4P47A

Crystal structure of a trap periplasmic solute binding protein from ochrobactrum anthropi (oant_4429), target efi-510151, c-termius bound in ligand binding pocket
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
320
structure length
320
Chain Sequence
EIRSQTIKFAAANSKGHPQVTGMEKFAELVKEKSGGQINVKLFPGGVLGSDPQTLSGLQGGVVEMTVMNAGILSSTVKAFEAVDLPFLFNSGEEADKVMDGPFGTNLMKRLPDTGLIGLAYWELGFRNLTNNRHPVAKLEDIAGLKIRTLQSPVPVALFNALGANAVPLPYTELYTALETGTVDGQENPNANIINAKFYEVQKYLTLTRHQYNPQIVMISKKFWDRLNDEEKAVIEQAAVEARDYQRKVSREQDATALDEIKKTGMQVTELTPEETTRLRDAVKPIIDKFTAEIGAETVDELFAELKKVRGENAENLYFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRAP dicarboxylate transporter, DctP subunit
publication title Experimental strategies for functional annotation and metabolism discovery: targeted screening of solute binding proteins and unbiased panning of metabolomes.
pubmed doi rcsb
source organism Ochrobactrum anthropi
molecule tags Solute-binding protein
total genus 122
structure length 320
sequence length 320
ec nomenclature
pdb deposition date 2014-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03480 DctP Bacterial extracellular solute-binding protein, family 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 4p47A00
2PFZA 2XWIA 4XF5A 4DI4B 4PC9A 4YICA 2V4CA 4X8RA 5IGAA 3GYYA 4PBHA 2CEXA 4NX1A 4P47A 2WYKA 4N6KA 2PFYA 4OVSA 4OVTA 4P1EA 4XFEA 4NGUA 2XWKA 3U65A 4MNPA 4PFRA 5IZZA 4PE3A 2VPOA 4PETA 4OVPA 2XWOA 4DI3D 4PAIA 4PGNA 4MMPA 5I7IA 3FXBA 4N17A 4N4UA 4XEQA 4PDHA 4NN3A 4OANA 4P8BA 2WYPA 4MNCA 2ZZWA 4NF0A 4PBQA 4MNIA 4PAFA 2HZKA 2CEYA 4N8GA 2ZZVA 4NHBA 2WX9A 4P56A 4N8YA 5IM2A 4MEVA 4N15A 2HPGA 4X04A 4P3LA 4PFBA 4N6DA 4PGPA 4LN5A 2HZLA 4MIJA 4UABA 4PF6A 4NQ8A 2XXKA 4OVQA 2XA5A 2XWVA 4MAGA 4P1LA 4PFIA 4MCOA 4PDDA 4MX6A 4MHFA 4PAKA 4PCDA 5I5PA 4YZZA 4PF8A 4OA4A 4NAPA 2VPNA 4OVRA 5LTCA 4N91A 4NG7A 4O94A 4O8MA 5CM6A 3B50A 2ZZXA 4P9KA 4O7MA
chains in the Genus database with same CATH superfamily
3Q25A 2IA4A 3IOTA 4AB6A 3QIMA 2XXTA 1FTAA 1T0KA 4DIGA 2QRYA 5IZ3A 3VVDA 3EPEA 3E3KA 2HHMA 4NX1A 1MY3A 2O6AA 3K2DA 2PFYA 1FPLA 2BJJX 3BIHA 2XXWA 4I40A 1JEVA 4BDOA 2CZLA 4QFOA 2V25A 4OYVA 1PBPA 1LB8A 2XD2A 4PE3A 4U21A 1MY4A 4QFKA 4YMBA 2OWSA 4KYSA 5EQ8A 2Z22A 3IB1A 2XHDA 4HE0A 1WODA 3TTMA 2LAOA 5KZTA 1CE2A 2RC9A 1B40A 5J1DA 3SEWA 4THIA 4IO7A 1FBCA 1B7ZA 3C36A 2DOJA 4WEPA 1FBDA 2VD3A 1EH3A 1ZLQA 2QVUA 2QSXA 3B8BA 4F2QA 2XWVA 3G3GA 1UIVA 1AMFA 1VFEA 3LC8A 4MCOA 4P11A 1MS7A 5FHOA 1S50A 4G8MA 4OWDA 3IB0A 2PX1A 2RF1A 1CB6A 4I8CA 5ET6A 3PUVE 2B65A 3S9LC 2PFZA 3T66A 4GOTA 4DXCA 1EZOA 3GBBA 3PV0E 4Q30B 5KDTB 1FPJA 3MZ9A 2E1SA 3CSGA 2P0SA 1P1OA 5ISUA 1R6ZA 4OVSA 4P1EA 3RUMA 3TAJA 3MVZA 4MF3A 3U92A 4X9TA 3PMWA 2OX3A 3T96B 4JBZA 1EZ9A 1D9VA 1LBYA 3TMGA 2ALUA 1O7TA 3TUSA 4UACA 2QVVA 4ELOA 3FXBA 3U1OA 1A54A 3KSXA 1PEBA 3EKIA 3G3HA 1DBZA 3N6UA 4X1BA 3HN0A 2H4IA 1SDXA 4HE2A 4G77A 3ROJA 3U94A 4BDRA 1N7WA 2P2AA 4QSDA 2XXVA 1NV7A 3O6IA 2PVUA 3QAXA 1B1HA 2P1SA 2DXRA 3FJMA 2B3BA 3CVGA 3SESA 2O7IA 3D4GA 2DE2A 3CI8A 3R7XA 1PB8A 2QPQA 1OLCA 2UVHA 1OVBA 3FD3A 4N6DA 3FXRA 4N07A 3SETA 2WEFA 2WBDA 4GX4A 4LUBA 4PDDA 5CMCA 2ZNUA 3LV0A 3CG3A 1EYKA 2O1LA 1QVSA 5I58A 3H4ZA 3ZS6A 4AS4A 4O94A 3OELA 2GH9A 4Z0IA 2F34A 3KBZA 3ODBA 4JDFA 2FBPA 5HM4B 3D1RA 4OFJA 3TCGA 1AH5A 5AA4B 1FW0A 1XVYA 2A5TB 1LB9A 2WYKA 2DWIA 2DWJA 3IOWA 4ZECA 1Y9UA 1R1NA 3Q27A 2HEUA 5ET8A 4PP0A 4RPNA 1S9TA 3H06B 5I84A 2F7BA 1UQWA 2OZZA 2R8TA 3TFLA 4QFLA 1IXCA 3QUJA 4RYAA 4I9DA 4G68C 4KCCA 4PAFA 2HXRA 1DTZA 3MQ9A 2RKMA 4LVQA 2WKYA 2VD2A 3H03A 4GWXA 2BJIA 4GWZA 1B5IA 2V93A 3DLNA 4EQ7A 1AOVA 3PD8A 1IZ1A 1LFGA 1JW1A 4M1VA 4PF6A 5FHNA 3DP6A 4KCDA 3FBPA 1QUJA 3OO9A 2F35A 1Y20A 1MRPA 2NOOA 2AYSA 5I5PA 5CBSA 3TPAA 3TTKA 1IXIA 3KN3A 4BLAA 2F8DA 4N91A 2D5WA 2ZYOA 1TXFA 3OO6A 1HSJA 3OMBA 2KR0A 4O3BA 2ZXTA 5T3JA 3THIA 1GR2A 5IGAA 5ET7A 2FYIA 1G0HA 4G68A 4LZ5A 3TEPA 4KR5A 1B0LA 3MPLA 1P1NA 1FPIA 4DXBA 1P99A 3N6TA 1WVJA 4OMBA 3KOSA 4NE4A 4DXUA 1MH3A 2UVIA 1I6BA 3MWBA 2GHAA 3KBRA 4FIMA 3IO4A 4QF9A 4GLIA 4H67A 4OESA 4TLLB 3IB2A 5I7IA 1B51A 2L5VA 4NF6A 1B2HA 1A7LA 3SERA 1NV1A 3TDJA 1M5EA 3O2AA 1YZ0A 1LAXA 4PE5B 3PPNA 3SDFA 1Y3NA 4GXSB 3JZJA 5I2KB 5EYHA 4FEBA 1FPGA 4U4XA 1OVTA 3OO8A 4ZEFA 4ZDMA 4HE1A 4ZE8A 1Y4CA 1N04A 4RK9A 2Q8MA 4WKMA 3EQ1A 4OEUA 3MP1A 4H5GA 4GBWA 4PFTA 5H8HB 5H8NB 5I3SA 3TTRA 3HSTA 1MPDA 1B5HA 4PAKA 3T93B 1NUZA 1OLAA 1P1WA 2F3BA 4HCWA 3FIRA 1DPEA 2P3VA 3OEMA 2PCRA 3GBAA 3T9XB 4NG7A 3FJGA 4BDNA 5CRYA 4N6PA 1A99A 2RC7A 4HW8A 4NWCA 1FPKA 3UK4A 4C0RA 1B3EA 3VE1B 5F1QA 5CMKA 1IIWA 3KGCA 2F7CA 2QFLA 1D4NA 3KEIA 1SW4A 1DK4A 2G93A 5FBPA 4PAIA 2E0SA 2NUVA 4JVDA 4R72A 4MMPA 5A5XB 1PB9A 2D21A 4YKJA 4NN3A 4LZ8A 5AE4A 5TP9B 1SW5A 3G7WA 3OOAA 5CMMA 5I2NA 2VP1A 4EXLA 2I3VA 2PT2A 2WX9A 5ET5A 1BLFA 1POTA 1J1NA 2X7QA 1Z7ME 5B70A 2I0CA 1FSAA 1NV4A 2A5TA 1JW4A 4MEVA 3UP9A 1SPIA 4RXLA 3ISPA 1M5CA 3SEXA 4C1UA 4GWWA 4G4PA 4G8HA 4OVJA 2FHYA 5BWJA 1DPPA 3UORA 3RPLA 5L8DA 1VE4A 3MC2A 4UABA 4I62A 4NF8B 3G3JA 4JVCA 5AA1A 4OVQA 1FBPA 3T0JA 4F1UA 2X26A 4X1DA 2DSFA 3IK6B 5CC2A 1FPEA 2ZYKA 3R26A 1DMBA 1B52A 3PUZE 2I4BA 2I48A 4TOZA 3G3IA 3O28A 3VLUA 5LTCA 3EHTA 3KJTA 4E0XA 3PU5A 1D9QA 3F11A 1KA0A 2ZZXA 1SW1A 1XC1A 4EF1A 4GX3A 1N0TA 3JV9A 2QS1A 2V4CA 1MY1A 4MLVA 4C1TA 4ELPA 1Y3PA 2NXOA 3A3UA 3OO7A 5I57A 1TFAA 3KN7A 4GWUA 2Z23A 3MP8A 2Y5KA 2GQ1A 1K9YA 4H45A 4ZE9A 3PMXA 3FUZA 4OTEA 1UIUA 3OENA 4AB5A 2XWKA 2VOZA 5I56A 4OVPA 3JYRA 2QS4A 2AL5A 4LA9A 4L17A 3PUWE 5H8QA 4YB7A 3E13X 1RDYA 3SZPA 4YKIA 4LP2B 4F29A 3T9VA 3ECRA 4Q8RA 1EZPA 1B3LA 1TWYA 2RINA 1KZ8A 3OEKA 4IGRA 4U22A 1NNPA 1URDA 5ICQA 2KLFA 3BBRA 5JTYA 3VVEA 1GTKA 2NWJA 1FPBA 3PPQA 4KYEA 3MVWA 1KWHA 2B4MA 3MBPA 3RN8A 4LATA 3Q26A 4XIGQ 4TQUQ 4OHNA 3USDA 4U1ZA 2THIA 3IJOB 2M8CA 4JWYA 1S7YA 4RPOA 1Q35A 1I6AA 4P0IA 4KQPA 4OXVA 2OLBA 1H44A 1AL3A 4OENA 2DWAA 4KHZE 3V8XB 4QHQA 1ZBMA 3B6WA 2HCAA 4DI4B 3C34A 3TYHA 1B1XA 5AA2B 1KA1A 3KZGA 2DE4A 3HO7A 2HXWA 5IKBA 5FTHA 4ZEDA 1LBVA 1N7XA 4P47A 4GXAA 3SKPA 1LLSA 1OQGA 1Y1MA 2Y7WA 3H6TA 4N6KA 3RGYA 4WXJA 4X48A 1BK4A 4OQOA 4H1XA 2XXRA 5H8HA 2R71A 4FECA 2ONSA 5ICTA 4QBAA 4ELRA 4GBVA 2F6PA 1UTBA 1ATGA 5CI5A 2REGA 3UIFA 2WYPA 4JWXA 4RNSA 1A8EA 1M5BA 3BKIB 4NF5A 3TZAA 3QYTA 3HHGA 1NH8A 1N3WA 3CR9A 3L6GA 4GF8A 4JWOA 4R9GA 4P56A 1NUYA 5EYGA 4N8YA 3R6UA 1MG1A 4G61A 5I59B 4JSDA 2VHAA 1NV5A 4X04A 3C32A 4P3LA 2XXIA 1LBXA 3FJ7A 1FTMA 4R6KA 3BIGA 1BTJA 1JNFA 1YCJA 4EUOA 2R6GE 5JK4A 3HPIA 1QULA 2VPNA 1LSTA 3ZKKA 3PMVA 4R2FA 4R74A 1UTHB 4O7MA 4GWOA 2FA7A 1LBZA 4NF4A 1R9LA 4PBHA 3DELB 5F7VA 4H8IA 1NKXA 1IMDA 4QSCA 3KC1A 3E78A 3CHGA 4DLDA 1MM6A 2HQ0A 1H3DA 3FV1A 2VPOA 2XWOA 4KXPA 1RKMA 3SEVA 4XEQA 1NV3A 2ZNSA 3N94A 4PDHA 3GLBA 2X7PA 3QXMA 2ZZWA 4GVOA 2JJKA 1N3XA 3K6UA 1IMEA 3Q28A 3WAEA 5ELVA 1MXZA 2F36A 2CZHA 3LUZA 3VLWA 1MXVA 1DTGA 5M2VA 1SVXB 3IR1A 5H8FA 4IB2A 4BDLA 1II5A 4GL8A 3PUXE 2GRVA 5HPQA 1URSA 4E0WA 5DEXB 5AA2D 1EU8A 3RLFE 1FPDA 3UN6A 1FJ9A 1JVYA 4IO6A 1LBWA 3K02A 1BKAA 5CMBA 4HXVA 1GVCA 2ZYNA 4R2BA 4NTLA 4H5FA 3FVNA 3S9NC 3HHFA 3O29A 2OJTA 4OVRA 4MLQA 3L6HA 1IITA 3HV1A 1IXHA 1B05A 1JP4A 2A5SA 2PBWA 1NI9A 1IXGA 1R9QA 3W9VA 1IUDA 1K9ZA 3GYYA 2MKZA 2XXXA 1LBBA 3A3CA 5TPAB 3FVGA 4FORA 3RTFB 5LDZA 3LR1A 4F3GA 3U65A 1NUXA 2ONKE 4ZS9A 5EHMA 1M5DA 1B3GA 2UVJA 5IZ3B 3OXNA 1AWBA 4KD5A 5EHSA 3B6QA 3U8QA 4LONB 1SD3A 3AXFA 5ESYA 4EXKA 2RCBA 1LBCA 2QL3A 3D4CA 1JW5A 3S9MC 4XTCQ 3TKDA 3OD7A 2HAVA 2QS2A 4O7IA 1B32A 2V3UA 3GZGA 3CSBA 3EHUA 2H25A 1FQEA 1INPA 2PMSA 4YB5A 2XXKA 3K1NA 3RPWA 2Q8JA 2I58A 5KDTA 1LFIA 3CFLA 3K6XA 4PF8A 3M3FA 2AIXA 5EQAA 1SW2A 3VV5A 5DYHA 5L9MA 2P3NA 4R6HA 2Y7IA 1YTVA 4RY1A 3T1BA 4MFIA 3IO6A 3E9XA 4HS7A 3RNNA 4F1VA 3FATA 5K2XA 1DOTA 2Q2CA 2Q9TA 4H6DA 1IMAA 1MXYA 1QUKA 1YYZA 1ZKBA 1EYJA 4KI0E 5B7DA 5HBCA 2Q89A 3PTYA 2XXPA 2PT1A 4BDMA 4MNPA 4IGTA 3FVOA 1SI0A 3MVYA 1SYHA 1JVXA 4OEVA 3IORA 1TT1A 1FQBA 1L5TA 4RK2A 4OANA 3MPKA 4F1YA 1A55A 2ZNTA 4QXDA 4MNCA 1Y4TA 1I6QA 3I6VA 2O68A 3K1MA 1HSLA 5KCJB 4ZZEA 1B5JA 2GHBA 1OMPA 2KQZA 2H5YA 5IM2A 1B9JA 5LOMA 3U93A 3U72A 3WAFA 2HAUA 3I3VA 1VSOA 3C35A 3LSXA 4R73A 4NWDA 4DDDA 2VGQA 3K4UA 4ZEKA 2DVCA 4R75A 1MQGA 3K00A 1XI6A 4MAGA 4EDPA 4GRKA 3FASA 2YJPA 5AA4A 4ZEIA 3O6HA 2DQVA 3IAZA 4YKKA 4R6YA 1FRPA 3RT6B 3IOUA 3E79A 5CM6A 2AL4A 1P1QA 4G2ZA 1US4A 2XWIA 4JSOA 2Y7KA 1MXUA 2V3TA 3N26A 4EF2A 2DS9A 3H3GA 3MW0A 4KPTA 1POY1 4FEDA 3OSQA 3FVKA 2PYYA 1H76A 2ZMBA 3V5AA 2O7UA 5I58B 4ZEBA 2W7YA 1TFDA 5EYFA 4TLMB 5BUUA 1LAFE 3TQLA 2DP8A 2CMOA 3G3FA 4PGNA 1ANFA 2XXYA 5AA3A 1P1UA 4RA1A 4GFRA 4HTGA 3ZSFA 2H99A 4OETA 1LEVA 3DP8A 4I3EA 2DWHA 4GL0A 4IO3A 2DE3A 1PC3A 1BIYA 3LBSA 2Z8DA 4U2RA 2ONRA 3IFCA 1H45A 1O64A 4N81A 4OZ9A 2REJA 4NHBA 5ITPA 1VDWA 1WDNA 4N15A 2HPGA 4IO2A 2UYEA 1N76A 4F22A 1XT8A 2I4CA 2F3DA 4PGPA 3UGWA 1Z7NE 2ESNA 2QMXA 3EHSA 4YU0A 4EQ9A 1LCFA 1RDZA 1MQDA 1LGBC 4F31B 1ZIUA 2UXAA 3FV2A 1XS5A 3CFZA 4FATA 1ZMGA 2Q2AA 1SBPA 1JEUA 4FE8A 1FTOA 3C4MA 4P9KA 3OSRA 4XF5A 3EN3A 3A09A 4F3SA 2XD3A 3FXUA 3KG2A 1B3FA 1I69A 1FPFA 3RYDA 4DCXA 2UVGA 4ESXA 1RYXA 3KFMA 3CIJA 4LQ2A 2OWZA 3KSJA 5CBRA 1FBFA 3P7IA 3MZ1A 5I2KA 3T9UA 4QFNA 5IZ1A 4GWYA 4ND9A 4N17A 1ZTYA 3VXCA 4G68B 3TELA 2XX9A 1B0HA 4IO4A 2F6GA 4POXA 2F5XA 1FBGA 5DVFA 1EYIA 3IJXB 1IEJA 4ELQA 4NMYA 3RTWB 3TQWA 2FIEA 3IFAA 4N8GA 2Y5LA 5H8NA 4F3PA 1XOCA 1MDQA 1XHYA 3O97A 2HFBA 4NF6B 3KN8A 3RQTA 3VLVA 4PFBA 4F3BA 1NNFA 5EQ9A 1FQFA 3KC0A 4GD5A 3T22A 1USYE 4MX6A 1ZU0A 2H98A 3B7DA 1AIVA 5F24A 5DTBA 4H0WA 4QRZA 4OA4A 4ESWA 2H9BA 4XKQA 5L9OA 1MPCA 3O9PA 1B7HA 5KCJA 3QK6A 1QW0A 1MY2A 2Z8FA 4O3CA 5A5XA 3MYUA 1FCKA 1FBEA 1DSNA 5TP9A 4K3FA 1QUIA 4OVTA 3BFTA 2XXHA 1SI1A 1PB7A 4MH5A 4GX6A 3HCQA 3TCFA 4H8JA 2YPNA 1OIBA 3K01A 1BP5A 3PGFA 1FTJA 1Y3QA 4PTKA 2O51A 1JQFA 1B58A 3MSTA 4YAHX 4DE8A 4NF8A 1HSEA 2RC8A 2B4LA 4FJPA 2Z8EA 3GXAA 3M3KA 5DT6A 1YXIA 2Q74A 2O69A 4PFWA 1NV2A 4MBPA 1GGGA 1MH4A 4LN5A 2FVZA 1QGXA 3N5LA 5JEIA 1LFHA 5I2NB 5EQ7A 1NNTA 1NUWA 4PFIA 4OERA 3PPOA 3K6VA 4JVIA 4OFLA 4DZ1A 1PDAA 1B4HA 4RJZA 2F7AA 3RPLB 2O84X 3ONMA 3KJ7A 4O8MA 5FTIA 4FAJA 1N84A 1RDXA 2XXQA 4PC9A 1DCUA 2DXYA 4YICA 1IMBA 2UYFA 4X8RA 4F19A 3K1PA 4XKPA 4ECFA 3EF7A 1Q9DA 2Y7PA 4XFEA 4U23A 4JB7A 4UA8A 3PUYE 3H6WA 3NOHA 2FIXA 1MPBA 2IEEA 1JETA 3SEUA 4PFRA 4YKPA 5L9SA 4I3YA 4PETA 2G29A 4XXUA 4JXIA 3C31A 3ILUB 5I57B 2R9JA 4LZ7A 1IMCA 1NH7A 5TU0A 3W9WA 2XX7A 4GIZA 1H43A 4GQOA 1IQ7A 3M8UA 2HZKA 4IY6A 5I56B 2ZZVA 3IOVA 3O66A 1SYIA 2YLNA 1GV8A 3M3LA 5H8QB 1NNKA 2DDKA 2I0BA 3LSFB 4YB6A 2HZLA 4MIJA 3DM0A 4GWSA 5IAIA 2XXUA 5H8SA 2V3QA 2XA5A 3QUFA 4WEDA 3CFXA 5AA2A 3H6VA 1B3HA 5JTYB 5DVIA 1A8FA 3BFUA 3PPRA 3MJNA 3DP4A 1MXXA 3T9HB 1M5FA 3VFJA 4F18A 3B50A 1NFTA 1D9YA 1IMFA 4MJOA 2RCAA 2I3WA 4QSEA 3MUQA 1YAEA 5DVJA 1LAGE 1NMUA 1MM7A 4NEDA 4O3AA 1CNQA 3TODA 4R9FA 4P0GA 5ITOA 1PBQA 4AS5A 3ILTB 2I6EA 3B6TA 2OCUA 5J16A 4DI3D 2D3IA 3RT8A 2GFEA 4F2OA 4H46A 4ZZAA 1OQHA 4HCYA 2DVZA 3QMFA 5I59A 1SQYA 4I1DA 2F97A 1D3KA 3ZKLA 5FHMA 4Z7EA 3K6WA 2CZIA 4NF0A 4PBQA 4MNIA 4U4SA 1MQIA 1QJMA 2F78A 3LSWA 1FQAA 5A5LA 1RYOA 2OK2A 4H65A 1UTBB 1LAHE 4YMAA 2V84A 3FGSA 3E4RA 1NL5A 4NF5B 2B3FA 1UTHA 1QKBA 4NQ8A 2QVRA 1O63A 4POWA 3MP6A 3MVXA 3IL1B 1FJ6A 3K0VA 4LQ5A 3MAMA 4MHFA 2Y7RA 1USYH 3FZVA 3LUYA 4N13A 3S4UA 4F39A 2ANJA 1YPNA 3W15C 1MQHA 3LSLA 4NAPA 4XKNA 2NVUB 4Q0CA 2Q88A 2CZKA 1A40A 1FQDA 4PQJA 3CG1A 1ELJA 1NV6A 1Y1ZA 4OFOA 3VDFA 3G3KA 2I49A 2VT5A 1B4ZA 3I5OA 4PFYA 4ISUA 3PPPA 1XVXA 4PFUA 3IX1A 2CEXA 1Q1KA 4QFPA 3QSLA 4FBPA 1FTLA 1MXWA 3Q29A 4G8NA 4NGUA 3RY3A 2Y84A 3FXQA 1FBHA 3KOTA 5IZZA 1MY0A 3S2VA 4ONYA 1URGA 3UA8A 1FQCA 4N4UA 1G0IA 3SEYA 4KYDA 4NF4B 1B46A 4P8BA 5DEXA 4BDQA 3H7MA 1VFDA 1F9BA 4DCYA 1ZJLA 3CRBA 2QS3A 3VVFA 2OWTA 3TTLA 2CEYA 2QMWA 2XX8A 2WBBA 4U1OA 3VXBA 2QJEA 3HFUA 4AQ4A 3H6UA 4IO5A 1B6HA 3A29A 4XKRA 2FNCA 1VR5A 2O1MA 3V83A 3C9HA 3TTNA 1US5A 3PD9A 3S9EA 1QKAA 3O6GA 4M4GA 4KFQA 4P1LA 5H8FB 5K2YA 1LCTA 3TCHA 4IR8A 4EQBA 5DW8A 4IY5A 3MZBA 4PCDA 5TPAA 2ABHA 2ZYMA 4YZZA 1MQJA 1NV0A 2DYXA 2OBGA 1B7UA 1MDP1 3C33A 1FTKA 4Q5TA 3V89B
chains in the Genus database with same CATH topology
1FTAA 1FPKA 1JP4A 5IZ3A 1NI9A 3MYUA 3W9VA 2HHMA 1FBEA 1K9ZA 2MKZA 3GYYA 4NX1A 2PFYA 4OVTA 1FPLA 5LDZA 3BIHA 4I40A 2QFLA 3U65A 1NUXA 4GX6A 4PE3A 1DK4A 5FBPA 4PAIA 4JVDA 5IZ3B 4MMPA 1AWBA 4NN3A 4PTKA 5EQ8A 3MSTA 5ESYA 4HE0A 5J1DA 2B4LA 2WX9A 5ET5A 1YXIA 1FBCA 2Q74A 1FSAA 1NV4A 4MEVA 1SPIA 4O7IA 3ISPA 1FBDA 4GWWA 2FHYA 1NV2A 3RPLA 2QVUA 4LN5A 2FVZA 1QGXA 4UABA 3B8BA 1INPA 4JVCA 5EQ7A 2XXKA 4OVQA 2XWVA 1FBPA 3T0JA 4F1UA 1NUWA 4PFIA 4MCOA 4JVIA 1FPEA 4PF8A 5EQAA 3RPLB 5LTCA 1D9QA 4O8MA 2ZZXA 1KA0A 5ET6A 2PFZA 2P3NA 1RDXA 4PC9A 1DCUA 3T1BA 4GX3A 4YICA 4F1VA 2V4CA 1IMBA 4X8RA 4F19A 1FPJA 2Q9TA 1IMAA 1YYZA 4GWUA 1EYJA 2Y5KA 1Q9DA 4OVSA 2GQ1A 4XFEA 4P1EA 1K9YA 4H45A 3PTYA 4X9TA 2OX3A 2XWKA 3NOHA 2FIXA 4MNPA 4PFRA 4I3YA 4PETA 4OVPA 1LBYA 2QVVA 3FXBA 1IMCA 4OANA 1RDYA 3SZPA 3EKIA 1DBZA 4QXDA 3W9WA 4MNCA 4HE2A 3ROJA 1KZ8A 2HZKA 1NV7A 2ZZVA 2KQZA 5IM2A 1FPBA 2DE2A 2DDKA 2QPQA 4N6DA 2HZLA 4MIJA 4GWSA 2B4MA 2WEFA 2V3QA 1XI6A 2XA5A 2WBDA 4MAGA 4GX4A 4PDDA 3LV0A 1EYKA 1FRPA 4AS4A 4O94A 3E79A 4F18A 5CM6A 3B50A 2XWIA 4DI4B 1IMFA 3KBZA 2FBPA 4MJOA 1KA1A 3D1RA 2DE4A 1LBVA 1CNQA 4P47A 2WYKA 4N6KA 4AS5A 1BK4A 5ET8A 5J16A 4DI3D 4QBAA 4PGNA 4GBVA 2R8TA 4H46A 4HCYA 2DVZA 3QMFA 2WYPA 1LEVA 4I3EA 2DE3A 2CZIA 4NF0A 4PBQA 4MNIA 4PAFA 2HXRA 3IFCA 4N81A 4NHBA 4P56A 5A5LA 1VDWA 1NUYA 4GWXA 5EYGA 4N8YA 2BJIA 4G61A 4GWZA 4N15A 2HPGA 1NV5A 4X04A 4P3LA 2F3DA 4PGPA 1LBXA 4M1VA 4PF6A 4NQ8A 2QVRA 3BIGA 1RDZA 1FJ6A 3FBPA 4MHFA 5JK4A 5I5PA 4NAPA 2VPNA 4N91A 2CZKA 1NV6A 4P9KA 4O7MA 4XF5A 2VT5A 2KR0A 1LBZA 5T3JA 5IGAA 5ET7A 1G0HA 4PBHA 2CEXA 4FBPA 1IMDA 1FPFA 1FPIA 3RYDA 3KC1A 3E78A 4NGUA 3CHGA 2OWZA 1FBHA 1FBFA 5IZZA 2VPOA 2XWOA 4KXPA 5IZ1A 4GWYA 5I7IA 4N17A 2L5VA 4N4UA 1G0IA 4XEQA 1NV3A 4PDHA 4P8BA 1NV1A 2ZZWA 2JJKA 1IMEA 2F5XA 1YZ0A 1FBGA 1EYIA 2CZHA 3LUZA 2CEYA 2FIEA 3IFAA 4N8GA 2Y5LA 5EYHA 2WBBA 3HFUA 3A29A 1FPGA 4PFBA 1FPDA 4HE1A 2Q8MA 1FJ9A 1LBWA 5EQ9A 3KC0A 4GBWA 4P1LA 5I3SA 4HXVA 4IR8A 5DW8A 4MX6A 4PAKA 1NUZA 4PCDA 2F3BA 5F24A 4HCWA 4YZZA 2P3VA 1NV0A 4OA4A 2PCRA 4OVRA 4NG7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PFZ A;  2XWI A;  4XF5 A;  4DI4 B;  4PC9 A;  4YIC A;  2V4C A;  4X8R A;  5IGA A;  3GYY A;  4PBH A;  2CEX A;  4NX1 A;  4P47 A;  2WYK A;  4N6K A;  2PFY A;  4OVS A;  4OVT A;  4P1E A;  4XFE A;  4NGU A;  2XWK A;  3U65 A;  4MNP A;  4PFR A;  5IZZ A;  4PE3 A;  2VPO A;  4PET A;  4OVP A;  2XWO A;  4DI3 D;  4PAI A;  4PGN A;  4MMP A;  5I7I A;  3FXB A;  4N17 A;  4N4U A;  4XEQ A;  4PDH A;  4NN3 A;  4OAN A;  4P8B A;  2WYP A;  4MNC A;  2ZZW A;  4NF0 A;  4PBQ A;  4MNI A;  4PAF A;  2HZK A;  2CEY A;  4N8G A;  2ZZV A;  4NHB A;  2WX9 A;  4P56 A;  4N8Y A;  5IM2 A;  4MEV A;  4N15 A;  2HPG A;  4X04 A;  4P3L A;  4PFB A;  4N6D A;  4PGP A;  4LN5 A;  2HZL A;  4MIJ A;  4UAB A;  4PF6 A;  4NQ8 A;  2XXK A;  4OVQ A;  2XA5 A;  2XWV A;  4MAG A;  4P1L A;  4PFI A;  4MCO A;  4PDD A;  4MX6 A;  4MHF A;  4PAK A;  4PCD A;  5I5P A;  4YZZ A;  4PF8 A;  4OA4 A;  4NAP A;  2VPN A;  4OVR A;  5LTC A;  4N91 A;  4NG7 A;  4O94 A;  4O8M A;  5CM6 A;  3B50 A;  2ZZX A;  4P9K A;  4O7M A; 
#chains in the Genus database with same CATH topology
 3Q25 A;  2IA4 A;  3IOT A;  4AB6 A;  3QIM A;  2XXT A;  1FTA A;  1T0K A;  4DIG A;  2QRY A;  5IZ3 A;  3VVD A;  3EPE A;  3E3K A;  2HHM A;  4NX1 A;  1MY3 A;  2O6A A;  3K2D A;  2PFY A;  1FPL A;  2BJJ X;  3BIH A;  2XXW A;  4I40 A;  1JEV A;  4BDO A;  2CZL A;  4QFO A;  2V25 A;  4OYV A;  1PBP A;  1LB8 A;  2XD2 A;  4PE3 A;  4U21 A;  1MY4 A;  4QFK A;  4YMB A;  2OWS A;  4KYS A;  5EQ8 A;  2Z22 A;  3IB1 A;  2XHD A;  4HE0 A;  1WOD A;  3TTM A;  2LAO A;  5KZT A;  1CE2 A;  2RC9 A;  1B40 A;  5J1D A;  3SEW A;  4THI A;  4IO7 A;  1FBC A;  1B7Z A;  3C36 A;  2DOJ A;  4WEP A;  1FBD A;  2VD3 A;  1EH3 A;  1ZLQ A;  2QVU A;  2QSX A;  3B8B A;  4F2Q A;  2XWV A;  3G3G A;  1UIV A;  1AMF A;  1VFE A;  3LC8 A;  4MCO A;  4P11 A;  1MS7 A;  5FHO A;  1S50 A;  4G8M A;  4OWD A;  3IB0 A;  2PX1 A;  2RF1 A;  1CB6 A;  4I8C A;  5ET6 A;  3PUV E;  2B65 A;  3S9L C;  2PFZ A;  3T66 A;  4GOT A;  4DXC A;  1EZO A;  3GBB A;  3PV0 E;  4Q30 B;  5KDT B;  1FPJ A;  3MZ9 A;  2E1S A;  3CSG A;  2P0S A;  1P1O A;  5ISU A;  1R6Z A;  4OVS A;  4P1E A;  3RUM A;  3TAJ A;  3MVZ A;  4MF3 A;  3U92 A;  4X9T A;  3PMW A;  2OX3 A;  3T96 B;  4JBZ A;  1EZ9 A;  1D9V A;  1LBY A;  3TMG A;  2ALU A;  1O7T A;  3TUS A;  4UAC A;  2QVV A;  4ELO A;  3FXB A;  3U1O A;  1A54 A;  3KSX A;  1PEB A;  3EKI A;  3G3H A;  1DBZ A;  3N6U A;  4X1B A;  3HN0 A;  2H4I A;  1SDX A;  4HE2 A;  4G77 A;  3ROJ A;  3U94 A;  4BDR A;  1N7W A;  2P2A A;  4QSD A;  2XXV A;  1NV7 A;  3O6I A;  2PVU A;  3QAX A;  1B1H A;  2P1S A;  2DXR A;  3FJM A;  2B3B A;  3CVG A;  3SES A;  2O7I A;  3D4G A;  2DE2 A;  3CI8 A;  3R7X A;  1PB8 A;  2QPQ A;  1OLC A;  2UVH A;  1OVB A;  3FD3 A;  4N6D A;  3FXR A;  4N07 A;  3SET A;  2WEF A;  2WBD A;  4GX4 A;  4LUB A;  4PDD A;  5CMC A;  2ZNU A;  3LV0 A;  3CG3 A;  1EYK A;  2O1L A;  1QVS A;  5I58 A;  3H4Z A;  3ZS6 A;  4AS4 A;  4O94 A;  3OEL A;  2GH9 A;  4Z0I A;  2F34 A;  3KBZ A;  3ODB A;  4JDF A;  2FBP A;  5HM4 B;  3D1R A;  4OFJ A;  3TCG A;  1AH5 A;  5AA4 B;  1FW0 A;  1XVY A;  2A5T B;  1LB9 A;  2WYK A;  2DWI A;  2DWJ A;  3IOW A;  4ZEC A;  1Y9U A;  1R1N A;  3Q27 A;  2HEU A;  5ET8 A;  4PP0 A;  4RPN A;  1S9T A;  3H06 B;  5I84 A;  2F7B A;  1UQW A;  2OZZ A;  2R8T A;  3TFL A;  4QFL A;  1IXC A;  3QUJ A;  4RYA A;  4I9D A;  4G68 C;  4KCC A;  4PAF A;  2HXR A;  1DTZ A;  3MQ9 A;  2RKM A;  4LVQ A;  2WKY A;  2VD2 A;  3H03 A;  4GWX A;  2BJI A;  4GWZ A;  1B5I A;  2V93 A;  3DLN A;  4EQ7 A;  1AOV A;  3PD8 A;  1IZ1 A;  1LFG A;  1JW1 A;  4M1V A;  4PF6 A;  5FHN A;  3DP6 A;  4KCD A;  3FBP A;  1QUJ A;  3OO9 A;  2F35 A;  1Y20 A;  1MRP A;  2NOO A;  2AYS A;  5I5P A;  5CBS A;  3TPA A;  3TTK A;  1IXI A;  3KN3 A;  4BLA A;  2F8D A;  4N91 A;  2D5W A;  2ZYO A;  1TXF A;  3OO6 A;  1HSJ A;  3OMB A;  2KR0 A;  4O3B A;  2ZXT A;  5T3J A;  3THI A;  1GR2 A;  5IGA A;  5ET7 A;  2FYI A;  1G0H A;  4G68 A;  4LZ5 A;  3TEP A;  4KR5 A;  1B0L A;  3MPL A;  1P1N A;  1FPI A;  4DXB A;  1P99 A;  3N6T A;  1WVJ A;  4OMB A;  3KOS A;  4NE4 A;  4DXU A;  1MH3 A;  2UVI A;  1I6B A;  3MWB A;  2GHA A;  3KBR A;  4FIM A;  3IO4 A;  4QF9 A;  4GLI A;  4H67 A;  4OES A;  4TLL B;  3IB2 A;  5I7I A;  1B51 A;  2L5V A;  4NF6 A;  1B2H A;  1A7L A;  3SER A;  1NV1 A;  3TDJ A;  1M5E A;  3O2A A;  1YZ0 A;  1LAX A;  4PE5 B;  3PPN A;  3SDF A;  1Y3N A;  4GXS B;  3JZJ A;  5I2K B;  5EYH A;  4FEB A;  1FPG A;  4U4X A;  1OVT A;  3OO8 A;  4ZEF A;  4ZDM A;  4HE1 A;  4ZE8 A;  1Y4C A;  1N04 A;  4RK9 A;  2Q8M A;  4WKM A;  3EQ1 A;  4OEU A;  3MP1 A;  4H5G A;  4GBW A;  4PFT A;  5H8H B;  5H8N B;  5I3S A;  3TTR A;  3HST A;  1MPD A;  1B5H A;  4PAK A;  3T93 B;  1NUZ A;  1OLA A;  1P1W A;  2F3B A;  4HCW A;  3FIR A;  1DPE A;  2P3V A;  3OEM A;  2PCR A;  3GBA A;  3T9X B;  4NG7 A;  3FJG A;  4BDN A;  5CRY A;  4N6P A;  1A99 A;  2RC7 A;  4HW8 A;  4NWC A;  1FPK A;  3UK4 A;  4C0R A;  1B3E A;  3VE1 B;  5F1Q A;  5CMK A;  1IIW A;  3KGC A;  2F7C A;  2QFL A;  1D4N A;  3KEI A;  1SW4 A;  1DK4 A;  2G93 A;  5FBP A;  4PAI A;  2E0S A;  2NUV A;  4JVD A;  4R72 A;  4MMP A;  5A5X B;  1PB9 A;  2D21 A;  4YKJ A;  4NN3 A;  4LZ8 A;  5AE4 A;  5TP9 B;  1SW5 A;  3G7W A;  3OOA A;  5CMM A;  5I2N A;  2VP1 A;  4EXL A;  2I3V A;  2PT2 A;  2WX9 A;  5ET5 A;  1BLF A;  1POT A;  1J1N A;  2X7Q A;  1Z7M E;  5B70 A;  2I0C A;  1FSA A;  1NV4 A;  2A5T A;  1JW4 A;  4MEV A;  3UP9 A;  1SPI A;  4RXL A;  3ISP A;  1M5C A;  3SEX A;  4C1U A;  4GWW A;  4G4P A;  4G8H A;  4OVJ A;  2FHY A;  5BWJ A;  1DPP A;  3UOR A;  3RPL A;  5L8D A;  1VE4 A;  3MC2 A;  4UAB A;  4I62 A;  4NF8 B;  3G3J A;  4JVC A;  5AA1 A;  4OVQ A;  1FBP A;  3T0J A;  4F1U A;  2X26 A;  4X1D A;  2DSF A;  3IK6 B;  5CC2 A;  1FPE A;  2ZYK A;  3R26 A;  1DMB A;  1B52 A;  3PUZ E;  2I4B A;  2I48 A;  4TOZ A;  3G3I A;  3O28 A;  3VLU A;  5LTC A;  3EHT A;  3KJT A;  4E0X A;  3PU5 A;  1D9Q A;  3F11 A;  1KA0 A;  2ZZX A;  1SW1 A;  1XC1 A;  4EF1 A;  4GX3 A;  1N0T A;  3JV9 A;  2QS1 A;  2V4C A;  1MY1 A;  4MLV A;  4C1T A;  4ELP A;  1Y3P A;  2NXO A;  3A3U A;  3OO7 A;  5I57 A;  1TFA A;  3KN7 A;  4GWU A;  2Z23 A;  3MP8 A;  2Y5K A;  2GQ1 A;  1K9Y A;  4H45 A;  4ZE9 A;  3PMX A;  3FUZ A;  4OTE A;  1UIU A;  3OEN A;  4AB5 A;  2XWK A;  2VOZ A;  5I56 A;  4OVP A;  3JYR A;  2QS4 A;  2AL5 A;  4LA9 A;  4L17 A;  3PUW E;  5H8Q A;  4YB7 A;  3E13 X;  1RDY A;  3SZP A;  4YKI A;  4LP2 B;  4F29 A;  3T9V A;  3ECR A;  4Q8R A;  1EZP A;  1B3L A;  1TWY A;  2RIN A;  1KZ8 A;  3OEK A;  4IGR A;  4U22 A;  1NNP A;  1URD A;  5ICQ A;  2KLF A;  3BBR A;  5JTY A;  3VVE A;  1GTK A;  2NWJ A;  1FPB A;  3PPQ A;  4KYE A;  3MVW A;  1KWH A;  2B4M A;  3MBP A;  3RN8 A;  4LAT A;  3Q26 A;  4XIG Q;  4TQU Q;  4OHN A;  3USD A;  4U1Z A;  2THI A;  3IJO B;  2M8C A;  4JWY A;  1S7Y A;  4RPO A;  1Q35 A;  1I6A A;  4P0I A;  4KQP A;  4OXV A;  2OLB A;  1H44 A;  1AL3 A;  4OEN A;  2DWA A;  4KHZ E;  3V8X B;  4QHQ A;  1ZBM A;  3B6W A;  2HCA A;  4DI4 B;  3C34 A;  3TYH A;  1B1X A;  5AA2 B;  1KA1 A;  3KZG A;  2DE4 A;  3HO7 A;  2HXW A;  5IKB A;  5FTH A;  4ZED A;  1LBV A;  1N7X A;  4P47 A;  4GXA A;  3SKP A;  1LLS A;  1OQG A;  1Y1M A;  2Y7W A;  3H6T A;  4N6K A;  3RGY A;  4WXJ A;  4X48 A;  1BK4 A;  4OQO A;  4H1X A;  2XXR A;  5H8H A;  2R71 A;  4FEC A;  2ONS A;  5ICT A;  4QBA A;  4ELR A;  4GBV A;  2F6P A;  1UTB A;  1ATG A;  5CI5 A;  2REG A;  3UIF A;  2WYP A;  4JWX A;  4RNS A;  1A8E A;  1M5B A;  3BKI B;  4NF5 A;  3TZA A;  3QYT A;  3HHG A;  1NH8 A;  1N3W A;  3CR9 A;  3L6G A;  4GF8 A;  4JWO A;  4R9G A;  4P56 A;  1NUY A;  5EYG A;  4N8Y A;  3R6U A;  1MG1 A;  4G61 A;  5I59 B;  4JSD A;  2VHA A;  1NV5 A;  4X04 A;  3C32 A;  4P3L A;  2XXI A;  1LBX A;  3FJ7 A;  1FTM A;  4R6K A;  3BIG A;  1BTJ A;  1JNF A;  1YCJ A;  4EUO A;  2R6G E;  5JK4 A;  3HPI A;  1QUL A;  2VPN A;  1LST A;  3ZKK A;  3PMV A;  4R2F A;  4R74 A;  1UTH B;  4O7M A;  4GWO A;  2FA7 A;  1LBZ A;  4NF4 A;  1R9L A;  4PBH A;  3DEL B;  5F7V A;  4H8I A;  1NKX A;  1IMD A;  4QSC A;  3KC1 A;  3E78 A;  3CHG A;  4DLD A;  1MM6 A;  2HQ0 A;  1H3D A;  3FV1 A;  2VPO A;  2XWO A;  4KXP A;  1RKM A;  3SEV A;  4XEQ A;  1NV3 A;  2ZNS A;  3N94 A;  4PDH A;  3GLB A;  2X7P A;  3QXM A;  2ZZW A;  4GVO A;  2JJK A;  1N3X A;  3K6U A;  1IME A;  3Q28 A;  3WAE A;  5ELV A;  1MXZ A;  2F36 A;  2CZH A;  3LUZ A;  3VLW A;  1MXV A;  1DTG A;  5M2V A;  1SVX B;  3IR1 A;  5H8F A;  4IB2 A;  4BDL A;  1II5 A;  4GL8 A;  3PUX E;  2GRV A;  5HPQ A;  1URS A;  4E0W A;  5DEX B;  5AA2 D;  1EU8 A;  3RLF E;  1FPD A;  3UN6 A;  1FJ9 A;  1JVY A;  4IO6 A;  1LBW A;  3K02 A;  1BKA A;  5CMB A;  4HXV A;  1GVC A;  2ZYN A;  4R2B A;  4NTL A;  4H5F A;  3FVN A;  3S9N C;  3HHF A;  3O29 A;  2OJT A;  4OVR A;  4MLQ A;  3L6H A;  1IIT A;  3HV1 A;  1IXH A;  1B05 A;  1JP4 A;  2A5S A;  2PBW A;  1NI9 A;  1IXG A;  1R9Q A;  3W9V A;  1IUD A;  1K9Z A;  3GYY A;  2MKZ A;  2XXX A;  1LBB A;  3A3C A;  5TPA B;  3FVG A;  4FOR A;  3RTF B;  5LDZ A;  3LR1 A;  4F3G A;  3U65 A;  1NUX A;  2ONK E;  4ZS9 A;  5EHM A;  1M5D A;  1B3G A;  2UVJ A;  5IZ3 B;  3OXN A;  1AWB A;  4KD5 A;  5EHS A;  3B6Q A;  3U8Q A;  4LON B;  1SD3 A;  3AXF A;  5ESY A;  4EXK A;  2RCB A;  1LBC A;  2QL3 A;  3D4C A;  1JW5 A;  3S9M C;  4XTC Q;  3TKD A;  3OD7 A;  2HAV A;  2QS2 A;  4O7I A;  1B32 A;  2V3U A;  3GZG A;  3CSB A;  3EHU A;  2H25 A;  1FQE A;  1INP A;  2PMS A;  4YB5 A;  2XXK A;  3K1N A;  3RPW A;  2Q8J A;  2I58 A;  5KDT A;  1LFI A;  3CFL A;  3K6X A;  4PF8 A;  3M3F A;  2AIX A;  5EQA A;  1SW2 A;  3VV5 A;  5DYH A;  5L9M A;  2P3N A;  4R6H A;  2Y7I A;  1YTV A;  4RY1 A;  3T1B A;  4MFI A;  3IO6 A;  3E9X A;  4HS7 A;  3RNN A;  4F1V A;  3FAT A;  5K2X A;  1DOT A;  2Q2C A;  2Q9T A;  4H6D A;  1IMA A;  1MXY A;  1QUK A;  1YYZ A;  1ZKB A;  1EYJ A;  4KI0 E;  5B7D A;  5HBC A;  2Q89 A;  3PTY A;  2XXP A;  2PT1 A;  4BDM A;  4MNP A;  4IGT A;  3FVO A;  1SI0 A;  3MVY A;  1SYH A;  1JVX A;  4OEV A;  3IOR A;  1TT1 A;  1FQB A;  1L5T A;  4RK2 A;  4OAN A;  3MPK A;  4F1Y A;  1A55 A;  2ZNT A;  4QXD A;  4MNC A;  1Y4T A;  1I6Q A;  3I6V A;  2O68 A;  3K1M A;  1HSL A;  5KCJ B;  4ZZE A;  1B5J A;  2GHB A;  1OMP A;  2KQZ A;  2H5Y A;  5IM2 A;  1B9J A;  5LOM A;  3U93 A;  3U72 A;  3WAF A;  2HAU A;  3I3V A;  1VSO A;  3C35 A;  3LSX A;  4R73 A;  4NWD A;  4DDD A;  2VGQ A;  3K4U A;  4ZEK A;  2DVC A;  4R75 A;  1MQG A;  3K00 A;  1XI6 A;  4MAG A;  4EDP A;  4GRK A;  3FAS A;  2YJP A;  5AA4 A;  4ZEI A;  3O6H A;  2DQV A;  3IAZ A;  4YKK A;  4R6Y A;  1FRP A;  3RT6 B;  3IOU A;  3E79 A;  5CM6 A;  2AL4 A;  1P1Q A;  4G2Z A;  1US4 A;  2XWI A;  4JSO A;  2Y7K A;  1MXU A;  2V3T A;  3N26 A;  4EF2 A;  2DS9 A;  3H3G A;  3MW0 A;  4KPT A;  1POY 1;  4FED A;  3OSQ A;  3FVK A;  2PYY A;  1H76 A;  2ZMB A;  3V5A A;  2O7U A;  5I58 B;  4ZEB A;  2W7Y A;  1TFD A;  5EYF A;  4TLM B;  5BUU A;  1LAF E;  3TQL A;  2DP8 A;  2CMO A;  3G3F A;  4PGN A;  1ANF A;  2XXY A;  5AA3 A;  1P1U A;  4RA1 A;  4GFR A;  4HTG A;  3ZSF A;  2H99 A;  4OET A;  1LEV A;  3DP8 A;  4I3E A;  2DWH A;  4GL0 A;  4IO3 A;  2DE3 A;  1PC3 A;  1BIY A;  3LBS A;  2Z8D A;  4U2R A;  2ONR A;  3IFC A;  1H45 A;  1O64 A;  4N81 A;  4OZ9 A;  2REJ A;  4NHB A;  5ITP A;  1VDW A;  1WDN A;  4N15 A;  2HPG A;  4IO2 A;  2UYE A;  1N76 A;  4F22 A;  1XT8 A;  2I4C A;  2F3D A;  4PGP A;  3UGW A;  1Z7N E;  2ESN A;  2QMX A;  3EHS A;  4YU0 A;  4EQ9 A;  1LCF A;  1RDZ A;  1MQD A;  1LGB C;  4F31 B;  1ZIU A;  2UXA A;  3FV2 A;  1XS5 A;  3CFZ A;  4FAT A;  1ZMG A;  2Q2A A;  1SBP A;  1JEU A;  4FE8 A;  1FTO A;  3C4M A;  4P9K A;  3OSR A;  4XF5 A;  3EN3 A;  3A09 A;  4F3S A;  2XD3 A;  3FXU A;  3KG2 A;  1B3F A;  1I69 A;  1FPF A;  3RYD A;  4DCX A;  2UVG A;  4ESX A;  1RYX A;  3KFM A;  3CIJ A;  4LQ2 A;  2OWZ A;  3KSJ A;  5CBR A;  1FBF A;  3P7I A;  3MZ1 A;  5I2K A;  3T9U A;  4QFN A;  5IZ1 A;  4GWY A;  4ND9 A;  4N17 A;  1ZTY A;  3VXC A;  4G68 B;  3TEL A;  2XX9 A;  1B0H A;  4IO4 A;  2F6G A;  4POX A;  2F5X A;  1FBG A;  5DVF A;  1EYI A;  3IJX B;  1IEJ A;  4ELQ A;  4NMY A;  3RTW B;  3TQW A;  2FIE A;  3IFA A;  4N8G A;  2Y5L A;  5H8N A;  4F3P A;  1XOC A;  1MDQ A;  1XHY A;  3O97 A;  2HFB A;  4NF6 B;  3KN8 A;  3RQT A;  3VLV A;  4PFB A;  4F3B A;  1NNF A;  5EQ9 A;  1FQF A;  3KC0 A;  4GD5 A;  3T22 A;  1USY E;  4MX6 A;  1ZU0 A;  2H98 A;  3B7D A;  1AIV A;  5F24 A;  5DTB A;  4H0W A;  4QRZ A;  4OA4 A;  4ESW A;  2H9B A;  4XKQ A;  5L9O A;  1MPC A;  3O9P A;  1B7H A;  5KCJ A;  3QK6 A;  1QW0 A;  1MY2 A;  2Z8F A;  4O3C A;  5A5X A;  3MYU A;  1FCK A;  1FBE A;  1DSN A;  5TP9 A;  4K3F A;  1QUI A;  4OVT A;  3BFT A;  2XXH A;  1SI1 A;  1PB7 A;  4MH5 A;  4GX6 A;  3HCQ A;  3TCF A;  4H8J A;  2YPN A;  1OIB A;  3K01 A;  1BP5 A;  3PGF A;  1FTJ A;  1Y3Q A;  4PTK A;  2O51 A;  1JQF A;  1B58 A;  3MST A;  4YAH X;  4DE8 A;  4NF8 A;  1HSE A;  2RC8 A;  2B4L A;  4FJP A;  2Z8E A;  3GXA A;  3M3K A;  5DT6 A;  1YXI A;  2Q74 A;  2O69 A;  4PFW A;  1NV2 A;  4MBP A;  1GGG A;  1MH4 A;  4LN5 A;  2FVZ A;  1QGX A;  3N5L A;  5JEI A;  1LFH A;  5I2N B;  5EQ7 A;  1NNT A;  1NUW A;  4PFI A;  4OER A;  3PPO A;  3K6V A;  4JVI A;  4OFL A;  4DZ1 A;  1PDA A;  1B4H A;  4RJZ A;  2F7A A;  3RPL B;  2O84 X;  3ONM A;  3KJ7 A;  4O8M A;  5FTI A;  4FAJ A;  1N84 A;  1RDX A;  2XXQ A;  4PC9 A;  1DCU A;  2DXY A;  4YIC A;  1IMB A;  2UYF A;  4X8R A;  4F19 A;  3K1P A;  4XKP A;  4ECF A;  3EF7 A;  1Q9D A;  2Y7P A;  4XFE A;  4U23 A;  4JB7 A;  4UA8 A;  3PUY E;  3H6W A;  3NOH A;  2FIX A;  1MPB A;  2IEE A;  1JET A;  3SEU A;  4PFR A;  4YKP A;  5L9S A;  4I3Y A;  4PET A;  2G29 A;  4XXU A;  4JXI A;  3C31 A;  3ILU B;  5I57 B;  2R9J A;  4LZ7 A;  1IMC A;  1NH7 A;  5TU0 A;  3W9W A;  2XX7 A;  4GIZ A;  1H43 A;  4GQO A;  1IQ7 A;  3M8U A;  2HZK A;  4IY6 A;  5I56 B;  2ZZV A;  3IOV A;  3O66 A;  1SYI A;  2YLN A;  1GV8 A;  3M3L A;  5H8Q B;  1NNK A;  2DDK A;  2I0B A;  3LSF B;  4YB6 A;  2HZL A;  4MIJ A;  3DM0 A;  4GWS A;  5IAI A;  2XXU A;  5H8S A;  2V3Q A;  2XA5 A;  3QUF A;  4WED A;  3CFX A;  5AA2 A;  3H6V A;  1B3H A;  5JTY B;  5DVI A;  1A8F A;  3BFU A;  3PPR A;  3MJN A;  3DP4 A;  1MXX A;  3T9H B;  1M5F A;  3VFJ A;  4F18 A;  3B50 A;  1NFT A;  1D9Y A;  1IMF A;  4MJO A;  2RCA A;  2I3W A;  4QSE A;  3MUQ A;  1YAE A;  5DVJ A;  1LAG E;  1NMU A;  1MM7 A;  4NED A;  4O3A A;  1CNQ A;  3TOD A;  4R9F A;  4P0G A;  5ITO A;  1PBQ A;  4AS5 A;  3ILT B;  2I6E A;  3B6T A;  2OCU A;  5J16 A;  4DI3 D;  2D3I A;  3RT8 A;  2GFE A;  4F2O A;  4H46 A;  4ZZA A;  1OQH A;  4HCY A;  2DVZ A;  3QMF A;  5I59 A;  1SQY A;  4I1D A;  2F97 A;  1D3K A;  3ZKL A;  5FHM A;  4Z7E A;  3K6W A;  2CZI A;  4NF0 A;  4PBQ A;  4MNI A;  4U4S A;  1MQI A;  1QJM A;  2F78 A;  3LSW A;  1FQA A;  5A5L A;  1RYO A;  2OK2 A;  4H65 A;  1UTB B;  1LAH E;  4YMA A;  2V84 A;  3FGS A;  3E4R A;  1NL5 A;  4NF5 B;  2B3F A;  1UTH A;  1QKB A;  4NQ8 A;  2QVR A;  1O63 A;  4POW A;  3MP6 A;  3MVX A;  3IL1 B;  1FJ6 A;  3K0V A;  4LQ5 A;  3MAM A;  4MHF A;  2Y7R A;  1USY H;  3FZV A;  3LUY A;  4N13 A;  3S4U A;  4F39 A;  2ANJ A;  1YPN A;  3W15 C;  1MQH A;  3LSL A;  4NAP A;  4XKN A;  2NVU B;  4Q0C A;  2Q88 A;  2CZK A;  1A40 A;  1FQD A;  4PQJ A;  3CG1 A;  1ELJ A;  1NV6 A;  1Y1Z A;  4OFO A;  3VDF A;  3G3K A;  2I49 A;  2VT5 A;  1B4Z A;  3I5O A;  4PFY A;  4ISU A;  3PPP A;  1XVX A;  4PFU A;  3IX1 A;  2CEX A;  1Q1K A;  4QFP A;  3QSL A;  4FBP A;  1FTL A;  1MXW A;  3Q29 A;  4G8N A;  4NGU A;  3RY3 A;  2Y84 A;  3FXQ A;  1FBH A;  3KOT A;  5IZZ A;  1MY0 A;  3S2V A;  4ONY A;  1URG A;  3UA8 A;  1FQC A;  4N4U A;  1G0I A;  3SEY A;  4KYD A;  4NF4 B;  1B46 A;  4P8B A;  5DEX A;  4BDQ A;  3H7M A;  1VFD A;  1F9B A;  4DCY A;  1ZJL A;  3CRB A;  2QS3 A;  3VVF A;  2OWT A;  3TTL A;  2CEY A;  2QMW A;  2XX8 A;  2WBB A;  4U1O A;  3VXB A;  2QJE A;  3HFU A;  4AQ4 A;  3H6U A;  4IO5 A;  1B6H A;  3A29 A;  4XKR A;  2FNC A;  1VR5 A;  2O1M A;  3V83 A;  3C9H A;  3TTN A;  1US5 A;  3PD9 A;  3S9E A;  1QKA A;  3O6G A;  4M4G A;  4KFQ A;  4P1L A;  5H8F B;  5K2Y A;  1LCT A;  3TCH A;  4IR8 A;  4EQB A;  5DW8 A;  4IY5 A;  3MZB A;  4PCD A;  5TPA A;  2ABH A;  2ZYM A;  4YZZ A;  1MQJ A;  1NV0 A;  2DYX A;  2OBG A;  1B7U A;  1MDP 1;  3C33 A;  1FTK A;  4Q5T A;  3V89 B; 
#chains in the Genus database with same CATH homology
 1FTA A;  1FPK A;  1JP4 A;  5IZ3 A;  1NI9 A;  3MYU A;  3W9V A;  2HHM A;  1FBE A;  1K9Z A;  2MKZ A;  3GYY A;  4NX1 A;  2PFY A;  4OVT A;  1FPL A;  5LDZ A;  3BIH A;  4I40 A;  2QFL A;  3U65 A;  1NUX A;  4GX6 A;  4PE3 A;  1DK4 A;  5FBP A;  4PAI A;  4JVD A;  5IZ3 B;  4MMP A;  1AWB A;  4NN3 A;  4PTK A;  5EQ8 A;  3MST A;  5ESY A;  4HE0 A;  5J1D A;  2B4L A;  2WX9 A;  5ET5 A;  1YXI A;  1FBC A;  2Q74 A;  1FSA A;  1NV4 A;  4MEV A;  1SPI A;  4O7I A;  3ISP A;  1FBD A;  4GWW A;  2FHY A;  1NV2 A;  3RPL A;  2QVU A;  4LN5 A;  2FVZ A;  1QGX A;  4UAB A;  3B8B A;  1INP A;  4JVC A;  5EQ7 A;  2XXK A;  4OVQ A;  2XWV A;  1FBP A;  3T0J A;  4F1U A;  1NUW A;  4PFI A;  4MCO A;  4JVI A;  1FPE A;  4PF8 A;  5EQA A;  3RPL B;  5LTC A;  1D9Q A;  4O8M A;  2ZZX A;  1KA0 A;  5ET6 A;  2PFZ A;  2P3N A;  1RDX A;  4PC9 A;  1DCU A;  3T1B A;  4GX3 A;  4YIC A;  4F1V A;  2V4C A;  1IMB A;  4X8R A;  4F19 A;  1FPJ A;  2Q9T A;  1IMA A;  1YYZ A;  4GWU A;  1EYJ A;  2Y5K A;  1Q9D A;  4OVS A;  2GQ1 A;  4XFE A;  4P1E A;  1K9Y A;  4H45 A;  3PTY A;  4X9T A;  2OX3 A;  2XWK A;  3NOH A;  2FIX A;  4MNP A;  4PFR A;  4I3Y A;  4PET A;  4OVP A;  1LBY A;  2QVV A;  3FXB A;  1IMC A;  4OAN A;  1RDY A;  3SZP A;  3EKI A;  1DBZ A;  4QXD A;  3W9W A;  4MNC A;  4HE2 A;  3ROJ A;  1KZ8 A;  2HZK A;  1NV7 A;  2ZZV A;  2KQZ A;  5IM2 A;  1FPB A;  2DE2 A;  2DDK A;  2QPQ A;  4N6D A;  2HZL A;  4MIJ A;  4GWS A;  2B4M A;  2WEF A;  2V3Q A;  1XI6 A;  2XA5 A;  2WBD A;  4MAG A;  4GX4 A;  4PDD A;  3LV0 A;  1EYK A;  1FRP A;  4AS4 A;  4O94 A;  3E79 A;  4F18 A;  5CM6 A;  3B50 A;  2XWI A;  4DI4 B;  1IMF A;  3KBZ A;  2FBP A;  4MJO A;  1KA1 A;  3D1R A;  2DE4 A;  1LBV A;  1CNQ A;  4P47 A;  2WYK A;  4N6K A;  4AS5 A;  1BK4 A;  5ET8 A;  5J16 A;  4DI3 D;  4QBA A;  4PGN A;  4GBV A;  2R8T A;  4H46 A;  4HCY A;  2DVZ A;  3QMF A;  2WYP A;  1LEV A;  4I3E A;  2DE3 A;  2CZI A;  4NF0 A;  4PBQ A;  4MNI A;  4PAF A;  2HXR A;  3IFC A;  4N81 A;  4NHB A;  4P56 A;  5A5L A;  1VDW A;  1NUY A;  4GWX A;  5EYG A;  4N8Y A;  2BJI A;  4G61 A;  4GWZ A;  4N15 A;  2HPG A;  1NV5 A;  4X04 A;  4P3L A;  2F3D A;  4PGP A;  1LBX A;  4M1V A;  4PF6 A;  4NQ8 A;  2QVR A;  3BIG A;  1RDZ A;  1FJ6 A;  3FBP A;  4MHF A;  5JK4 A;  5I5P A;  4NAP A;  2VPN A;  4N91 A;  2CZK A;  1NV6 A;  4P9K A;  4O7M A;  4XF5 A;  2VT5 A;  2KR0 A;  1LBZ A;  5T3J A;  5IGA A;  5ET7 A;  1G0H A;  4PBH A;  2CEX A;  4FBP A;  1IMD A;  1FPF A;  1FPI A;  3RYD A;  3KC1 A;  3E78 A;  4NGU A;  3CHG A;  2OWZ A;  1FBH A;  1FBF A;  5IZZ A;  2VPO A;  2XWO A;  4KXP A;  5IZ1 A;  4GWY A;  5I7I A;  4N17 A;  2L5V A;  4N4U A;  1G0I A;  4XEQ A;  1NV3 A;  4PDH A;  4P8B A;  1NV1 A;  2ZZW A;  2JJK A;  1IME A;  2F5X A;  1YZ0 A;  1FBG A;  1EYI A;  2CZH A;  3LUZ A;  2CEY A;  2FIE A;  3IFA A;  4N8G A;  2Y5L A;  5EYH A;  2WBB A;  3HFU A;  3A29 A;  1FPG A;  4PFB A;  1FPD A;  4HE1 A;  2Q8M A;  1FJ9 A;  1LBW A;  5EQ9 A;  3KC0 A;  4GBW A;  4P1L A;  5I3S A;  4HXV A;  4IR8 A;  5DW8 A;  4MX6 A;  4PAK A;  1NUZ A;  4PCD A;  2F3B A;  5F24 A;  4HCW A;  4YZZ A;  2P3V A;  1NV0 A;  4OA4 A;  2PCR A;  4OVR A;  4NG7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...