWK A;  2CEX A;  2VPO A;  4PFB A;  4PAK A;  4O8M A;  2ZZX A;  4MAG A;  4N8G A;  4PDD A;  4P1E A;  4P56 A;  3U65 A;  4MEV A;  5IZZ A;  4NF0 A;  4N4U A;  4N6K A;  4MMP A;  3GYY A;  4NGU A;  4PGN A;  4LN5 A;  4N91 A;  4P9K A;  4N15 A;  4NHB A;  4OVR A;  2V4C A;  2CEY A;  5IGA A;  2XWO A;  4N6D A;  4MNC A;  4NG7 A;  2XWV A;  4YZZ A;  4P47 A;  4PC9 A;  2ZZW A;  4OVQ A;  2WYK A;  4DI4 B;  4OVT A;  4PFR A;  4PE3 A;  2XWI A;  4PAF A;  5IM2 A;  5CM6 A;  4MCO A;  2XXK A;  4MNP A;  4X04 A;  5I5P A;  4OAN A;  2PFY A;  4MX6 A;  5LTC A;  4P3L A;  4PF8 A;  4MHF A;  2XA5 A;  4P8B A;  2HPG A;  3FXB A;  2WYP A;  2PFZ A;  4XFE A;  4XF5 A;  4PFI A;  4NQ8 A;  4PAI A;  4YIC A;  4DI3 D;  4NAP A;  2HZL A;  4PF6 A;  4O94 A;  5I7I A;  4XEQ A;  4PDH A;  4NN3 A;  4O7M A;  4MIJ A;  4PCD A;  4PBQ A;  4NX1 A;  2VPN A;  4PBH A;  2ZZV A; 
#chains in the Genus database with same CATH topology
 1A8E A;  2PVU A;  2AIX A;  2P2A A;  2QPQ A;  4XIG Q;  2RCA A;  3NOH A;  1NUX A;  5DVI A;  3E13 X;  2IEE A;  3MPL A;  3QK6 A;  5L9M A;  3KFM A;  1LFH A;  4JVI A;  3C9H A;  1QUJ A;  3CRB A;  3FJM A;  4G68 C;  2VPO A;  3MWB A;  1YPN A;  4H46 A;  4PFB A;  1QUK A;  1WVJ A;  1UIU A;  1QKB A;  1JW5 A;  2ZNT A;  3SET A;  3RNN A;  2CZI A;  4MMP A;  3GXA A;  5AA3 A;  2QRY A;  4Q0C A;  3V83 A;  2V4C A;  1MM7 A;  4X48 A;  4JB7 A;  4MNC A;  1URG A;  3IK6 B;  3MZ9 A;  1SYI A;  4OEN A;  5EQ9 A;  5EQA A;  5EYG A;  1XS5 A;  4OFL A;  3T66 A;  3C33 A;  2Q88 A;  3FZV A;  2UYE A;  2XWI A;  3R26 A;  5IM2 A;  1NV0 A;  3W9W A;  2FIE A;  1Y1Z A;  4O3B A;  5JTY B;  4NWC A;  5J1D A;  3VXB A;  1LBB A;  2Z8E A;  4GD5 A;  1NV4 A;  1N0T A;  1Y4T A;  2O6A A;  3S2V A;  4C0R A;  2I4C A;  3KN3 A;  4ELQ A;  3OMB A;  4I1D A;  3LBS A;  4IGR A;  4DIG A;  3IOR A;  4RYA A;  3D4C A;  4PFU A;  2BJJ X;  5I2K B;  4QHQ A;  3KSJ A;  3CG1 A;  1OQH A;  2NXO A;  1NFT A;  2AL5 A;  3M3F A;  1S50 A;  4ZE8 A;  4BDQ A;  4NTL A;  3DLN A;  1LBV A;  4WKM A;  1FTK A;  1B40 A;  3T9V A;  4H67 A;  4HS7 A;  1LGB C;  3MVZ A;  5FHN A;  1NV7 A;  2O68 A;  4GLI A;  5IZ3 B;  3C36 A;  4RPN A;  4P1E A;  4NF8 A;  1MY2 A;  3TCG A;  3C32 A;  4LP2 B;  4YKP A;  4ZZA A;  2ESN A;  4PQJ A;  2I48 A;  1B51 A;  2WKY A;  1FBH A;  3R7X A;  3USD A;  1H44 A;  2A5T A;  4GWS A;  1QGX A;  2OWS A;  3G3H A;  1OLA A;  4N15 A;  3LSF B;  2CEY A;  2XXQ A;  4NF5 B;  1DOT A;  4YB6 A;  5LDZ A;  4EF1 A;  3KOT A;  4H5F A;  4BLA A;  5DVF A;  4YZZ A;  4GBV A;  5FTI A;  3G3K A;  4OQO A;  3EHT A;  4OEU A;  1FPE A;  3TTR A;  4F1U A;  2H25 A;  3MPK A;  4MCO A;  2RC8 A;  1JEV A;  3PPO A;  1PDA A;  2F78 A;  2PFY A;  4RJZ A;  1JNF A;  1B46 A;  4PF8 A;  4NWD A;  1RDZ A;  4HCY A;  4QXD A;  1FQD A;  4EXL A;  4ZEK A;  3S9N C;  3VVE A;  2CMO A;  3QIM A;  2XXY A;  1QUL A;  2P1S A;  3PGF A;  1WOD A;  1UQW A;  1FSA A;  3ROJ A;  4P11 A;  4O3C A;  3LC8 A;  2Z8D A;  1JW1 A;  1R9L A;  3V5A A;  2VPN A;  4DE8 A;  2ZNS A;  3PUV E;  2VT5 A;  2UVI A;  3UOR A;  3OSQ A;  1SW2 A;  3OXN A;  3EN3 A;  5AA1 A;  1IXG A;  1GV8 A;  5IAI A;  1ZMG A;  1OLC A;  1QW0 A;  2DSF A;  2Y7P A;  5F7V A;  4GWU A;  2OK2 A;  1I6B A;  3FVO A;  3SKP A;  3EQ1 A;  3U65 A;  3TOD A;  3EHU A;  3C4M A;  5H8S A;  3PV0 E;  4LQ2 A;  4F19 A;  1A40 A;  4OVJ A;  5F1Q A;  1B32 A;  4F31 B;  4QFL A;  2LAO A;  2OJT A;  1EZP A;  3O6G A;  2GHA A;  3MVX A;  4N81 A;  3OO6 A;  4ND9 A;  4KFQ A;  3TTN A;  4KYD A;  5ELV A;  4OVT A;  4XKN A;  3EKI A;  2DP8 A;  3O6H A;  4F3S A;  4H6D A;  3KOS A;  4YMA A;  3IOT A;  5L8D A;  1IQ7 A;  3SDF A;  3VFJ A;  5TPA B;  2ABH A;  1MRP A;  5L9O A;  2QS1 A;  1Y3P A;  3H6U A;  2B3B A;  1G0H A;  4QFP A;  1N04 A;  4NF8 B;  1B4H A;  5ET6 A;  4KXP A;  3WAE A;  3RPW A;  2A5T B;  4TLL B;  4YKJ A;  2DE4 A;  3H6T A;  2RKM A;  2A5S A;  3N5L A;  4R6Y A;  1EYK A;  1LAF E;  3U94 A;  4ESX A;  1DMB A;  5I57 A;  4UAC A;  2ZYO A;  5CC2 A;  3H6W A;  4OA4 A;  3U8Q A;  1B0L A;  2V3Q A;  4EQB A;  3PPP A;  1AIV A;  3KC0 A;  1LAH E;  1B4Z A;  4O3A A;  5BWJ A;  2Q8M A;  3ODB A;  4PAK A;  4LA9 A;  4MAG A;  3ZS6 A;  3B6T A;  3FJG A;  1ZJL A;  4GX3 A;  4MEV A;  3T9H B;  1SDX A;  4GX4 A;  2R71 A;  4GOT A;  3S9L C;  2AL4 A;  4NHB A;  3RLF E;  1UIV A;  4LON B;  1FTA A;  1NV3 A;  4R9F A;  1POT A;  4KYE A;  1QVS A;  1OQG A;  1JP4 A;  1SQY A;  4XXU A;  1KA0 A;  4E0W A;  1D3K A;  1XVX A;  2QS2 A;  1FPF A;  3QAX A;  5FBP A;  4OVQ A;  3TZA A;  3OEN A;  2KQZ A;  4RY1 A;  4OWD A;  1A99 A;  2HAU A;  5J16 A;  3N6U A;  3IX1 A;  1R6Z A;  3PU5 A;  4OAN A;  3DEL B;  4OTE A;  2F35 A;  4U22 A;  3T22 A;  3M3L A;  4BDN A;  5FHO A;  3THI A;  2HHM A;  2QMW A;  3MST A;  4BDL A;  1PC3 A;  4OHN A;  4OET A;  2ALU A;  1IMC A;  1N76 A;  4GWW A;  1MY3 A;  1FPG A;  4O94 A;  1MPD A;  3GBB A;  3IL1 B;  2XX9 A;  4JXI A;  5EQ7 A;  4LAT A;  4ZDM A;  3IOU A;  1FQE A;  4H0W A;  4ONY A;  1MXU A;  2XXV A;  1MXW A;  3O2A A;  4QFN A;  1UTH A;  1SW5 A;  2WBD A;  4N8Y A;  2HZK A;  2XWK A;  3T93 B;  3M8U A;  5TU0 A;  5JEI A;  1NNP A;  3I3V A;  1R9Q A;  1VFE A;  3CI8 A;  2DWH A;  2WEF A;  1LB8 A;  4GVO A;  4P56 A;  1NL5 A;  5CBR A;  3VLV A;  3VVD A;  1UTB A;  5H8Q B;  3CFL A;  1MQH A;  1QJM A;  4IO4 A;  4P9K A;  3T0J A;  4LQ5 A;  2F34 A;  3BIG A;  3IOW A;  2OZZ A;  4YKI A;  4R72 A;  1MDQ A;  2B4L A;  2VGQ A;  2QVU A;  4AQ4 A;  4RK2 A;  3UIF A;  4FBP A;  3HHG A;  5IKB A;  1XHY A;  1LLS A;  3TCF A;  3VE1 B;  1Q1K A;  3LUZ A;  1FTO A;  4F3G A;  2R8T A;  5I57 B;  5ET7 A;  2FA7 A;  4M1V A;  3R6U A;  5K2X A;  1USY E;  3O9P A;  3D4G A;  1MQJ A;  5EHS A;  1B5J A;  1FBC A;  3MBP A;  1IXC A;  4QBA A;  2H99 A;  4GWY A;  2CZL A;  3PPQ A;  1ZBM A;  2O1M A;  3IFA A;  5LTC A;  5DEX B;  4MH5 A;  3TDJ A;  5L9S A;  1S9T A;  3CVG A;  4YIC A;  4F1Y A;  2M8C A;  3K2D A;  4C1U A;  1A7L A;  4KCC A;  3W9V A;  1LFG A;  3CFX A;  2I58 A;  1SVX B;  2VP1 A;  4PBH A;  3ECR A;  2XXR A;  3CR9 A;  4PGP A;  4X9T A;  2FHY A;  2V3T A;  1FPD A;  1JEU A;  4HE2 A;  4IO6 A;  5CBS A;  2CEX A;  3UP9 A;  3H7M A;  4U4S A;  4K3F A;  1LBZ A;  1O63 A;  3E9X A;  1ZIU A;  1B58 A;  3CSG A;  4X1D A;  2VD3 A;  2XXH A;  3B6Q A;  1VDW A;  2DDK A;  4NF0 A;  1MH3 A;  1GGG A;  1URS A;  1N7W A;  2F8D A;  4PGN A;  1YAE A;  4NMY A;  1LST A;  2D21 A;  3PUY E;  1LBX A;  3ONM A;  3CG3 A;  3MJN A;  1N7X A;  3A3U A;  1MPB A;  4L17 A;  3BIH A;  2QSX A;  3K6W A;  4DI4 B;  4YKK A;  4PE5 B;  1ANF A;  4PAF A;  1ZTY A;  2Q2C A;  5B7D A;  2UYF A;  1NMU A;  4WED A;  4HTG A;  4XKP A;  1UTH B;  3LUY A;  3OD7 A;  1RYX A;  1VR5 A;  1B9J A;  4TOZ A;  3ILT B;  2X7Q A;  4G68 B;  2PCR A;  2KR0 A;  2H5Y A;  1H43 A;  2OWZ A;  2H9B A;  2RC7 A;  4XFE A;  3DP4 A;  3G7W A;  3IJO B;  3FD3 A;  2PT2 A;  3E78 A;  3BKI B;  1UTB B;  5H8F B;  2H98 A;  4NN3 A;  2ZYK A;  2DXR A;  1FQA A;  2O7I A;  3A3C A;  1B3G A;  2OX3 A;  5HPQ A;  4FOR A;  3SZP A;  3U72 A;  3B50 A;  2I6E A;  4PET A;  2RC9 A;  1JET A;  2O51 A;  1MS7 A;  2ONS A;  3FV2 A;  5M2V A;  5ITO A;  1B7H A;  2WBB A;  4U4X A;  5HM4 B;  1SYH A;  2Y7K A;  3TTM A;  2XD3 A;  3FV1 A;  5A5L A;  1NUW A;  4NF4 A;  3IJX B;  3GZG A;  4LN5 A;  1MM6 A;  5AE4 A;  2Y7W A;  2HXR A;  4QF9 A;  4GBW A;  2XD2 A;  4NED A;  3VXC A;  1SI0 A;  1IMD A;  1YZ0 A;  4ISU A;  2VHA A;  3FXQ A;  1FBP A;  1TFA A;  3MQ9 A;  5CI5 A;  5A5X B;  1D4N A;  2DWJ A;  1N3W A;  4PE3 A;  1FTM A;  1JVX A;  4JWO A;  1O7T A;  3IAZ A;  4KPT A;  1B1H A;  1OMP A;  3TTK A;  3LV0 A;  4IO2 A;  4F1V A;  1MH4 A;  4RXL A;  4AS5 A;  3HST A;  2V25 A;  3RT8 A;  1PEB A;  2XXU A;  3N94 A;  1ZU0 A;  4JSO A;  2YLN A;  1B2H A;  3S9M C;  4QSC A;  3H6V A;  4XEQ A;  5AA4 A;  2Y5K A;  2F6G A;  4NX1 A;  1BIY A;  2P3V A;  1FJ6 A;  4KHZ E;  2ZNU A;  1LEV A;  3PPN A;  1NV5 A;  3DM0 A;  1JW4 A;  4UAB A;  3LSX A;  3Q26 A;  3QUJ A;  2ZZX A;  1LBY A;  2MKZ A;  3TQW A;  3C31 A;  3MC2 A;  3HN0 A;  2Y7R A;  4ZED A;  4IO7 A;  4N6K A;  2Y7I A;  3LSW A;  4U23 A;  4EXK A;  4N91 A;  4OFJ A;  1EZO A;  3KG2 A;  1IXH A;  4G61 A;  5I59 A;  3PMW A;  4BDR A;  1IUD A;  4FEB A;  3EHS A;  1XOC A;  3O6I A;  4ZE9 A;  4WEP A;  4EUO A;  1EZ9 A;  4RPO A;  2ZZW A;  2GHB A;  1IMA A;  1ZKB A;  1I6Q A;  3Q25 A;  4OXV A;  2XXW A;  5I3S A;  1INP A;  3KJT A;  5ESY A;  4PFW A;  4U21 A;  5HBC A;  2XA5 A;  5ET8 A;  3P7I A;  1PB8 A;  1FQB A;  2DWI A;  2WYP A;  2FYI A;  1Y20 A;  3SEU A;  4PFI A;  1D9V A;  3A09 A;  3TUS A;  2R9J A;  3DP6 A;  4R9G A;  4G2Z A;  4NF4 B;  3CIJ A;  3SES A;  4U1O A;  2X26 A;  4F3B A;  1HSL A;  3G3G A;  1MY4 A;  4ECF A;  5ITP A;  3G3F A;  3IB0 A;  1A55 A;  2P3N A;  4IGT A;  4N17 A;  1TFD A;  3FAT A;  3PD8 A;  3K1P A;  3TFL A;  2XXX A;  4OVS A;  3OO9 A;  1DK4 A;  4THI A;  4ZEB A;  4GF8 A;  3L6H A;  4XKQ A;  3FUZ A;  2PYY A;  3O28 A;  4N8G A;  1LAG E;  3L6G A;  4POW A;  1LB9 A;  4HXV A;  5DT6 A;  2VOZ A;  3HO7 A;  3RYD A;  4FAT A;  3TCH A;  1OIB A;  4YB5 A;  4PTK A;  2W7Y A;  4MJO A;  1B7Z A;  2O69 A;  4JSD A;  4Q8R A;  1O64 A;  2F7A A;  4N6D A;  3JZJ A;  4QRZ A;  1CB6 A;  4JBZ A;  3BFT A;  1JQF A;  4ZEC A;  3LSL A;  4IY6 A;  3QYT A;  4R2B A;  4U2R A;  4N6P A;  1LCT A;  5I2N A;  2E1S A;  4TQU Q;  4OFO A;  2O84 X;  1GR2 A;  4BDM A;  4YB7 A;  4LVQ A;  5F24 A;  3OSR A;  1SBP A;  2UVJ A;  1DBZ A;  4WXJ A;  1MQG A;  2Q2A A;  4FEC A;  4H8I A;  3FXB A;  3A29 A;  3T9X B;  3TTL A;  1NUZ A;  2DOJ A;  1QKA A;  4F18 A;  4NQ8 A;  1XI6 A;  2XXT A;  3T9U A;  4FED A;  5CRY A;  1IMB A;  4G8N A;  1MQI A;  1P1N A;  1Y9U A;  5I59 B;  1SI1 A;  4IO3 A;  2L5V A;  2UVH A;  2FVZ A;  5KZT A;  3SEV A;  3KJ7 A;  3TAJ A;  2I3W A;  1B3F A;  1ATG A;  4Q5T A;  4KCD A;  4GQO A;  1N3X A;  3LR1 A;  5K2Y A;  5I56 A;  1OVB A;  4BDO A;  4GWO A;  3EPE A;  3KGC A;  2JJK A;  4R2F A;  1WDN A;  3HHF A;  4OEV A;  4I3Y A;  2PBW A;  3KZG A;  3SEW A;  2PT1 A;  1POY 1;  1P1O A;  3FVN A;  2I49 A;  4LZ8 A;  5CMC A;  3KN7 A;  3Q27 A;  4EQ9 A;  1P1W A;  4DDD A;  1FRP A;  4MF3 A;  1HSE A;  4Q30 B;  4EQ7 A;  3K1M A;  2D3I A;  2F3D A;  5I58 A;  2IA4 A;  1H3D A;  4GL0 A;  4P47 A;  1NV1 A;  1SD3 A;  3MVW A;  2BJI A;  1USY H;  3VLW A;  1B3E A;  3U1O A;  2Q74 A;  3MP1 A;  4JVC A;  2PMS A;  2E0S A;  2F7C A;  1FJ9 A;  1Y4C A;  2DYX A;  1IEJ A;  2QVV A;  3VVF A;  5JK4 A;  4QFK A;  1KWH A;  2ONK E;  2HPG A;  5H8N A;  2DWA A;  1NNF A;  3K01 A;  4AS4 A;  2NWJ A;  4TLM B;  1NH8 A;  4QSE A;  1BTJ A;  4NAP A;  2F7B A;  3RGY A;  4GXS B;  4PCD A;  3OOA A;  5CMB A;  2I4B A;  2F5X A;  1VE4 A;  3GBA A;  1B5I A;  3MZB A;  2QFL A;  1J1N A;  4ESW A;  3K6X A;  3H3G A;  4DXU A;  3PUZ E;  4RK9 A;  3M3K A;  3PD9 A;  3H03 A;  1YXI A;  3E4R A;  4C1T A;  2OLB A;  5DW8 A;  1XVY A;  2Q8J A;  4PDD A;  2R6G E;  3HCQ A;  1ELJ A;  4X1B A;  1T0K A;  4N07 A;  3TQL A;  1YCJ A;  1RDX A;  4QFO A;  4I3E A;  4NGU A;  5IZ3 A;  3IO4 A;  3RPL A;  2ONR A;  1NV6 A;  5ISU A;  1ZLQ A;  5IGA A;  4ELO A;  3PPR A;  1URD A;  1YTV A;  3MZ1 A;  3T1B A;  3PMX A;  3HFU A;  2O1L A;  2THI A;  3QXM A;  5FTH A;  5KDT A;  4PC9 A;  1R1N A;  4F22 A;  4G8H A;  4F29 A;  4FJP A;  1B52 A;  2B4M A;  1BLF A;  3RQT A;  3N26 A;  3W15 C;  1EU8 A;  4H5G A;  2AYS A;  4IO5 A;  5I56 B;  4MHF A;  1MXZ A;  1GVC A;  1Y3N A;  3CHG A;  2FBP A;  4XF5 A;  3B8B A;  3I6V A;  2HCA A;  1IXI A;  3JYR A;  4H8J A;  4H65 A;  4NE4 A;  1FBF A;  3BFU A;  3PTY A;  1FTL A;  1FQC A;  2HAV A;  4KI0 E;  5CMM A;  2XHD A;  5I58 B;  3TMG A;  1LCF A;  4OMB A;  5I84 A;  4AB5 A;  1XC1 A;  3FAS A;  3O29 A;  2RIN A;  4GRK A;  3SER A;  1KA1 A;  3UK4 A;  1I69 A;  4O8M A;  1TWY A;  2XXP A;  1Q35 A;  3BBR A;  1QUI A;  3DP8 A;  3C35 A;  4POX A;  1IIT A;  5EQ8 A;  3MAM A;  3UN6 A;  1RKM A;  2ANJ A;  4R6H A;  4DZ1 A;  2DVC A;  4GIZ A;  2QS4 A;  5H8N B;  1FPI A;  1MG1 A;  2Z23 A;  3RT6 B;  3KBZ A;  1EYJ A;  4XKR A;  1B6H A;  2NOO A;  1CE2 A;  2GRV A;  4H1X A;  4PP0 A;  2DS9 A;  3IR1 A;  2YJP A;  2WYK A;  4IY5 A;  1D9Y A;  4JVD A;  4OYV A;  4N13 A;  3HV1 A;  1IZ1 A;  1M5B A;  1LBC A;  1B7U A;  3RY3 A;  3WAF A;  3QMF A;  3CSB A;  1Z7N E;  1M5F A;  1JVY A;  2V3U A;  4JWX A;  1IIW A;  1US4 A;  2HEU A;  1MY0 A;  2Q89 A;  2RF1 A;  1F9B A;  3FBP A;  5TPA A;  3IOV A;  1MY1 A;  4DI3 D;  1FBD A;  4GWX A;  2REJ A;  5I7I A;  4GX6 A;  4O7M A;  3RPL B;  1H45 A;  5T3J A;  3HPI A;  4GWZ A;  4YU0 A;  4F2O A;  4IB2 A;  4YAH X;  1MXV A;  4GXA A;  3T96 B;  3GLB A;  1M5C A;  5KDT B;  2QVR A;  1DPE A;  5FHM A;  4HW8 A;  4LUB A;  4DCY A;  4DXB A;  4ELP A;  3S4U A;  3G3J A;  4N4U A;  4P0I A;  2HFB A;  1OVT A;  1B3L A;  2RCB A;  3K6V A;  2V84 A;  2OCU A;  4OVR A;  4I9D A;  4MLQ A;  1LAX A;  2G29 A;  4HCW A;  2X7P A;  1NUY A;  4OES A;  4KYS A;  1MPC A;  4KQP A;  1FBG A;  5EYF A;  4ZS9 A;  3S9E A;  4LZ5 A;  3Q29 A;  5H8H A;  3VLU A;  4MNP A;  1P1Q A;  1VFD A;  4DLD A;  2FNC A;  3MVY A;  1RDY A;  3JV9 A;  4P0G A;  2OWT A;  4R73 A;  4P3L A;  2V93 A;  3OO7 A;  3K1N A;  2XX8 A;  3U92 A;  5LOM A;  1D9Q A;  3B7D A;  5AA2 A;  4R75 A;  3KEI A;  4PAI A;  1DTG A;  4IR8 A;  3ZSF A;  1FPL A;  2F3B A;  1NNK A;  4NF6 A;  3EF7 A;  2F97 A;  1DTZ A;  1FQF A;  2Y84 A;  1FTJ A;  4PFY A;  4PBQ A;  2ZZV A;  2REG A;  3B6W A;  1M5E A;  1GTK A;  3ZKL A;  3N6T A;  5AA2 D;  1DSN A;  3SEY A;  1H76 A;  1EYI A;  3E79 A;  4EDP A;  1FCK A;  4LZ7 A;  1US5 A;  3TEL A;  3TKD A;  1Y1M A;  3CFZ A;  1B3H A;  1PBP A;  3RTW B;  3E3K A;  3MP6 A;  3V8X B;  2P0S A;  1MXX A;  2KLF A;  3GYY A;  4HE1 A;  1MDP 1;  1SW4 A;  4M4G A;  2I3V A;  2XX7 A;  3KSX A;  1NKX A;  2XWO A;  3VDF A;  2UVG A;  5B70 A;  1BKA A;  5H8Q A;  4NG7 A;  1NH7 A;  3O66 A;  4GFR A;  2I0C A;  2PX1 A;  4PFR A;  3U93 A;  2HXW A;  1PB7 A;  2HQ0 A;  2GH9 A;  4G8M A;  5CM6 A;  3FXU A;  2XXK A;  4ZZE A;  2O7U A;  4X04 A;  1CNQ A;  2ZYN A;  4ZEI A;  4I62 A;  4KR5 A;  2F6P A;  3IB1 A;  5DYH A;  1K9Z A;  4P8B A;  1II5 A;  4FIM A;  2FIX A;  3K4U A;  2VD2 A;  5AA4 B;  3MW0 A;  5DVJ A;  1A54 A;  1TT1 A;  3FVG A;  1B05 A;  2D5W A;  5DEX A;  3K02 A;  2HZL A;  3H06 B;  5TP9 A;  1FPJ A;  2GQ1 A;  3O97 A;  4QSD A;  1B0H A;  1DPP A;  2NVU B;  1LFI A;  1Y3Q A;  1BP5 A;  3FGS A;  4U1Z A;  4X8R A;  1YYZ A;  1I6A A;  1IMF A;  1FPB A;  2ZXT A;  2DE3 A;  4OVP A;  3PMV A;  5H8H B;  3K6U A;  3MP8 A;  4G4P A;  1Z7M E;  3IB2 A;  2CZK A;  4ZEF A;  1SPI A;  1L5T A;  4FE8 A;  4DXC A;  2QMX A;  5IZZ A;  5EYH A;  2H4I A;  1LBW A;  4MFI A;  4RNS A;  2Q9T A;  2QS3 A;  3D1R A;  4FAJ A;  5KCJ A;  2CZH A;  5BUU A;  1KZ8 A;  2GFE A;  5AA2 B;  3G3I A;  3FVK A;  5EHM A;  1XT8 A;  3UGW A;  1BK4 A;  2F36 A;  3QUF A;  4OER A;  2Y5L A;  2XWV A;  4YMB A;  4NF6 B;  1N84 A;  1FBE A;  4XTC Q;  2ZYM A;  2DE2 A;  4MBP A;  1IME A;  3ISP A;  2DVZ A;  4PFT A;  5I5P A;  4RA1 A;  1AL3 A;  2UXA A;  5ICT A;  4MX6 A;  5ET5 A;  1G0I A;  2YPN A;  5IZ1 A;  2Z8F A;  2PFZ A;  3KC1 A;  3KN8 A;  3IFC A;  1MXY A;  4Z7E A;  4EF2 A;  1SW1 A;  3TEP A;  2QL3 A;  4G68 A;  1VSO A;  3TPA A;  1DCU A;  4F2Q A;  4O7I A;  1AH5 A;  1RYO A;  3K0V A;  4G77 A;  3IO6 A;  2B65 A;  3Q28 A;  1AOV A;  1B1X A;  4P1L A;  3I5O A;  1MQD A;  5H8F A;  4MNI A;  4Z0I A;  5JTY A;  4JWY A;  5DTB A;  3FJ7 A;  2WX9 A;  1P99 A;  3K00 A;  4KD5 A;  4OZ9 A;  1FPK A;  3VV5 A;  3FIR A;  1M5D A;  4E0X A;  2DXY A;  4UA8 A;  1EH3 A;  3QSL A;  4R6K A;  3RN8 A;  2DQV A;  3V89 B;  4AB6 A;  2ZMB A;  5I2K A;  3MUQ A;  3RUM A;  2G93 A;  2NUV A;  1NNT A;  3AXF A;  4F39 A;  4MLV A;  1NI9 A;  4R74 A;  5CMK A;  2B3F A;  3F11 A;  1FW0 A;  1PB9 A;  5I2N B;  1Q9D A;  5TP9 B;  3OO8 A;  1TXF A;  4H45 A;  3OEK A;  5ICQ A;  3MYU A;  3PUX E;  4HE0 A;  5A5X A;  1B5H A;  3TYH A;  4I40 A;  1AWB A;  1P1U A;  1A8F A;  1HSJ A;  3H4Z A;  3OEM A;  1AMF A;  4I8C A;  4ELR A;  2XXI A;  1NV2 A;  4NF5 A;  3SEX A;  3UA8 A;  2QJE A;  3PUW E;  4JDF A;  4F3P A;  4GL8 A;  3RTF B;  1S7Y A;  3C34 A;  3OEL A;  4PF6 A;  2OBG A;  1K9Y A;  1PBQ A;  3ZKK A;  4PDH A;  4MIJ A;  2Z22 A;  5KCJ B;  3ILU B;  2I0B A;  3KBR A;  3FXR A;  4DCX A; 
#chains in the Genus database with same CATH homology
 2P3N A;  4N17 A;  2QPQ A;  3NOH A;  1NUX A;  4OVS A;  4JVI A;  2WBD A;  2QVR A;  4N8Y A;  1DK4 A;  2HZK A;  2XWK A;  2VPO A;  4PFB A;  4H46 A;  4N8G A;  2WEF A;  4P56 A;  2CZI A;  4N4U A;  4HXV A;  4MMP A;  3RYD A;  4P9K A;  4PTK A;  3T0J A;  4MJO A;  3BIG A;  4OVR A;  2V4C A;  4HCW A;  4N6D A;  2B4L A;  2QVU A;  1NUY A;  4MNC A;  4FBP A;  5EQ9 A;  5EQA A;  1FBG A;  5EYG A;  3LUZ A;  2R8T A;  2XWI A;  5ET7 A;  4M1V A;  5IM2 A;  1NV0 A;  3W9W A;  2FIE A;  4MNP A;  1FBC A;  4QBA A;  5F24 A;  4GWY A;  1RDY A;  5J1D A;  3IFA A;  5LTC A;  4P3L A;  1NV4 A;  1DBZ A;  3FXB A;  3A29 A;  1D9Q A;  1NUZ A;  4F18 A;  4NQ8 A;  4PAI A;  4YIC A;  1XI6 A;  4IR8 A;  1FPL A;  1IMB A;  2F3B A;  3W9V A;  4PBQ A;  4PBH A;  2L5V A;  2FVZ A;  2ZZV A;  4PGP A;  1LBV A;  4X9T A;  2FHY A;  1FPD A;  1EYI A;  4HE2 A;  3E79 A;  1NV7 A;  2CEX A;  2JJK A;  5IZ3 B;  1LBZ A;  4P1E A;  4I3Y A;  1VDW A;  2DDK A;  4NF0 A;  1FBH A;  3GYY A;  4HE1 A;  4GWS A;  1QGX A;  4PGN A;  1FRP A;  4N15 A;  2CEY A;  2XWO A;  5LDZ A;  1LBX A;  2F3D A;  4NG7 A;  4YZZ A;  4P47 A;  1NV1 A;  3BIH A;  4GBV A;  2BJI A;  4DI4 B;  4PFR A;  2Q74 A;  1FPE A;  4JVC A;  4F1U A;  4PAF A;  5CM6 A;  4MCO A;  2XXK A;  4X04 A;  1CNQ A;  1FJ9 A;  2PFY A;  2QVV A;  5JK4 A;  1K9Z A;  4PF8 A;  1RDZ A;  4P8B A;  4HCY A;  2HPG A;  2KR0 A;  2PCR A;  4QXD A;  2FIX A;  2OWZ A;  4XFE A;  4AS4 A;  3E78 A;  4NAP A;  2HZL A;  1FSA A;  3ROJ A;  1FPJ A;  2GQ1 A;  4NN3 A;  4PCD A;  2F5X A;  2VPN A;  2OX3 A;  4X8R A;  2VT5 A;  2QFL A;  1YYZ A;  3SZP A;  1IMF A;  3B50 A;  1FPB A;  4PET A;  1YXI A;  2DE3 A;  4OVP A;  5DW8 A;  2WBB A;  4PDD A;  4GWU A;  2CZK A;  1SPI A;  3U65 A;  5IZZ A;  5EYH A;  1RDX A;  5A5L A;  1LBW A;  1NUW A;  2Q9T A;  4I3E A;  4NGU A;  4LN5 A;  3D1R A;  4F19 A;  5IZ3 A;  3RPL A;  1NV6 A;  2CZH A;  2HXR A;  5IGA A;  1KZ8 A;  4GBW A;  3T1B A;  1BK4 A;  1IMD A;  2Y5L A;  1YZ0 A;  3HFU A;  2XWV A;  4N81 A;  1FBE A;  4PC9 A;  1FBP A;  2DE2 A;  4OVT A;  1IME A;  4PE3 A;  3ISP A;  3EKI A;  2DVZ A;  2B4M A;  5I5P A;  3LV0 A;  4F1V A;  4MX6 A;  5ET5 A;  1G0I A;  4AS5 A;  4MHF A;  5IZ1 A;  1G0H A;  2PFZ A;  3KC1 A;  3CHG A;  2FBP A;  4XF5 A;  3IFC A;  3B8B A;  5ET6 A;  4KXP A;  1FBF A;  1DCU A;  2DE4 A;  4XEQ A;  2Y5K A;  4O7I A;  3PTY A;  4NX1 A;  1EYK A;  2P3V A;  4OA4 A;  2V3Q A;  4P1L A;  3KC0 A;  4MNI A;  1FJ6 A;  1LEV A;  2WX9 A;  1NV5 A;  4UAB A;  2Q8M A;  1KA1 A;  1FPK A;  4PAK A;  4O8M A;  2ZZX A;  4MAG A;  1LBY A;  2MKZ A;  4GX3 A;  5EQ8 A;  4MEV A;  4GX4 A;  4N6K A;  4N91 A;  1FPI A;  4G61 A;  4NHB A;  1FTA A;  1NV3 A;  3KBZ A;  1EYJ A;  1NI9 A;  1JP4 A;  1KA0 A;  1Q9D A;  1FPF A;  5FBP A;  2ZZW A;  4OVQ A;  2WYK A;  4H45 A;  4JVD A;  2KQZ A;  1IMA A;  3MYU A;  5J16 A;  4HE0 A;  5I3S A;  1INP A;  5ESY A;  4OAN A;  4I40 A;  3QMF A;  1AWB A;  2XA5 A;  5ET8 A;  2HHM A;  2WYP A;  3MST A;  1NV2 A;  3FBP A;  4PFI A;  1IMC A;  4GWW A;  4DI3 D;  1FBD A;  1FPG A;  4PF6 A;  4O94 A;  1K9Y A;  4GWX A;  5I7I A;  4GX6 A;  4PDH A;  4O7M A;  4MIJ A;  3RPL B;  5EQ7 A;  5T3J A;  4GWZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...