4P49A

The structure of a chicken anti-prostate specific antigen scfv
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
243
structure length
226
Chain Sequence
ALTQPSSVSANPGETVKITCSGSSGSYGWYQQKSPDSAPVTVIYQSNQRPSDIPSRFSGSKSGSTGTLTITGVQAEDEAVYYCGGWGSSVGMFGAGTTLTVLGAVTLDESGGGLQTPGGALSLVCKASGFTFSSYAMGWVRQAPGKGLEWVAGISDDGDSYISYATAVKGRATISRDNGQSTVRLQLNNLRAEDTATYYCARSHCSGCRNAALIDAWGHGTEVIVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antibody scFv B8
publication title Reconciling the structural attributes of avian antibodies.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Immune system
total genus 59
structure length 226
sequence length 243
ec nomenclature
pdb deposition date 2014-03-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4p49A01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4p49A02
4LCYA 3O3BA 5IBLD 2VQ1A 5LWYL 3LHPL 1YNTB 1KB5L 1AGCA 5HYIA 3OKNA 5FM5O 1JNHA 5IB3B 1CDCA 4TUJB 5B4MD 3TLRA 5HI3C 5IBTH 4DOHB 3V0AC 5DQDH 2R8SL 4M7JH 3MV8A 1KCUL 2IC2A 4ZNEE 1XF3B 4OGYL 3BEWA 1IGIH 3BFOA 5F3BB 3GSQA 5C6TH 4KUZL 4M6NL 5CEYA 5C6WH 4KHTL 4JY6A 1FG2A 1AXTH 4FXGB 1VGKB 2EDNA 5SWSA 4WFFD 4PLKC 3OKMB 3I2CH 1KPVA 2ZUVA 1MCNA 1U8HB 5E9DE 3BZFA 1P7KA 1N26A 4HIEA 3TM6A 3RDTB 3PWLA 4I18A 4KROB 4TN9A 4X98A 1ZHKA 5E2JA 2AXFA 1V8HA 4H88L 5C0RL 5ICXB 4JY5H 3R0NA 4N1EA 4RMUA 2FGWL 5CGYD 4LMQI 3L7EB 3GSVA 3SCMD 4H8WC 2R0KL 2XACC 4JM2B 3QEUA 1TLKA 4WEBH 4AIXA 3OSKA 1A1MB 3V4UL 5MEOB 3DX7B 4DTGH 1LDPH 4KJWC 3E6FB 4HIJA 1CFTB 4PUBL 1J8HE 5BS0A 3L1OH 3QP3A 3SJVB 4L9DA 1BFTA 3RRQA 3MV9B 3MROA 3KYNB 1Q9LB 1XEDA 4MCZB 5CBAA 4WO4A 2BRRH 2KDGA 1T1XB 2WQ8A 4KRPB 1QEWA 3IU3B 4NQVA 3WIFA 3HNSL 4ZSOB 5IVZA 4NNXB 2VLRA 1T7ZA 3PWPD 1UCBH 4P2QE 4ZUWA 1AGFB 4QRSB 2EEAA 4M62L 1UYWH 1D5MA 2YA0A 2HMIC 1MFAL 3STLA 3TO4D 3QAZB 1JPTL 1UZ8A 3AAZA 3S97C 3SDCC 2NXYD 4K9EL 4K8RC 1X5GA 2MKLC 5FUZL 1U91A 1DQTA 1CIDA 4H0IA 4HAGA 3QQ9D 3KLHC 2QR0A 3BSZL 3ZTNL 1SY6L 2JE8A 5AWNL 4PJAF 3OWEA 4Y5VA 3DO7A 3LMJL 3OAZH 5IW3A 1VKXA 4PJFB 2A9NL 4IRSA 2JCCA 2HAZA 4LOUD 1UM6L 4NWTH 2DD8H 5DUML 5JW3H 5KVFH 1FNAA 3ZDXE 3S37X 3BP7A 5FKAB 1BBDH 1T03L 3DV4B 1U8MB 2QKIB 1YY8A 4MD4A 1B0RB 1Q38A 3IFPB 1GZQB 5LQBL 3TT3H 1KIPA 2XFXA 4PB0H 1GC1H 2XRAH 3RWIA 1SYSB 4U1IA 4WJ5B 3O8XC 3HNVH 3U82B 4KJYA 1I1AA 4OLYL 5E4EC 5HPOA 1LE5A 3VH8A 1ONQA 2D03H 1UWXH 2Q6WB 4OB5L 5EB9A 5ELIA 1DSFH 2ZJSH 4JFPB 3TBWB 1UZ6E 2KUTA 2VIRA 1JVKA 5C0GA 2DQGL 2OL3L 1XF4A 1KJ2H 1CK0L 5IEKB 3IJSA 1U95B 3TH2T 2IAND 2IPUK 1R24B 5DRXB 4BKLA 4PRHE 1BIIA 3B6SB 4OCWL 3CSGA 4ZODA 2GY7B 4PJ9A 5J06A 1DBBL 2XY2A 4XCFL 4XTRD 3FT3B 3RX7A 3CZFA 2F53D 1A4KA 4ELMA 2IFGA 3LH2L 3AY4A 4Z6AT 3T77B 3KPSD 2EKSB 4FXKB 1G6VK 5EU3B 1FGNL 2X1PA 1X3DA 2NZ9C 1DE4A 3V5DB 4GW5A 4NKMB 3VFGL 2DQEL 2PNDA 4NSKB 5D2NE 5JIKA 4QXUL 3U9PL 5DEZA 4S1DC 3OB8A 3KHOA 5EZIL 4WEUD 2WP3O 3D5OF 5CJOL 1CDGA 1KT2B 2B4CL 3BZ4B 4OM1L 1KCSL 2ED9A 1YY9C 1AHWB 1KB9J 1F3JB 2DKMA 3V52L 1EGJH 4Y5YA 2APVA 3C5ZB 5I6XB 4ZFFB 4IRSC 5IM7B 4DOHE 3F6LA 1ZXQA 2NY3D 2OI9B 4NHUA 3MLWH 5CD5C 1KJMB 1NDMA 2P8PA 1ZA3B 3BPOC 3INUL 2W60A 4FXLA 2EC9U 4CVZA 1IT9L 4KKBC 4CJ1A 3WKMH 1EFXA 4OZIE 3ARBD 2LFGA 2EC9T 4G6KH 1NFDE 4JN1L 4WI2A 2HT2C 1CLOH 3IJYB 5HHNA 4PJGB 3HG1B 4L4VA 4XP1H 5TJWK 5C0ND 5BVJA 1BD2E 2D0FA 1FO0L 1HCVA 3CNKA 4QTIH 5T3ZH 5H37H 4CVWA 5DJ0A 1IFHH 1RUPL 1UG9A 3EOBA 4OKVA 3MRDA 1AD0A 2HWZL 2XZZA 3ULVE 1MIML 3QDJD 4PRID 1XIWD 2VDNL 3TO2A 1LE9B 1OF2B 2KPNA 4M1DH 4BYHA 4MQXC 3MCKB 3C87A 3CDFA 5K9OB 1FYTD 3MRKA 5TFSL 3BH8A 1ZT1B 5FOBB 5CILH 5DURB 3L7FA 1L7TL 4C59B 1YNKH 5DD3H 5MI0B 1HXYA 1M7DB 3BD4A 3O6KH 4OZHE 2K7PA 3WNMA 1YECH 3QUYD 3MA7B 5SWQA 4JFFE 4WI3A 1QBLH 3BISA 3HAEG 5IOPA 1I3RB 1NMAH 1RZIA 5EC2A 4NZJA 3QUMB 2DTMH 4KKLC 3BI9X 2P24B 1YMMB 1MCRA 4KTEH 1ZVYA 2R1XB 5C0JB 4HIXL 3BT2H 1QFHA 3IFLL 3TWCH 3R0MA 4ZSOE 3HE6C 1IAII 5EDXA 2BCKA 3AS0A 5D5MF 3VFTB 3VGFA 4PJDB 3MRRA 4HMDA 4UV7H 4XNMA 1EGJA 2XZAH 3NCBB 3W39A 3MRCA 1BVLA 2OYPA 4O2EB 3RL1B 5DJXB 5HDLA 1BEYH 2ZSWA 5DTFA 3U6RB 5IV2A 3O11A 1SHMA 5EU5A 3UYRL 4LSQH 4I3SH 1UC6A 3FN9A 3KPOA 4GAGH 4BSVB 4YPGA 1XR9B 3H3BC 3Q6FB 1VFBB 4LVOB 4DW2L 1M1SA 3SHSA 2FIRT 1Q8MA 4Z77A 5EG6C 4M8VA 5CFHA 1JBJA 4LAJH 2XQBH 4JG0L 4Z7QF 1XMWA 5MEND 4KRMB 2MHAB 2JKXA 4Y5YC 1IKNA 1FL6A 3VGAC 2B1AL 2F5AL 4G9FA 5IJVB 3T2PA 5FHBH 2IBZX 1TVBA 2ZG2A 1MCOL 1PDKA 1F90L 4GG8A 4I9WE 2ZCKH 1T66D 4Z0XB 5I1IH 1I1FB 3OTTA 4M7LH 5TGBB 1N4XL 4AL8L 3H9HB 3ZYOA 4YQXL 1U0QA 5EORH 4HK3N 5ICZB 2Z91B 4Z0BH 5TPWL 1Q9WA 4XHQA 5IB2B 2FYYA 4YX2L 4GW4B 2G75A 5KVEL 2FEEL 2X7LB 3ARGD 3X13A 5C07A 2DS4A 3TNNA 4Z5RA 1I7TB 4D0CA 1Z5LA 1HH9A 5I8CB 1FDLL 1RK1B 5E08H 3GK8L 3BOVA 2YMXL 5IROA 1EV2E 2XWJA 2ZUUA 1CU4H 1JV5B 2BVYA 3GZKA 5CSZB 2BVUA 3KS0H 5HI5D 2ZCLL 4KK6D 5IK3B 3WFHB 1MCJA 1PYWA 5IMKA 4X83A 4XNYH 5I76B 1FZOB 3QYCA 1LEKB 1KNOB 2X70B 3SE4A 3CVHB 3MMEA 1HDMA 3P30H 3UAJC 3RGHA 1P4LA 1YEKL 3NACL 1NCTA 3OHXA 4FN0A 4OKDA 1F11B 2XN9A 5GGQL 4KXZH 3U0TA 2VLKD 1U8PA 4NGHL 4V2BA 3CDGA 5CSGA 4DN3H 1QFWL 2BOCB 4KK8C 1JN6B 3NCJH 3TVMC 1EHLH 5CS7A 4LPXA 2D7MA 4M5ZH 2GY5A 3CAFA 2YBRA 1U8OA 6CGTA 1W0VB 5GS0H 1MJJB 3O41B 2EDFA 1A3RL 4ZTOL 3VG9C 5FEBA 4E0RA 4Y19A 3V6FB 3NABL 5DZNA 2AJSH 5I8EB 4GXUM 2BERA 1E4WL 4ZQKB 4UUJA 3UTQB 3VWJB 3O3UN 4P9ML 2BFVH 3MREB 3JXAA 4J7RA 4JRWA 4D94A 4KPHL 1U58A 4QHNA 2W9EL 4PGBA 3RNKB 1II4E 2HT3D 4FA8A 2DQUL 3C6SA 1IKNC 5EOCL 3P0VH 3Q6GH 3NH7L 4FQQB 1RUAL 1D6VH 1CDUA 1VDGA 2HA1A 2Z31D 3MNZA 1A6UH 4GBXB 5F3HB 3ROOA 4FTVD 4JQVA 1I3UA 3UROR 5I1LA 5A2JH 1C12B 4NBXB 3OXRB 3RA7L 3HG1E 2IPUG 5EU6B 3K2MC 1KN4H 4S1QH 1BHGA 4YAQA 2C3WA 2FJFB 4D9LH 1TJHL 3LQZB 2P46B 1QFUL 1ZT4A 1OQXA 4I48A 1C16A 2ICEB 3SCMA 2I5YH 3O45A 4LDEB 1RU9L 2VZ3A 1YN6A 4YHKH 5I1DA 1ZWIB 1RMFL 3HZMA 3ZKND 3BDBA 2CRIA 2QHRL 2VXSL 2R4SL 3OKLA 2Y06H 3N0PB 4HIHB 1C08A 4XPTL 1FCGA 1FSKC 2HRPH 3EO9H 1X5KA 3D0LA 4PRPD 4WU5B 2Y07L 1ACYH 4NCC1 3BPLB 2YPKB 3F7YB 5DLML 5HDBE 3DPBA 4MQ7A 1MHPL 1A9BA 4GG6F 3FQNB 5IHLB 4U1LA 5ITBL 4PS4H 5IQ7L 1WQVT 3U2SA 2HLFC 4U1NA 3HE7C 3CFKB 4ZPVA 4CVXB 4ODSH 2OR9L 4M43H 2RHEA 4PJDE 3TO4A 3JWOL 1OHQA 3FTGB 4KVNL 1MQKH 5EBWB 1HHIB 2EEBA 1I8IA 3MOBH 4RAVB 5J89A 5IHBA 1JUFA 3MJGX 3TA3B 4WI7A 2HMID 3RKPA 3SKUD 4EIZC 1CIUA 2PKDA 5L0QC 3GJFH 3ME0A 1MHHA 4TPRH 4HXBH 3MXWL 3WUZA 5I0DA 3KXFB 4JQIH 3G6DL 3ARSA 1KN2H 4R8WH 1QA9A 4NUJA 4NT6B 4JZJA 5F7DB 1LNUA 1FBIH 4R9HA 5ITFB 4O2FB 5EZOH 1UEYA 3O2VH 4M6AA 4JZOB 1L4IA 2AEQH 5I8KH 4XGZA 3TBSB 3TV3H 5GGSA 5SX5K 3LIZL 4P5TC 2D0GA 5CLWA 1OP9A 3QO1B 3FOMB 4BSWB 4YHML 1ZVSA 4MA1C 3P0YH 4QRRA 4JY4B 4BQCA 3D2UD 5GGRY 4N9OB 1TCRB 5DHYB 1SYVA 2GFBA 4YHNB 1QR1B 3O4LD 3W9EA 4LLUA 3SGEH 3TPKA 1RUKL 4P2RE 2XXMB 1AR1C 4PTTA 4HX1A 1FNGA 3O8XD 4JZNA 2G9HA 2WQRA 5F7MC 5ILTH 1BIHA 4X4YB 2JLLA 3MGOA 5E1HB 2I26N 3BGFC 4OZFB 3SDXF 3IGAA 5C08B 3ARDD 1C5BL 1NSNH 2W59A 1KB5B 2VXQL 5DJ8B 4JN2B 2DQHL 4XPBL 5EZLA 2J5LC 1F4XH 3IS1X 3WKNA 1KIQB 4GRLC 1ZE3C 5D7KE 5CINH 2K3TA 5HHQA 4XCYB 2DQDH 1RZKC 1FPTL 2F53A 2R9HC 3NCMA 1C5CH 3QPXH 1LHZA 2APWA 5K59E 3H0TA 1EBAA 3KPSA 4LPCA 4JKLA 3GMMB 4ODXB 2LTQC 4L4TD 2QLVB 4JRYE 5IB5A 5EU4A 1MCLA 1OAUL 2EDWA 3HUJB 3FAWA 3MYJA 2PCPB 4U1SA 3VJ6A 1S3KL 5F88A 2X4RA 5BCAA 3MNWA 2HP4A 2GITA 4HAFA 4YHZL 4AZ8A 3QNXA 4M5YH 3T3PE 1D7FA 3GHEH 2CLZA 5KN5B 15C8H 1B9ZA 1E0OB 1X6LA 4M3JA 5H2BB 4DGIL 3BGMB 1W8OA 3QJFB 5B22A 1RJYA 5AD0A 4RZCA 4ENEC 4YXKH 5D93C 1FP5A 4QTHB 1F6FB 1HNFA 4OV6F 2BJML 1YY9D 1Q1JL 2VH5H 1CICC 5DZOA 4N90E 1RJLA 3CFIC 4L9LB 4TQEL 3WO3B 2C1OA 4RMSA 2YD2A 3KPLA 4JFEB 2I27N 5SWZB 2UWEF 3IU4L 4JHAH 1MREH 3W0WD 2CR3A 2E3VA 1E6OH 1JHKH 4YFLI 1JF6A 4P5KB 3QJHA 3N9GL 1LO2L 5C3TA 4EXPX 2ADGB 3QCUH 5J1AB 4QHUA 5E8DL 3NFPB 1UB5A 1MCWM 2HT2D 4MA8H 5DI8A 5IMOA 3L95B 4JPIA 5AUMA 5JW4N 3WDIA 5D1QC 1G7PA 5I2IB 5K9JL 1CG9B 5CHNA 1T0MA 1KBGL 2YPLB 4HUNB 3IJHB 2OK0L 5DVOA 2Y5TB 1JPSL 1MFBH 2YEZA 1UM4H 2AEWA 3QDJA 4G8GD 1XIWA 4PRIA 1FFOA 3VGGA 1W72H 1A7OL 1V7NL 2BNRE 2BHUA 2EE6A 3QXDA 3SKMA 3TIDA 4D0DB 2GTWB 32C2A 5F1IA 2NYYC 2NCMA 4GMTH 1IL1A 1C8PA 4R26L 5J6GA 1ZHLB 2X40A 4P4KB 1D5BB 4HK3J 3GRWH 2EDTA 1X5XA 2SEBA 4JRXA 3B9VA 3RVUD 1H3TA 2DQCH 5BRZD 3DURA 2DLFL 3VCLB 5TE6H 5K9KB 4KV5E 4OCRH 3FQXB 1BM3H 3MCG1 3OPZH 3MBEC 4MB4A 4ZO6A 4QT5B 3ZKQD 1YEFH 1T1ZB 1UH2A 5GGUB 2HH0L 2WMPA 3RGVD 4OGAC 5DVMA 4MJ6B 4NUGH 1SEQH 1YQVH 2EDDA 1KYOK 4KZEL 4GAYA 1AH1A 3ZYZA 2IMMA 3DETC 3ARUA 1UACH 3TZVD 5FM4A 3VMPA 1MEXH 4BFBD 4YZFF 4HHAB 1DBJH 5DWUL 2BY2A 3OJDA 4EI5C 1BP3B 2OL3B 3VXOA 5I8OH 3LSOA 1GAFL 3MV7E 4GG6A 5HHMB 3QH3B 4NO5A 1FFPB 4M48L 4EVNB 5DMIL 1DZBA 3BIKA 4O2CB 1G7MB 3DSFL 1Y18B 4NQDB 1JPST 4HEME 4TOYH 5MENA 3FFCB 3WMSA 4EI6A 3RTQC 1RZ7L 1ZS8A 4L3CA 3T65B 2O5ZH 3FQTA 4X5WB 5CBEB 1YPZA 2EDKA 2FX8H 4M4PA 3SE3C 1ZANH 4GKSA 2B39A 4IOIA 3ARFB 2V6HA 1G7LA 4WVRA 3GBMH 2J8UE 4RFOL 2ITDA 4E41E 4NRYB 5GS1B 2EIEA 1NLDH 3UDWA 2AABH 4HBCH 5GPRA 1P2CA 4L1DA 1CE1H 1DUZA 2VZTA 2A83A 5DD1L 1V3LA 2NPLX 4LAQL 3ZKXC 5GJSH 2BY1A 1OAYH 2E8YA 2UYLA 2XTLA 1IJ9A 3KDMA 3WIHH 4JFQB 1W2KT 4R0LA 4A2LA 5E99L 3WXVH 3HR5B 4KY1L 1P1ZA 1I1CA 2FHBA 5ID1B 3VXUE 1GGBH 3T1FB 4XC3H 1MFEL 5LBSL 1RIHH 5DJZA 1MH5B 3U0PB 1AI1L 1J86A 4BZ1H 5JMRA 3TBYA 1WWCA 4OTXL 3I6LD 3IDMA 2BVQA 5DEFA 4G8FA 2NX5B 4HEPG 4WW2B 3OKOA 3I6GB 3FOLB 1TVDA 4PLOB 3OKEA 4LIQL 2GSIB 2VLKA 2ADIB 5C2UB 3TYGL 5C09D 3TYFA 1IQDB 1S9YA 4PJIE 1FAIH 5CJQL 4KK5D 3SKNA 3L3KB 4XRCA 3D3VE 4CN4A 5EU7E 4QOKD 1FV1A 1FO0B 3SDXA 4Y4FD 1Q0YH 4R3SB 5KSAC 1JE6A 1NMBH 1CFNA 1KCLA 4W4NA 2ICWB 5D7IF 4ZXBC 1HSAB 1WC7B 4L3EB 2L7UA 4TSCH 4ZUVA 3PWJB 1DL7H 2OQJA 1RUQH 4FABH 3SY0A 1NFIA 3DV6B 2FZ3B 3KYOA 2JJUA 3G9VA 2P5WB 4UAOC 3ZE2E 4KAQL 2WP3T 1MFDH 1EAPB 1YEIH 4Q6IA 2EDXA 4LHUG 1UKSA 4NQXB 2M1KA 4I5BB 4ZUTA 3S37H 2WAHA 4C4KT 2OX5A 3TJHD 4QXTB 3ZDZF 4NQUA 5E6IB 3MR9B 2BNUB 4WUUB 1QPXA 4WWID 2VABB 2PXYC 1BX2A 4NQSB 2XWBB 5T3XH 4JHWL 1QRNE 3WIHA 3OAYK 1H15A 2D2OA 1AD9A 3MRQA 3DVNA 4ZD3H 3HA0A 4MNQB 2VJXA 2Z31A 2R2HA 2DQJH 4GRMA 3VWKC 3MLRL 1SMOA 3RWHA 4QRQA 2NW3A 5MP6H 3L3DA 4L8DA 3AXLA 1PG7W 1LO3L 4EN3D 4KJQC 3RWGB 4Y1AD 2PYEB 4OIAA 2E7LC 5B39G 3LQMA 5DUBB 3QR2A 1AR2A 3QEQA 1GZPB 2VR9A 4OV5A 3UCRA 4YHOL 3OB0H 3PJSB 5EIVA 4CADB 3QHFH 3O6FD 3SO3C 4IOSD 3BDXA 1A7QH 1XF2A 3VRLF 4HC1H 3VXSA 5EBGA 3HRZB 1LP9B 3UXFA 4PP2B 1B4RA 4PJ5E 4DKEH 3DUUB 1QKZH 3G04A 1NC2B 1EFQA 1S9XB 4UB0H 2X89D 5LJYH 5KS9F 3AM8C 3MRFA 2X4PB 1P5UA 5D7JC 4PRPA 5F70A 2VMFA 3BPNB 4QF1A 1BQUA 2AJXH 3HFML 3KPPA 4JGMA 4NZTH 5IBTL 1JGUH 5C0IB 5DQDL 4EUPG 3GHBH 2V2TB 3WLBA 4OIBA 2H9GA 3GDBA 2VLMD 3O3AA 5DMGC 2VE6B 3EJZC 1LVEA 5C6TL 4LDOB 4NQEA 5FYJH 2VR5A 5GGTH 1H8SA 4X4XA 5E03A 4NC2B 3I2CL 1J1PH 3MUGA 4MAYC 3FO0H 3K1KC 5E7FA 4WW1B 1WFUA 4JFXB 2OM5A 3WJJC 3WEXB 3R06A 4A2MA 4NRZA 3LKQA 4HJJH 1AY1L 4LL9A 1REIA 4JY5L 1OWRM 4LMQE 1HIMH 2AJUH 4U6VH 4F15C 4LLWB 1OGAE 1I4FA 4RBPH 3R4DA 2EDBA 3V5HA 4HWUA 4DGVH 3AS3A 3VG0H 2HT4D 4Q0XL 3K8LA 3PNWB 4WEBL 2AVGA 1LWRA 2H3NB 4NQDE 4MXWH 5D72L 3O9WB 4DTGL 3VXRD 4MNHB 5MERA 3K7UA 5JIIA 5E1AB 4RGMC 3RIFK 4XBGA 3V95A 4NYLB 3OZ9H 4OF6A 1S7RB 1MCIA 3BE1H 1WFOA 1J11A 3MJ8A 3OJ2C 4MS8C 3CDYA 3P73B 4P5TD 3D18B 5B8CA 2ZUQB 1N7MH 1IEBB 4OCYL 3O4LA 3MUJA 3QDGB 1IZJA 2FEDC 5HGHB 4PGDA 4F7CA 1GJIA 1R3KB 1H5BC 1QSFB 4PR5A 1T20A 3MLPA 1I7RA 2G60H 2NY5L 4XMPH 3D25A 3D85D 3SGJC 4X8XA 3QQNA 3ARDA 3P9LA 5HYJB 5I1HL 4DFHA 5HGBA 3UJJH 3SDDD 1D5ZB 3GGWB 5C8JB 2RB8A 1CDHA 3TNMB 3VFVA 1GRWA 1HEZB 3FL7A 2Q8BL 3BO8A 4WCYL 1P5VA 5HHXH 3LZFL 2MCPH 4XCNA 5A16A 2APBA 4GJTB 3CJJA 2YD6A 2DYPA 3RZCD 4Z7WA 2WUBH 4OCXH 4YBQD 4S0SD 2P5ED 2P8LB 3KLDA 4PJ8A 5ACZA 5JW3L 4C56D 1WWWX 5GISH 1I8MA 4PGCA 4NBYB 3U1SH 5C71A 1JGEA 5F6HJ 1EO8H 3MACH 5D70L 3T09A 1BBDL 2VL5A 2R9HD 5IT2H 4Y4KB 3CH1B 5IVNA 1H0DB 4L4TA 2N7BA 3OKKA 3QFJB 3VXMD 5T1DH 2D31B 3EYVA 5BXFA 5C2BH 1X5FA 3TT3L 4PB0L 1AGEB 1GC1L 4LGRB 1D5XB 3HNVL 5BZWB 3GMNB 2VISA 1AFVH 1Q72H 1AKJD 2A73A 5HGAA 5JDSB 2W1NA 2OSLB 2D03L 2NW2A 1QP1A 3BRGC 1G9NC 3ROLA 1AGDA 3FJTA 3FZUD 4P57B 35C8L 2CRYA 1DSFL 4WWKD 3S5LA 3MV01 2DRUA 3P2TA 2R1WB 4BH7B 3WD5L 4JO3H 1U8KB 1R5WB 2A6DB 4U0QB 4YDVA 3GJFK 5DA4A 4OZGA 5FGBA 1MCBA 3W11C 1JTPA 3UTZA 5ID0A 4HH8A 3OGOE 4R96B 4ENED 4Q7DA 1CFBA 1J0JA 4JAMB 2P42B 1EZVY 1FZJB 4KMQA 1JWSB 3H2WA 4PJCA 3L3OA 4DKFL 4HXAL 1BGXL 3S3JA 1NGZA 1A9EB 3B9KB 1A0QL 5E94A 3W5MA 4IMKA 3R1GH 3B3IA 2X4NB 4RA3A 1SVZA 5B39A 2NXZD 5IJKC 4HKBB 4G8GA 1NAKH 3PWUB 3B2VH 2F8OA 3CFEA 1F8TH 1JGLL 5GGRB 2CKNA 4V1DA 5CZXC 3LB6D 2NY0C 5AAMA 1FVEB 3STZA 5DJCB 3P0GB 2AJ3B 3NN8A 1IAOB 3PWNA 1RFDH 3KPNA 1CR9L 4QRPB 4J4PD 4XVJH 1IGJA 3QIBD 3MODL 6FABH 3MO1B 4PG9B 5BRZA 4R2GB 2B8OT 1EGJL 3FO9B 5EC1B 3UTTA 2F8XC 1UB6B 5C0CB 4ODUA 1O5DT 3GIZH 4YO0A 3IF1A 4NN7B 4BSJA 4AMKL 3U36B 3MLYL 1AP2B 1CLYH 3MLWL 2O61B 4PGEB 1NCCH 3RGVA 3ZE1E 4Y5XA 4DAGH 1CFVL 4EUPA 3G08B 5D7LB 1OAXL 4CDGC 2R39A 1UH4A 1YC7A 4G6KL 3ZLQC 4PD4K 3G6JE 1CDJA 4MDJB 3F7PC 1CLOL 4XP6H 4G9DB 3PWPE 3MRNB 4JO1H 5KS9A 4Y4HC 3PQYE 1OPGH 4QTIL 5T3ZL 4YGVB 1NBYA 1UH3A 4JG1H 2RCSL 3MLXL 4O02H 2J6EA 1RZJL 4X6CF 4JLRA 3IDIB 4AEEA 4FNLL 1HK6A 3FO2A 5A40E 3O3EA 5JW4Q 1Q0XL 3TCXA 3SQOH 2YOCA 1NGXB 2FECI 2NNAB 4RGOL 5GRUH 4M7ZB 4GKZA 3BYYA 4JPKH 5C0AB 1KCVH 4NOFA 4ZFZA 4U3HA 4L8CB 4IRZL 3NZ8B 1C5DB 4P49A 5DD3L 1HHKA 3MSPA 4W6XB 2FJGB 5EFIB 1CT8B 5FGRA 3O6KL 1FH5H 2BDNH 1K2DA 4AEIH 4MLIA 5IMLA 3CXHJ 4ZYKA 4GMSH 4LP4A 1U8QB 1J0YA 1QQDA 1J5OH 3HLAB 4H26B 3RWJB 3SO5A 2DTML 3R8BB 5D5ME 4UTAL 4OLWL 3RWCB 4NQCD 2AXGB 8FABB 1BJ1H 2V7HB 3RAJL 4F58L 4U7SA 4LBEB 1BZ7B 5IF0B 5DF0A 3RDTC 1MCCA 4KROC 5DEGB 4Z7NF 1WBYB 2YSSA 1IKFH 3RUGF 4BFGA 2XI9A 1S5HB 5CEZE 4UQ3A 3VFNB 1I9RH 2R69H 3CFJB 4JKPH 2BSSB 4I0PB 1NLBL 3GO1L 5BOZG 2P7TB 4JM2C 1OWWA 1DUYA 5BO1H 4WUKH 5BVPH 4LSQL 1YUHB 5C0BB 4FFZH 2O5YH 3WFDH 3VFWB 4N5ED 3AREA 4RMWA 5IB4B 2JELL 3WL9A 2BXZA 5FK9B 2H45A 4R4BA 3VA6A 3FKUS 3RIFF 2K1MA 2R4RH 2XQBL 5EO0A 1FVCB 2IANE 2RGSA 3HC0A 5C09A 4EJ1C 3X12B 4KRPC 4GAJL 5CZKA 1MI5E 4XNUH 2Z93A 4LSUL 3HC4H 1JWUA 1K8DA 3H42H 2IADB 4OGZA 3WO4C 2ZCKL 5I1IL 5F6IB 1A1OB 2BSRB 1KENH 1XAUA 1UKTA 3MZGB 4QOKA 1BF8A 4Y4FA 3QUMH 3OX8B 4PREB 5EORL 1INDH 4UZGA 3QA3A 3QAZC 4Z0BL 4U1GB 1MF2H 3EOYG 1XGQA 4CUCA 3LN4A 2XTJB 3EHBC 25C8H 5EUOF 2X6MA 3RQ3A 3DX6B 4G6FB 4R7DA 2DM2A 5C9JB 2UZYB 2R0ZH 5J0BA 2L4OA 1CU4L 1XGUA 2X09A 4X9IA 2D9CA 1BF2A 2QADB 3T0DA 4JKKA 1IGYB 4C57C 3DMMA 3HPLA 2OLDA 2FWOB 4XNYL 4LF3A 3OJVC 4KHXL 1YNLH 3WFBH 2E7MA 4X9BA 1S7XB 3ULUH 4CDHA 2QQNH 5I75C 2VDRH 3KYKH 2QQLH 4CMMB 1CD1B 4Y2DA 1L0YA 1GXEA 3FFDA 1CZ8L 1QVOA 1ITCA 4RMRA 1BLNA 5D1ZB 4NHCH 2GK2A 5J6HB 1PZUB 2H8PB 3VA2C 2FNBA 4JO2H 4HF5H 2F74A 4FS0A 3SDAB 2CQVA 3AU1B 4QHKI 3C08H 3L5XH 4EN3A 2Q76B 5IVXA 3PWVB 3S96B 3VWKD 4HS3B 1EHLL 4WNQA 1WISA 2DI8A 4PJ7F 1U3ZA 4KJQD 2HFFA 4EZMA 1ZHNB 4QEGA 2JIXD 4LQFH 4X6FB 3ARQA 5DMJB 5FYLE 4EXKA 5GS0L 1M7IA 4PG2A 1ZA6B 2CLRA 3UTSB 4F7TB 5D6CB 1FZKA 5B3JF 3RWFA 5MHSE 1DANU 1MAKA 2QQKH 2X89A 2JJSA 1JL8A 1WAAF 4NFDA 5AG9A 3QIUB 1FYTE 1T2QL 4WFHD 3RVWC 3BN3B 4Z7OE 1OAKH 3X14A 3AREC 1U92B 1QFWM 3JV4B 4POYA 1N6QH 4NNPH 3V6ZB 4LEXH 1QLRB 4HQQL 5DJ6B 3GMLB 3VXQB 4PTUB 1ES0A 4L8BA 4LVEA 3MC0A 3CVIL 5JPNA 2VDKL 4ZTPH 1D6VL 5E8EA 1P6AB 1MSPA 4CW1A 4LCWA 3UZVB 2DQIH 2A1WL 1A6UL 5ACLA 5DMGD 3KWWA 2YD3A 1H3PH 3LKRA 2JJTA 4LPTA 4ALAH 1NJ9B 3X17A 3UPRB 3JBG7 3AUVA 1T0PB 2GK0B 4OZ4B 5EO9A 3TFKC 1VEPA 4UDTB 5ESQA 2BC4B 3U46B 4K2UL 1P84K 1CLZH 4NWUL 4S1QL 3PDGA 3PGCB 1G7QB 3H9SD 3CCHA 1MFNA 4K7PL 2PW2A 2IFFH 4XP5H 2Q8AH 5J11C 5GRYA 1W0WB 1T0NA 2LU4A 4MD0B 2YD7A 2GCYA 4F7MB 3T0ED 5LGJB 3CU1A 1RIUH 3ESUF 5IIEB 4MCYA 2XICA 1ZLWH 3IVKB 1GHFL 3VGDA 1TZGL 5A2IH 3C5ZC 5I6XC 2Y6SC 1DBKH 3O2WH 2AK4B 3VXRA 4H1LB 2YA1A 1X7QA 1XGPA 3LKSB 5L7XH 3REVA 2OI9C 4ZDHA 3LRHA 2E7CA 2HRPL 3REWB 3MBXH 5HJ3B 4HWZB 4ONGL 1DDHA 2XKNA 4LARH 2NY6B 2CIKB 1VFOA 4LCYB 3O3BB 2VQ1B 1ND0A 4JFDA 4HUMB 5I66A 4UI2A 1FGVH 3GJEA 4X6CA 1AGCB 3OKNB 4PS4L 1JNHB 4QRTA 3MLZH 3U4EA 4DQOH 2VAAA 3NIGE 4ODSL 3MV8B 4M43L 5GZND 5E9DD 5HHVH 2WWMC 2Z92A 1IARB 5M94B 5KTEL 5ESAA 3BEWB 3MOBL 5IFHH 3GSQB 5E95B 5CEYB 3SOBL 3FN0H 4JY6B 1FG2B 2PTUA 4XAWH 1EJOL 3OB0K 5SWSB 5E4EB 1KPVB 3HI5H 4TNVK 3SDDA 3BZFB 3QG7H 1P7KB 4TPRL 3UTOA 3PDOA 5MI0C 4HIEB 1A47A 4DVRH 3PWLB 4JQIL 1MCPL 2AJYH 4I18B 4X98B 4POZD 1ZHKB 4R8WL 2AXFB 3EFFA 2E9WA 4YPJA 1FBIL 4R90H 2HLAA 3O2VL 3RZCA 1IAKA 2AEQL 2AEPL 2P5EA 4OLVH 5GGVH 4I2XE 2VDOH 3GSVB 3MFGB 3QEUB 3RUGA 4OGXH 1TMCB 4UT6H 3NGBB 4HPYH 5J9PA 1OOAA 3UX9B 2VXUH 4HIJB 5BS0B 3VXMA 3QDAA 2YUVA 5HHOE 3LN9A 4P2QD 4RGNB 5ACMA 5DC0A 3MROB 3TJEH 2NY4B 2WK2A 5CBAB 4WO4B 2Y7QA 1WTLA 1AKJA 4LASH 1TJGL 4W70A 3VI4E 1QEWB 4NQVB 3WIFB 3ZT5A 3ULUC 5AEAA 1LO0H 2EH7L 2IPKA 5IVZB 2VLRB 1JYXA 5EUKA 2XQYG 4ZUWB 3MLUH 2IF7A 4LVOC 4UIKH 4GRWE 1D5MB 2QSVA 3STLB 4YXLL 4S2SA 2EICA 1UZ8B 3AAZB 3BPCA 4RBPK 1U91B 1CGUA 2Y72A 5FECA 2H2SC 2I07A 4P5MA 1YEDA 2ZPKH 3GKWH 3BRDA 4PV8A 2QR0B 4NPYA 5D9SA 2YRPA 1EA9C 3MZTA 4Y5VB 2CKBH 3DO7B 2DTSA 1VKXB 2FH6A 4K94H 4IRSB 2JCCB 2H1PL 1NC4D 4Z95L 1FQ9C 4DKAA 1GPOH 4FTVE 4LSTH 4MJIE 3U7YH 1FRGH 3BP7B 5FCUL 1WT5A 3ARPA 2J12B 5CWSA 4MD4B 1JPFA 1KIPB 2XFXB 2HVJA 4HUWA 3L5IA 3RWIB 1U3HD 4U1IB 2FX7H 2ENSA 4KJYB 15C8L 5CZXD 5T1LD 4J4PA 4UNUA 3QIBA 1EDQA 4DZBA 1LE5B 1UM5L 4UNVA 3VH8B 1ONQB 5I1AA 1MCFA 2EYTA 4OZFH 3MTRA 1KTLA 1KPUA 1U93A 3LHPH 4GW1A 1X4YA 1KB5H 4PGJA 5D1XD 1NBZA 2VIRB 5C0GB 1WZKA 3T0VA 4YHYB 1XF4B 3IJSB 1E6OL 4OGYH 1JRHH 4BKLB 1A6VL 4KUZH 1BIIB 4NP4L 3NBNA 2W07A 1UQSA 5FYKE 4PJ9B 1K5NA 5ESVA 2VZOA 3LKNA 4ZAKD 1DQJA 3PG2A 3NPSB 3CGTA 4KDTA 5HY9A 3CZFB 4A6YA 1A4KB 1E28A 4ELMB 3L9RA 1EO7A 4XCEA 1MFBL 4H88H 5C0RH 4HH9A 1UM4L 4Y4HD 3VWJC 1U2CA 5AYUL 1DE4B 4PFEA 1PKQE 4K3EH 4GW5B 4XC1H 2CKBA 3IRZA 4URTB 1TZHA 2J8HA 2Q3AA 5EBLA 2R0KH 3MOAH 4JKMA 1GIGL 1KEML 2AK4E 1MJUL 3V4UH 3FHQA 3UYPA 4G7YL 3DOSA 4PUBH 1K4CA 3KPRE 5IWLA 2DQCL 4RSVA 3BAEH 1UADC 4K07A 1SM3L 4HJGA 1BM3L 3T0WA 1N0LA 5KSBF 1YEFL 4NQCA 5J3HD 1WVZA 4Y5YB 1MVFA 3QDMA 1RI8A 2G5BA 2XY1A 3D69A 3FHAA 2FL5A 3A6CH 1NEZG 4NUGL 1SEQL 3UC0L 3W9DA 1YQVL 4NHUB 2P8PB 1NDMB 5HYQA 1UWGL 1BD2D 2OTUA 2W60B 4M62H 1UACL 2EZ0C 4CVZB 3RDTD 3H7LA 1SJXA 1QSEE 1EFXB 1KG0A 2Y9RT 1ZAGA 1T7XA 3P77A 1JPTH 4WHYH 1LO5A 5HD8D 2VLJE 4K9EH 3DHMA 4ZPTA 5FUZH 4BUHA 3T4YA 5FUOL 5TQ0L 5HHNB 4L4VB 2Z8WC 4MJ2A 5BVJB 5I8OL 4Q9CA 1SY6H 4JM2D 2HJFA 2YPVH 5DJ0B 5AWNH 1P7HL 3EOBB 4OKVB 5IHUL 1CS6A 1JI2A 3MRDB 2MQ3A 1AD0B 1IRAY 1U8LA 3ZT6A 3H8NA 3BPLC 3TO2B 4FG6C 5GRVK 4GT7A 1MELA 1UM6H 2EC8A 7CGTA 3T0XA 2O5ZL 3MRKB 3BH8B 2FX8L 5B38G 3MPCA 3F6IA 3L7FB 1Z6JT 1HOCA 1HXYB 5CGTA 5GRXG 2AEIT 5SWQB 1TQCB 1ORSA 4LLVA 1NLDL 2EDLA 5IOPB 3K4ZA 1RZIB 2AAVA 5LQBH 5EC2B 4HBCL 1MPAL 5JQ6L 1CE1L 4TNWK 5T33L 4JB9L 3C60A 2P48B 3TCLA 4OF0A 3PP4L 3WIHL 1TITA 1UJ3A 3WXVL 4LP5A 4N8VA 3EHBD 2BCKB 4OB5H 5J13B 3V9FA 1MFCH 3RVTC 4TNVF 4XC3L 3HS0A 4R4ND 3MRRB 4XNMB 5HDOA 3LKOA 3W39B 3AVEA 3MRCB 3DIFA 1BVLB 2DQGH 2OL3H 2X05A 4K94C 1CK0H 2OP4L 2ZSWB 5DTFB 5IV2B 3O11B 5EU5B 4G43A 3KPOB 3I75A 5L8LB 4YPGB 5CKGA 4Z7UA 1UZ6F 5IWLC 1HWHB 1FC2D 3IDJA 1EEYA 5B21A 4WHTA 4I9WD 1WTGT 4IRJA 4XCFH 3VXNA 4Z77B 4EQ2A 5FGCB 1FAIL 2YN3A 3N1QC 3LH2H 2J1KA 1FL6B 4G9FB 1OSZA 5DRNA 1KLFA 1TVBB 4GG8B 2JIXA 2DQFA 3VFGH 4TSCL 2QSCL 1DL7L 3U9PH 5KZCB 4FABL 3WDJA 5EZIH 1S7TA 1I85A 1Q9WB 3ZDZE 1JZ5A 2FYYB 1TDQA 2G75B 2B4CH 3U30B 4M03A 3X13B 3DYPA 5C07B 1YEIL 1KCSH 3TNNB 1BQSA 4D0CB 4EDXA 1Z5LB 4Z5RB 1HH9B 2QHLA 1A7PL 1RZFL 4CVUA 3WHE0 1S5IL 2XWJB 3A6BL 3C9NA 3V52H 1NANH 2PO6D 4O00A 4UQ2A 4U1MA 4Z8FL 1PYWB 5IMKB 3K3QA 5FUCC 3Q5YA 3INUH 1JF1A 2B20A 4UINL 1IT9H 1QLFA 2YWYA 3CX5J 1T7YA 3E8UL 2DQJL 3MMEB 1U2HA 2LVEA 1HDMB 5MP6L 1P4LB 3OR7A 4JN1H 3MRHA 3OHXB 2XN9B 3U0TB 1U8PB 1HN1A 1Z9LA 9CGTA 4MHHG 3CDGB 3GI9L 3QUZA 1FO0H 1RJZA 3H9SA 4OFKA 2EDHA 2DIBA 1NFDF 3K46A 4JREB 5I1KH 2FLBT 1MIMH 1J1OL 2VDNH 3T0EA 1I75A 3GBNH 2RAMA 2YBRB 1U8OB 3AMLA 4DKEL 5DFTA 1QKZL 4KI5C 2C7UA 4TVPH 5TFSH 2H6PA 3ESVF 2AV7A 4L9LC 1L7TH 3CSYA 5HPMA 4E0RB 4Y19B 1OTUC 1E4JA 2X4TA 2Y6SD 3OG6B 2Y25A 4P23D 4ZNEA 4UUJB 1FN4A 2AJXL 4JM2F 3RIAK 4L29A 1NGQL 2ITCA 5GSVA 3PGDA 1U58B 5F96L 4YNYA 3ZSSA 4QY8A 4QHNB 4OZHF 1LD9A 1MWAA 2A6KA 4HIXH 4K9EC 4PGBB 5GHWH 3IFLH 1UXWA 1TZIA 1KC5H 1SJHA 1KTRL 3GSUA 1G9MH 3HG1D 5E9DA 3C6SB 3QWRD 4P2OD 2GAZA 2IGFL 2X10A 5JHDE 3MNZB 5KJRH 3ROOB 2VDQL 3OL2A 4UU9A 1A6AA 4B5EA 5I1LB 4HJJL 1EEQA 4ACPA 4PJHA 4P4KC 3NIDF 4L4VE 3B9DA 4N0CD 1H8OA 4IHOA 5DURD 3GM0A 3T4AA 3VG0L 2IQAA 4I77H 2IAMD 1J8HA 4DW2H 4IDLA 5JOPE 4IOFD 3UPAA 4MXWL 2ESVE 3I6LE 1ZT4B 1BFOA 4I48B 4J6RH 1C16B 1X5ZA 3SCMB 2V9RA 3O45B 3PGFH 4Q9QL 2H2PC 1YN6B 5I1DB 3HZMB 4FQLL 2B1AH 2E6JA 5FB8A 5DK3A 1HHGA 3OKLB 1WFTA 3BE1L 3FAXA 1MCOH 1C08B 3FMGH 4PJFF 1BBJA 3QO0A 4OUOA 4KWUA 4AL8H 1N4XH 3D0LB 2P1YA 4P2QA 4YQXH 1K85A 2B0SL 3KNBB 2EXWC 3MJ9A 4MQ7B 1R3IH 1A9BB 4QXGH 4YX2H 5KVEH 5GQBA 5JOEA 4U1LB 4AY0A 2Z0BA 1FDLH 3GK8H 3U2SB 2ID5A 4XVUC 4HS6A 4U1NB 4ZPVB 2ILLA 2YZ8A 4OLUL 4LK4A 4XMPL 5I71B 2ZCLH 1J0KA 3TO4B 3Q5TA 4QO1A 5L8JB 1I8IB 3JVGA 2NXYB 1JUFB 1H3GA 4XX1E 4NQTA 3TIEA 5C70A 2EYRA 5JW4M 2DQTL 3SGKA 3ARFC 2J2ZA 2ZOLA 3S88H 1Q9OA 1MHHB 4LCCA 4LVNB 1YEKH 3NACH 2WUBL 1CN4A 4KC3B 5D93B 1QA9B 4NUJB 4JZJB 5GGQH 5GS1C 4MA7L 1LNUB 5GISL 1X4ZA 1NC4A 3QXTA 4TULH 1YC8A 1HHJA 3RWEA 4XGZB 1QFWH 1BJMA 3JTTA 2D0HA 5GGSB 4BQ8A 5T3ZE 2BZDA 1BOGA 4TNWF 2B4CC 1N59A 4UILL 5C2BL 1EX0A 5ADPL 4Y1AE 3AS1A 3DLQR 3P11H 4OBRA 4RWYL 1ZVSB 4QRRB 3CUPA 4AG4L 5JXEC 1AFVL 2I9LA 1Q72L 1XGTA 3BQUA 1A3RH 3MYZA 4ZTOH 3BZEA 1U3HA 4HFWA 1SYVB 2GFBB 5FOJA 3W9EB 3MOQA 4LLUB 4N0UE 5T1LA 2W38A 3BW9A 5JIHA 1E4WH 4JR9H 4ONHA 1VFAA 4PTTB 3DX9A 4HX1B 3WS6C 4LGPB 1FNGB 4PY7A 5J57B 4JZNB 2G9HB 4P9MH 4WW2C 3ZL4L 3BVNA 4KPHH 4OBSA 4PRHA 5D1XA 3F5WA 3ULVH 2W9EH 3DUSA 5DJYA 3IGAB 4YK4C 5KOVC 3IDYB 2YR3A 3P4NA 2DQUH 4YGAB 4M9PA 4PJBE 3UBXA 5EOCH 1DR9A 3EZJB 5EZLB 3TN0A 3LPWA 4XPAL 4JRYD 4ZAKA 5HHQB 2QEJA 2XN9E 4KI1A 5D2NA 2F53B 3RA7H 2N4IA 1R3LA 5E2VL 3H0TB 4I0KA 3MJ7A 3KPSB 1VHPA 4OIIL 5I15H 1NAKL 1QFPA 4ODWA 4TUOA 3VDCA 1F8TL 3U7WL 2E9BA 3EYUL 4XP9L 5H94A 5IB5B 5EU4B 3MYJB 4U1SB 3DRTA 1J87A 3RX5A 3VJ6B 1RU9H 5F88B 1RMFH 4QHMB 3MNWB 2GITB 1RFDL 2QHRH 2VXSH 2R4SH 4XVJL 3QNXB 1ZLVH 4OD2A 6FABL 4XPTH 1R0AL 4N90D 7FABH 2CLZB 4P2CG 4ELKA 2D7PA 2GJ6E 3QQ4A 5E70A 2X4OA 3V8OA 2GW5A 1H8NA 4XPGL 1RJYB 1IE5A 5AD0B 1DFBL 4RZCB 5DLMH 1CLYL 3T3ME 3NFNA 1NCCL 2NY1D 4NIKB 5JTWA 4OZIA 1NFDA 4G80A 5ITBH 4GBXD 3EYOA 4BZ2H 1RJLB 5CJXA 1MLCA 2NY3B 2C1OB 3WYRA 3N1FC 1BD2A 1V5JA 3KPLB 2OR9H 5F1NA 2PETA 3TC9A 3QUXD 4XB8A 4MZ3A 4JFHE 4S11A 4XWOD 2GKIA 4JO1L 2Q7NA 5FF6A 5E7BA 3IFNL 3QJHB 2EZ0D 1RZGA 4NO0D 2A6JA 4QHUB 1UB5B 3QWQB 3ILQC 5DJ2A 5DI8B 5IMOB 4JPIB 5AUMB 1UKQA 5ADOL 4PJDF 5KW9L 1G7PB 5CHNB 1T0MB 4GS7B 5GRUL 2YEZB 3E6FA 4OZHA 5IBUB 3QDJB 4WTXA 1XIWB 1FFOB 4JPKL 3SKMB 3TIDB 1KCVL 3QXDB 3IDNA 1IILE 4KKCD 4JFFA 3EDEA 4PJXA 32C2B 4ETYA 5F1IB 1J1XH 4M61A 1IL1B 3O6LH 1N2RA 5GRWA 5J6GB 3HZVA 5TDNA 2FGZA 2UUDH 3HPJA 3RVXC 3HI1A 1J5OL 2SEBB 4HBQA 4Z7NE 4JRXB 4C56E 1CVSC 3QUKA 4YHMH 5T1KD 3VE0A 1R5IA 3ZO0A 3DURB 4Z7VA 4ZS7H 3VFOA 5CZVL 4N0YL 4JFYA 1RUKH 5GIRA 4XI5C 1IKFL 3VFUA 5DQJA 1QLEH 3TA3D 1XH3B 2QBWA 2R69L 4GAYB 1T22A 2J3SA 5KOMC 5BO1L 3MV7D 1OGTA 3QZWA 3SDYH 2YRLA 3O9WC 1C5BH 4XAKE 5HYSG 2O5YL 4L1HA 5DC9B 3WFDL 3BWAA 3QRGL 2DQHH 1LK3L 3OJDB 4WI9A 4XPBH 4KKNA 2XWTA 4LLMA 4MNGE 1KUMA 2HKHL 3VXOB 3N1GC 3LSOB 1G1YA 1IM9A 3EYFA 4GG6B 3HHRB 2ZUQC 1XCQA 4NO5B 2NTSP 5L2KE 2OR7A 4G6AD 3BIKB 4XNUL 5F1KC 2GEEA 3ILPA 5MENB 4EI6B 4E41D 1ZS8B 4L3CB 2X41A 1JF5A 3FQTB 1YPZB 5EUOE 3LPFA 3MLSH 2BVTA 4GKSB 1GGTA 1QG3A 3MRIA 5IW1A 3BKML 3RVVD 4IOIB 1OAUH 1G7LB 5D2LE 2AJVL 2APFA 1MF2L 2XA8H 2Y36L 2Q7YB 2R0WL 3J7HA 2ITDB 5ANME 4O5LL 4YHZH 3WLWD 3IAPA 3VXUD 4D9RE 1KXQE 3RJQB 4KQ4L 1KPRA 5IB1A 1P2CB 1DUZB 1T4KA 2A83B 1OTSC 3IS0X 3RNQA 4N8CH 1FNEA 2UYLB 2E9JA 5D8JL 3KDMB 1KELL 4DGIH 4R0LB 2AXHA 3CMOL 1I7UA 1YNLL 4K7PX 1P1ZB 2A0LC 3E6HA 3T3PF 2PO6A 4OLXH 2QQNL 4K55A 2VDRL 3KYKL 2BJMH 2M8XA 1Q1JH 3HKFA 3UJIH 4FFVC 1CGVA 1TXKA 4PP1D 2BVOA 5DJZB 3QDHA 3LEVL 1IGMH 3B5HA 4NHCL 4Y4KC 1LEIA 5KAQF 3TBYB 3A6OA 4UT9L 3IU4H 4XP4L 4KH2A 4Y8DC 2BVQB 2X4QA 5DEFB 4PJ7E 3D3VD 4G8FB 1FE8H 3DXAA 3OKOB 4UTBL 2HJKB 3QXAA 4EBQH 5C7XL 5F7LB 3N9GH 3OKEB 4B41A 2VLKB 3TYFB 1S9YB 4EIGB 3SKNB 2C3VA 1ED3A 4XRCB 1KBGH 1WAAE 2OK0H 1JPSH 3CLEH 2KQMA 1FV1B 4KJPC 5FDWA 3SDXB 4ZOBA 1A7OH 1MIEH 5KAQG 1CFNB 2EXYC 2CDFA 1JYWA 1BFVL 5E5MB 4R26H 4ZUVB 4RX4D 3Q0HA 1X5AA 2OQJB 3EDJA 3SY0B 1DQQA 1NFIB 1QTYT 4RMVA 3KYOB 4NJAL 3ISWA 1OAKL 1K3IA 4KZDH 4P23A 3RKDC 2W0KA 4K23L 4NNPL 2EE3A 3E0GA 4ISVA 4Q6IB 2DLFH 1QRND 5IVOA 3BP6A 3PUCA 2ZSVB 1NUDA 3EDKA 5E8OA 5DHXB 2XZQL 1B4JL 4AENA 4ZUTB 3DWTA 4WY7H 4HLZH 1QO3A 2DQIL 1BX2B 4HKZA 4KV5F 3PL6D 3QWRA 4P2OA 1H15B 3P4MA 1KB9K 1OD7A 3MRQB 1AD9B 1IC7L 3DVNB 3OR6A 1PGRB 2Z31B 4PJEE 2R2HB 3RWHB 3H3KA 4QRQB 2NW3B 3L3DB 4L8DB 3AXLB 3CC5A 4TSAL 5A3ID 5CSBA 5DWUH 4XP5L 2IFFL 2BNQE 4HCRA 3UJTL 4UT7L 2Q8AL 4BK5A 4YR6A 1F4HA 4ODTL 4PJ5D 3QEQB 2J4WH 5D4QA 1GAFH 1YEGL 3AFLA 4YE4L 2QSTA 2IAMA 4OV5B 2ADFH 1RIUL 4M48H 3MA9H 2B1HL 4OFIA 5J8OA 4NJ9H 1XF2B 1DBKL 3O2WL 4M02A 4JEGB 4W4OC 3VXSB 5ECJE 5L7XL 1ZEAH 1K8IA 1T83A 1CD0A 1RZ7H 3MUZ1 2LE9A 2G2RA 5CMAA 1BMGA 1NBVL 1YDPA 5DO2C 3G04B 2DB8A 2K7QA 5GRZA 2YA2A 5DSCA 1GL4B 3MRFB 1HQ4A 4MQSB 4QRUA 4N5UA 1S78D 4PRPB 1I8LA 4RFOH 1FGVL 4QF1B 5C6PB 3KPPB 3MLZL 1HZHH 1WFNA 2EH8L 4OLZL 4XNXL 2AKRB 1P4BH 2CDGA 2D4DA 5DD1H 5JA9A 1NGPL 1I9JL 4YC2B 3WLBB 2H9GB 2J8UF 5CKAA 5HHVL 3O3AB 1EUTA 3OF6D 4NNYA 5JORA 4FFYH 3BH9A 5E99H 5IFHL 3WFZA 1D6EA 4KKAD 4KY1H 4NQEB 2DJ4A 1MY7A 4HUVA 3FN0L 4M7ZC 4XAWL 1OGAD 4X4XB 3QWOA 2OJZH 3MUGB 1MFEH 3HI5L 3BEVA 5HHMD 5LBSH 5IHZA 5IFJA 1WCQA 4QWWD 1FC1A 1T1WA 4DVRL 2AJYL 3R06B 4NQDD 5HYSA 4NRZB 3LKQB 4MDIA 2OJEA 1X5YA 4LNRA 4R90L 4NO3A 1I4FB 1ZT7A 2XOTA 3V5HB 4LIQH 3DSNA 4U1HA 1AC6A 2VDOL 3MLTA 3PXHA 4HWNA 1GOGA 5GZOC 5BW7A 4UT6L 4HPYL 43C9A 5CJQH 5MERB 1IC1A 1YPZE 3HZKA 4XBGB 5ISZA 3F7RA 2MQCA 4IMLA 4P2RA 1BOYA 1ZLUK 3TJEL 5DK2A 3AMKA 3T0BA 3MJ8B 4PJIF 4I0PC 3QXVA 4HWEL 5B8CB 4LLYA 2F5BH 1AE6L 2HTLD 4MQTB 4NRXA 3O4LB 4X4ZA 1ZSDA 4X8JA 4RCAA 5I74C 3O3DA 2WBJD 4HUXA 1A3QA 4PGDB 1CGSL 1FZOA 4D0BA 5TF1L 3MLUL 3HI6H 5GJTH 4F7CB 2YD5A 1KACB 2W65A 2ZCHH 1HH6A 3RP1A 4PR5B 1T20B 5JMOC 3VMNA 1I7RB 2AK1L 3AB0C 4KFZC 1J18A 4A6YL 2NX5D 4W68A 3D25B 1RULH 4MSWA 3ZE2F 4U6HA 2ZPKL 3WSQH 3ARDB 3P9LB 1KULA 5DD5H 2MSPA 3FT4A 3OKYA 5DRWA 5JO5A 5HGBB 1E4XH 1IGTA 1GOHA 1K6QH 1PJ9A 4JHWH 5IQ9A 3V2AR 2VO5A 2BK8A 3VFVB 5CAYB 4H0HB 3CFDA 2XIDA 3BO8B 2CKBL 4FZ8L 4XCNB 5A16B 4U1GC 4JRYA 2DYPB 4Z7WB 1I8LC 2XTJC 1GPOL 1LO3H 2ZP0T 1SBSH 4PJ8B 1EXUA 3TPUA 1CQYA 1W0VA 3G5YA 3SE8L 4L3ED 1I8MB 4PGCB 3U7YL 4HK0A 1JGEB 4PLJD 4F7EA 2VL5B 2VRAA 2QADC 1WGOA 4L4TB 1HI6A 4HJ0D 1F6AA 1XGYL 3OKKB 3GFUA 5KVMC 1B2WL 2CK0H 3EYVB 5BXFB 5I16A 5DYOA 4J23A 2A73B 5HGAB 3GMPA 2FLRT 4Z78A 1X9QA 3GSNA 5E6ID 2NW2B 2X2YA 4DWHA 3ROLB 3WIIH 1AGDB 2ZWLT 3T08A 3S5LB 5EA0L 2MPAL 3HFMH 3SDAC 3QEGL 4MNQD 3D39E 4YDVB 3EIFA 4OZGB 4WHYG 4S0TD 3UTZB 5ID0B 2W0LA 3NCFB 2QQQA 1JRHL 1MAMH 2XKUA 4MMZC 2CUHA 3C6LD 2F19H 3QUXA 4LKCA 4E5XA 4PJCB 1AO7E 3L3OB 4P59L 2WIMA 4O4YH 2I25N 3BRFA 1NGZB 2BNRA 3CK0H 4NO0A 2AERT 2PW1A 2PYFA 5FM8A 4F2MA 5E94B 2IBBA 1AY1H 3B8YA 3QIUC 5ERWA 3B3IB 1GCFA 5LG1A 4K3EL 4JCLA 5B39B 1V7ML 4XC1L 4G8GB 3MOAL 4RRPG 5I1CH 4Q0XH 3CFEB 5KSBE 3VXSE 5D72H 4V1DB 3STZB 4PD4J 3NN8B 1WUNT 3QI9D 1ZTXH 3QCVH 3PWNB 3BAEL 3OQ3B 2F8VA 2EKJA 1BZ9B 3BYTA 3KPNB 1IGJB 1MJ7H 5T1KA 3HNTH 4Y16D 5BRZB 3RVXD 4P46D 3UTTB 4OCYH 4N0RA 3A6CL 4YO0B 3S4SA 1P4IH 3WO4B 3RGVB 4Y5XB 4HULB 3PQYD 3QIWA 1KLUA 4EUPB 2C1PA 3C09B 1IEHA 3FB8A 2BSTA 4D9QD 2NY5H 3MV7A 1NMCB 5DFWH 3RBSA 5KS9B 5I1HH 4XMKH 4UOW0 4TYUA 1M7XA 2BMKA 2VUOA 2YPVL 1NBYB 4ODHL 3O9WD 4P4RA 2W92A 4JLRB 4WCYH 2Q8BH 5T3XE 3MGAA 3LZFH 1A1NA 3FO2B 1R3HA 2NY6C 3O3EB 2AV1A 3V6OA 1EH9A 1A02N 1AXSA 5I75B 2J8UA 5DS8A 2XG5A 4GKZB 1L6XA 1OP5H 4BM7A 2VUYA 4X6DE 3VI3E 4ZFZB 3CMGA 1ODAA 4MXQD 4E41A 1HHKB 5D70H 1U36A 3I50L 1UA6L 1K2DB 1PZ5A 1RZ8A 3K0WA 5IKCA 4ZYKB 5J56B 1QQDB 3VGHA 2GUOA 4OCLC 5CEZD 3IKKA 1U9KA 2ICWI 3VXUA 3VRJA 3PP3H 1RK0A 2F54E 3BX7C 4MB3A 4I18C 1F2QA 1Z9OA 1G6RH 1MFCL 1GGYA 35C8H 2YSSB 1OTSD 3WD5H 4UQ3B 1PFCA 2XG4A 3M45A 5DUPH 5FFLA 2OZ4A 1DUYB 3NGBC 4DVBA 1A6TA 4DK3A 1DVFD 1P9MA 4TTDC 1MI5D 4PJIA 3AREB 4FFVD 1T7VA 5M95B 4I13B 3D3VA 3WL9B 4RGNC 3E2HB 4DKFH 4HXAH 1FNSL 5HVGB 4Y4KD 3MNVA 1BGXH 4G6MH 5FYJE 2NY4C 4R4BB 4OF5A 4WO4C 3GMOA 4LSVL 2UUDK 5EO0B 5AZEH 3V6BR 3SGDH 1U41A 1A0QH 3HC0B 3LDBC 5C09B 2VLLA 1HQRA 2Z93B 1JWUB 1K8DB 4EQ3A 1I9EA 1C7TA 3SE9L 4ERSL 3LVEA 3KVQA 4QOKB 1RHHA 4Y4FB 1DLFL 3DARA 1S7VA 1MCWW 1JGLH 4I3RH 4RAHA 2LV4A 3QA3B 1MWAL 4OUUA 1XGQB 4YEEA 4BFEA 5J11B 3U9UA 3M17A 1CR9H 2FJHA 4R7DB 4WFGE 4C4KO 3MODH 1XGUB 1LP9F 1QRNA 3JV5A 4Y5VC 5JPMA 3DMMB 3HPLB 3TEUA 1F4WL 2WSKA 5JXAL 3V6OC 4LF3B 3V7AE 4AMKH 2RR3A 3MLYH 1T3FA 1WIPA 4ZS6C 1CFVH 4Y2DB 1OAXH 1P69B 3B9KD 3W81A 3EUUA 2W9LA 5HVHB 3FFDB 3PL6A 1G6RA 1QVOB 2CK2A 5DMKA 3WV0A 1T1YA 3I84A 1BLNB 4R7NA 2DMBA 4APQA 2FEEI 2NTFA 1S8DA 3EDDA 1L7IH 3ZE1F 2F74B 5D6DA 4NN5C 3BKCL 3ZYIA 5FYLD 3SBWA 4EN3B 3LKPA 4WEMB 5IVXB 2RCSH 1I1AC 1LK2A 3MLXH 4WI8A 4PJ5A 1RZJH 3G6JF 3B4NA 3EOTL 5I1KL 4FNLH 4FQIL 4WNQB 5MHSD 4WI5A 4BFIA 3RZWA 4FQXA 1Q0XH 2R1YA 3LQAL 3WN5A 2HFFB 4OT1L 3GBNL 4RGOH 4QRPD 5EH1A 4TVPL 5INDA 3MJ9L 3NCYS 1A7NH 1FIGH 2A74A 1M7IB 2CLRB 5EN2A 4R2GD 3FQUA 5T1MA 4IRZH 1AJ7L 1MRFL 1FZKB 4LFHD 5C0CD 4CNIA 1PKOA 1J7VR 4YHYC 3RWFB 2EIDA 3SJVE 1NKOA 4KK9C 3MV9E 2VKWA 5DVLA 3HB3D 3X14B 4PJ9C 5DFVC 1QFWI 4YHIA 4UTAH 2WBKA 4OLWH 3UTTE 3NPSC 1L0XA 3RAJH 2XYCA 5GHWL 4F58H 2NY5C 4X80L 1KC5L 3QHTC 3AY4C 1WIUA 4HLJA 1G9ML 3G5VA 1ES0B 2V2XA 1HXMA 3NIDE 4L8BB 5JPNB 3QHZH 3IETA 5E8EB 4KTYA 3L3IA 4CW1B 2DLHA 4LCWB 5FO9A 5KJRL 1JMXA 4QKXB 4XBEH 3KWWB 2DWEA 1OGAA 3LKRB 1NLBH 3GO1H 4L8SA 1VA9A 1I3VA 1WWAX 5EO9B 3I3EA 5ESQB 3ZKMC 3FO1A 3RFZC 4DEPB 4X7TA 3ZHDA 3N06B 4OFDA 3CCHB 4I77L 2JELH 2PW2B 4DUVA 3F7QA 2EIBA 3N1MC 1T0NB 3FONA 4PJFE 4J6RL 2GCYB 3PGFL 5FA3A 4MCYB 1GC1C 4YIQA 4GAJH 3S34L 4LSUH 1P7QD 4O58H 3VXRB 1X7QB 1XGPB 3V5KB 3REVB 3FMGL 4ZDHB 1T04A 1FFNA 1FJ1A 2H32A 5DRZA 1DDHB 2XKNB 3PV7A 4MA3A 5D96B 5LKNA 1UGNA 5FA4A 1R3IL 2AP2A 2NY2C 4QXGL 3HMWH 4JFDB 1R5VA 4PJAA 5I18L 5I66B 2CIIA 3GJEB 4X6CB 1LMKA 4QRTB 4MWFA 1YYLH 2V9QA 2WBJA 3CSBA 3U4EB 1MCQA 3WFCL 1Z3GL 2W9DL 2VAAB 2VNCA 1AGBA 5CP7A 1CTNA 3B2UC 4Q9RL 1D9KD 2Z92B 1CL7L 1MJ8L 5ESAB 4FQXC 2WBWB 1FFQA 4KHXH 1ULVA 1I8KA 3VD7A 3FB7A 4FFWC 5JW5A 1DCLA 1FZMA 1UVQA 1CZ8H 3RU8H 3SDDB 3S88L 1F3DJ 3PDOB 4YDLC 5T5FH 1ETZA 3EFFB 4LSSH 1TQCC 1XT5A 4J3UA 2HLAB 1N5YH 4TULL 3RZCB 4HGWA 4F9LA 5HHOD 3PV6A 4MJ5A 2P5EB 3FB5A 4KGLA 4AIOA 3RUGB 4U2ZA 3S35L 5J9PB 2Z8VC 5D7SH 1RUML 5ETUA 5J13C 3P11L 1DQMH 5E00B 3VXMB 3HAEH 2WUCH 4GO6B 2A9ML 1JPGA 2Y7QB 1GYAA 3QG6A 1AKJB 4G3YH 1CFQA 4JR9L 1T2QH 1FVDA 4PV9A 1NGWA 1S9KC 4QYOA 2IPKB 2E27H 4CU7A 3NVQA 1VFUA 5EUKB 1H3UA 4K71B 3ULVL 4WU7A 4JGJA 2FX9H 2H26A 5D1ZD 3V4PL 1A21A 3RWDA 4ODBD 3VXTA 4WI4A 4HQQH 4S2SB 1WZMA 4Z7OF 5FECB 3CVIH 5HI3D 2I07B 1CWVA 1YEDB 2VDKH 2Y23A 4P5MB 4LU5L 4PV8B 3D1MC 4NPYB 5D9SB 1NQBA 2A1WH 3C6LA 1CXKA 1RZJC 3CIQA 3AGVA 2IBGA 4MJID 4YDJB 4CADA 3JWDH 1CYGA 4PJGE 1KJ3L 4K2UH 1UWEL 2NQCA 4NWUH 4U0RB 1M05A 4S1SH 4PLKD 4YBHA 3U30C 2WINA 4K7PH 5I15L 1F4AA 1R6VA 1TETL 1JNNL 5CIPA 1K4DA 5EULV 5IROC 2NXZB 1VESA 1TTGA 4BQBA 4LFHG 3HC3L 1GHFH 1TZGH 5CP3A 5CWSB 4ETQA 1JPFB 2HVJB 4HUWB 2P4AB 1SJEA 3QI9A 7FABL 2IJ0C 4IS6A 3SE4C 4ONGH 3X3FL 3QIBB 4KJWD 4DZBB 5I1AB 4Y16A 2EYTB 1KTLB 1KPUB 1U93B 3HAEA 4P46A 3HTLX 1YMME 1NDGA 5F93C 1T2XA 4GW1B 3FRUB 4B7LA 1A14H 5L8KB 3G6JA 4HDIA 5FYKD 4BZ2L 4OD3H 4U7MA 3PWPA 3SN6N 2Z4QB 3MX0A 3ZTJG 3PQYA 2I60H 4J3XA 3VRIA 4AM0A 4JREC 4P9HL 3NIFE 5KTEH 3BMVA 1B0GA 2IBZY 5ENWA 4UOJA 1UQSB 5TF0A 4JFZL 3SOBH 2FHCA 1K5NB 5ESVB 1EJOH 3NIGF 3LKNB 2NLJA 1DQJB 4U6TA 3SDCD 5HY9B 4A6YB 3ULUE 4K8RD 1E28B 1DBAH 3L9RB 1KTKE 5C0DA 4XCEB 4MX7A 5FO7A 1MCPH 4BUGA 1QBMH 2AK4D 3MFFA 4OFPA 4AH2A 4M8QA 2C3HA 4HH9B 4MVBC 3KLHD 2HTKC 1XF5A 5IBLC 3KPRD 2ZUYA 1BVZA 1J1XL 4AIZA 3UPCA 1YN7A 4JPWL 2AEPH 2CKBB 1TZHB 3O6LL 3TGXA 4WGWB 2NY6D 3V0WH 3WFEH 5EBLB 5D5MA 4F80A 5B4MC 2O93L 5JIPA 4FQCH 3MRLA 4GFTB 1ZLSH 5A43C 5I73B 3BD5A 1K4CB 4EDWL 2QV2A 5I9QB 5HGHA 1TVHA 5MEQA 4KDVA 4Y88A 4HJGB 3L5JA 2OBGA 2L7JA 5T5NF 4ZS7L 1YYML 4JQVC 1QSED 1FFRA 2MTPA 4NQCB 4G7VL 3D0VA 1TJGH 1QPPA 3QDMB 2G5BB 1QLEL 2VLJD 3D69B 5F71A 2FL5B 4CGTA 4AEHH 5SWSD 3W9DB 2EH7H 1FIEA 1UENA 5HYQB 4CRPA 2OTUB 5INCA 1LEGA 3K8KA 3SDYL 3PIQA 5CGYC 1KG0B 5FXCH 1PEZA 3VI4F 4YXLH 3P77B 3SCMC 1LO5B 4JO4L 3QT2A 1YJDL 4ZPTB 3K80A 4GLRH 3UTPE 3F8UB 2IANA 5T5NG 3T4YB 2ZOKA 2M26A 1DVFA 5LAXA 1MI5A 4RQQA 2LAAA 4GRWF 2DM7A 2HJFB 4XCCL 4MXVE 5F7NC 1K3ZA 1JZ7A 1TJIL 3X11A 1U8LB 4TTDD 1MNUL 5CD3A 5GS0C 2H1PH 4J3WA 4Z95H 4S10A 1KCRH 4NM4H 3MLSL 4WO4D 4FHBD 5GS2D 2R23A 1G7JA 2VC2H 1KXVC 1HOCB 3LPGA 2XA8L 1U8NA 2NZ9D 5FCUH 5I71C 3C2AL 4OJFH 3PXJA 3TO4C 1ORSB 4LLVB 3X3GL 2NXYC 5F44A 2R1WA 3QQ3A 4BH7A 2IALA 3BJ91 5CJBA 3C60B 4S1DD 3TCLB 3C5SA 4N8CL 3QQ9C 3WS3A 1UM5H 5JLZB 4W6WB 1UJ3B 4LVNC 4J8RA 2HVKA 4N8VB 2UVEA 4OLXL 2BHZA 3EFDL 4LHUD 4E42A 2VZ1A 4JZJC 5BQ7A 2VDLL 3UJIL 5TDPA 3HS0B 2CLVA 3L3HA 4HCRL 1IGML 3JWDC 3LKOB 3OAZK 4J1UA 3DIFB 4IRSD 1AQKH 1VEOA 3ARBA 4G43B 5CD5D 3VFMA 1FE8L 3I75B 1A6VH 1OP5K 4EBQL 3THML 3LV3A 4NP4H 4Z7UB 2X5PA 4GSDL 4KKBD 4D8PA 3IDJB 3QPQC 1EEYB 3EZ8A 4HKBA 4WHTB 3G9AB 5TDOA 4IRJB 4YFLF 3VXNB 5EU6E 5SV4A 2OTPA 1CGXA 5BZDA 4IIQA 3CX2A 2QSQA 3CLEL 4DK6A 1MIEL 3IAQA 1OSZB 5DRNB 5AYUH 1U6AH 4GQPH 2EDYA 1FYTA 2JIXB 2DQFB 3PP3K 5JQHC 4TRPH 4J3SA 4LLQA 4NC1C 1UWXK 4ESKA 3ZYJA 4MQXD 4RAUA 1HYSC 1GIGH 1KEMH 3FO9A 3MV11 2LVCA 1MJUH 1S7TB 3FB6A 3IDYC 4JANA 4G7YH 4KZDL 3QUYA 3RHWK 4WFEE 5J12B 3IYLW 4EDXB 1U3JA 1SM3H 4UV4L 1A7BA 4KMLB 4H25A 4XTRC 3C9NB 2ATPA 4KKLD 4UQ2B 1O7SA 3RL2A 4U1MB 4WY7L 2CSPA 4U3CA 3UC0H 3NTCL 1GGCH 1UWGH 4RFNB 1JF1B 2XZCL 2M2DA 1QLFB 3HE6D 3OAUL 3TH4T 2X9XA 1TQBB 2V2WA 1T5WA 3OR7B 1M4KA 5A2LH 2PR4L 3MRHB 5FUOH 5TQ0H 5L6YL 4H1LG 3E3QC 3DROA 4X6EA 2J4WL 3QUZB 1RJZB 3H9SB 3I3DA 5J7CC 3KXFE 2DIJA 3ZKMD 2ADFL 4LRNL 1CT8A 1MCKA 3MA9L 5IHUH 1NUGA 4NJ9L 4OM0L 1OCWH 3OJMB 3S36L 5DDHA 5HGDA 4JE4B 3EW3B 1ZEAL 5TQ2L 3T0EB 5C86A 2C7UB 3BKJL 1P7QA 4C54A 2H6PB 2AV7B 1RD6A 2NY3C 3CSYB 4O9HL 5HPMB 3G5ZA 2X4TB 4Q2ZA 5GXBB 4F3FA 4JQXA 5C92A 3ARBC 1FN4B 1FNHA 4L29B 1HZHL 1MPAH 5JQ6H 1T5XA 2ITCB 1P4BL 3PGDB 1EFXD 3ARGA 4JB9H 4YNYB 5T33H 4QY8B 5JHDD 3QNYA 3MUY1 3W82A 3PP4H 1LD9B 1MWAB 4C83A 3QDME 2X42A 4WV1A 3I85A 2A6KB 4FFYL 1J05A 3DBXA 1UXWB 4JJHA 3NAAL 1TZIB 3DVIA 1SJHB 3GSUB 4GS7C 4L4VD 5E9DB 2GT9A 1D9KA 4RFEA 1XIWC 2GAZB 5IB4A 3PDDA 2OJZL 5C08E 2PN5A 5SX4H 2VR4A 1GH7A 5F1OB 5JUEL 5AAWA 2FO4A 5JOPD 4UU9B 1A6AB 2ESVD 2OP4H 3C5JA 4I2XA 4PJHB 2KBGA 5HDQL 1NCUA 3MGTA 1YEHL 3QUYC 4IHOB 3I9GL 1S9WA 4YFDB 4FFWD 3T4AB 3T2QA 1MCSA 2IQAB 4CKVX 1J8HB 3UAJD 1N6VA 1Z0MA 5HHOA 2X4SA 4YK4B 5FCSH 4U1KA 1BFOB 2LU7A 5DK0A 1I9IH 4BQ6A 4H8WH 4XPFL 5FUCE 2R2CA 3GSNL 1RURH 1HINH 3NPZB 1G1CA 2V5RA 5FB8B 3S6CA 1HHGB 2ADJA 5MEPA 4KK8D 3HUJE 3TVMD 4LSRH 4XVTL 2YD4A 1BBJB 3QO0B 4JPVH 2JCCF 3KJ4B 4P2QB 1CXFA 2QSCH 5IEHA 2F5BL 1CE6A 1ZVHA 1YA5A 1T89A 4PRBA 3MRGA 4JM4L 1Q9KA 3HI6L 3MCLL 5GJTL 1CD8A 3Q3GA 2ZCHL 3U0WL 1A7PH 1RZFH 5KANI 3ECBA 4O51A 4HS6B 1S5IH 4TSBL 4HKJA 3A6BH 4XXCA 5D1ZA 2WV3A 1RULL 2QJDA 4KI5E 3WSQL 4JDVA 4M1CC 2YHGA 5DD5L 4ZOAA 4Z8FH 1E4XL 5AYQA 1K6QL 4JFEE 5CCKH 3ELAT 5SWZE 5TH2A 4N0FA 3TIEB 2IG2H 2EYRB 4UINH 4MAUL 4HWBA 1T66C 3E8UH 1BVKA 3EKCA 4FTVA 2VYRE 2ZOLB 1Q9OB 3W2DL 4MJIA 4LCCB 4G9FD 5T3ZD 2DAVA 2XT1B 3CD4A 4GKNA 2XNAA 1SBSL 1PLGL 5DGRA 4P3CH 3H9YA 3UDWC 1NC4B 5F6HI 1AXIB 3QNZA 2VTFA 3GI9H 1HHJB 3RWEB 3S98A 5KANG 2YPLE 4CJ0A 4FQ2L 1JYNA 3JTTB 4P48A 3C2SA 4WV1C 1BOGB 3VH8G 4R0LC 1J1OH 1N59B 2CK0L 2CJUH 5HI5C 1CGYA 5GGVY 4ELMF 4HKXA 4YEFA 4KK6C 2UWEA 3CUPB 2X4UA 4U3XA 4HSQA 2I9LB 1M6OA 3STBA 1XGTB 2D7NA 3BQUB 1FL5A 4OFVA 1BQLH 1U3HB 4HFWB 3CFCH 4POUB 5DJAA 4XNQA 3R8QA 3BZEB 4JJ5A 3F12A 3LS4L 5E2WL 2VKXA 3DVFA 3WIIL 4HGMA 5T1LB 5E8NA 2IH1A 3BW9B 3I3BA 4JCMA 4ONHB 4YBLB 1VFAB 3DX9B 4ZFGH 4PY7B 3QULA 1VERA 2YXMA 5L9DL 1NGQH 3BVNB 4PBXA 5F96H 4PRHB 3LEXA 5D1XB 3F5WB 2HG5A 3NCEB 3DUSB 5DJYB 1MAML 2XN9D 2VL4A 3P4NB 4Q6YA 2F19L 3CLFL 3UBXB 1JZ3A 1I1RA 1S7WA 4O4YL 2HLFD 2IGFH 3HE7D 4QHLA 1HKLH 3TN0B 1IM3A 2X1WL 4KMTL 4PY8I 2VDQH 1DBML 4MD0A 3CK0L 1CCZA 4U7KA 3G6AA 3RX8A 1PKQA 2VDMH 4PRNA 4ZAKB 4DGYH 3LEYL 4S1RH 2ZG3A 3SDCA 4NFBA 5D2NB 1R3LB 5IFAH 3MJ7B 2AK4A 1JHTA 1SEBA 1JGVH 5HHME 4NZDA 4Q6IC 4ODWB 4TUOB 5I1CL 3KPRA 4YUEH 4N68A 3RHWF 5H94B 3QEHA 2GJ6D 3FFCE 4MVBD 4IJ3B 5L88H 4D3CL 3DRTB 4XXCC 1XGRA 4Q9QH 4FQLH 2P44B 5EOTA 1NGYA 1ZTXL 3QCVL 5SX5H 3CH8A 2HT3C 2EDQA 3EO0A 3SKJL 1KIRB 1MJ7L 1VADA 1L9MA 4OD2B 3UO1L 3VU2A 3HNTL 1EHXA 4ELKB 4AYFA 3SGDI 3QQ4B 3EO1A 2X4OB 3D2UA 3TBVA 2Z31C 2B0SH 1OAZL 3C8HA 4FQHA 3EOAA 1P4IL 1QSEA 2NMSA 2OZ4L 4JFHD 5F9JA 5F89A 3IXTA 3NFNB 4OZIB 1N8ZA 1NFDB 1N64L 2P47B 4G80B 2VLJA 3O8XA 2ARJA 3EYOB 2R15A 4KQ3L 3GSXA 1MLCB 2AJZA 2PTTA 5BV7L 2CXKA 5E2TH 1AR1D 1BD2B 4OLUH 3I02A 5F1NB 4HZLA 4XZUA 1EUUA 2FIKA 4GXVH 5FF6B 1JYVA 4XMKL 1PX3A 5LXGL 3EGSA 3ZKNC 1RZGB 5JNYA 2A6JB 5ICYA 3A0OA 4J3OC 2VXTL 4PJHE 4X7CC 5DJ2B 2DQTH 2NX5E 4P3WA 2IQ9H 3TT1H 4OZHB 4GRLD 4XHJC 1DLHA 4MA7H 1FHGA 5F9OH 4NCDA 4P2YA 3IDNB 4JFFB 4PJXB 5FGSA 4M61B 1A6ZA 4LEOA 5A2FA 1EMTH 4YC2C 3AS2A 4FQJL 4ORGA 1N2RB 5F7YC 3SQBA 4Z76A 3HZVB 5GS0D 5TDNB 5DA0B 2J88H 3HPJB 4UILH 1U8IA 3HI1B 4H5SA 5ADPH 5HTSA 4RWYH 3QUKB 3VE0B 4L3EE 1R5IB 4AG4H 4GH7B 5TE4L 1OB1A 3EAKA 4TVPE 4EUPH 4Z7VB 2P5WE 1OM3L 3VFOB 4XX1G 1OD9A 2DLGA 1TCMA 1G6RL 4JFYB 1F4YL 4OD1L 3ALWA 2Z9TA 4XAKD 5GIRB 1QNZH 3VFUB 5DQJB 4JDZA 3ZL4H 5I1EL 4LHUA 4GUPA 3O2DH 2PUQT 1LGVA 4JVWA 1T22B 1N5AA 2B2XL 2Q3ZA 5DUPL 3CU7A 3CPLA 4WUUE 1OGTB 3QZWB 4M00A 2JB6A 2J6EH 5L2KD 1ZGLM 5D7IA 3DRQA 1CICD 1T21A 3BWAB 3W0WA 1JWMA 1KLGA 1YEEL 3NA9H 5BOPA 1T2JA 5H37G 3V4VH 4MNQE 2XWTB 1F00I 4LLMB 4G6ML 4LLDA 4X7DC 1J0HA 4XPAH 1IGFH 1IM9B 3EYFB 3PABA 5AZEL 3BZDA 5B8CC 4G8EA 1XCQB 4LHQB 2PYEE 12E8H 4PJBF 4F57H 5E2VH 4QRRD 4RNRA 2FDBP 3ILPB 1IQWL 3QPQD 4NKIL 1DEEA 2C9AA 4OIIH 4D9RD 2CMRL 2V5TA 5D1QD 3U7WH 3EYUH 4I3RL 4XP9H 3MRIB 5IW1B 1LP9E 2FSEA 5H35A 4WRLA 1BQHG 4LVHB 3ARDC 2NYYD 3VFPA 3DNKA 1KPRB 3P4OA 4HIIA 5IB1B 1HYSD 1T4KB 1R0AH 3RNQB 1FNEB 3TBTA 3SPVA 1ZKAA 4XPGH 1DFBH 4PB9H 4U05A 1I7UB 3E6HB 2PO6B 3L6FA 1FNLA 1A6PA 4PJ8C 1V3JA 3MBED 1JZ2A 1E6JL 2BVOB 2Y1VA 2EDOA 4LPUA 1INQA 4HZAA 1LEIB 3L5WA 4YHLH 4OGAD 3WE6A 3TZVA 3HE6A 2UZIL 1L7IL 3T3MF 2X4QB 2RQ8A 3JV6A 3O2DA 4BA8A 3DXAB 1RY7B 3DETD 3DVGA 3QXAB 3IFNH 4U6YA 1PEWA 4DN4L 1FNFA 3CFBA 4D9QE 1EAJA 4TTGA 5ADOH 4EEEA 1QUNA 2C3VB 5KW9H 4EI5D 1ED3B 4K3DL 4QGTA 3CXDH 3G5XB 1A7NL 1FIGL 5FDWB 1U8JA 1MHCA 2IMNA 3KR3H 2CDFB 3M07A 1VENA 5FGBC 3ULSA 4PRDA 3RTQD 4KXZI 1DQQB 5F72S 4P23B 3UMTA 3DX8A 4ISVB 4X99A 4XH2A 5KSUA 3Q48A 3BP6B 4U4BA 3QDGE 5E8OB 4AENB 1AQDA 5JHDA 5GSRA 5CZVH 4N0YH 4HFUH 2CUMA 4IMKC 1JTOA 3QHZL 1I1YA 3I6KA 3BP4A 3Q1SL 1QSFE 4WENB 1CQKA 1QO3B 1WBXA 3ZHKA 2BNQD 2ATKA 4HKZB 4XBEL 1KJ2A 2IPTL 4P2OB 1A7RH 5I30L 3P4MB 4Y0GA 3S35X 3OR6B 5HYJE 5EO1A 2GSGA 1TTFA 5C0EA 1EVUA 3CC5B 4X7FC 2ESVA 5I74B 3QRGH 4FZEL 1LK3H 5LCVL 2EE9A 5CUSH 4YR6B 1KTDA 5F9DC 2HKHH 4MJ4A 2VOTA 2ZG1A 5K93A 3RVUC 2B5IB 2IAMB 5IR1A 3AB0B 3L3GA 3PE9A 4JRXD 5FIEA 4O58L 4PJXE 5L2JB 1K8IB 4HUKB 3RGVC 2G2RB 2DWDA 3KJ6L 4Y5XC 1YDPB 4P99A 4LPWA 5CMAB 2V9TA 4M6ML 2EYSA 3QFJE 3C09C 1FAKT 2BVPA 1J8KA 5DSCB 3TVMA 3BKMH 1MVUA 1O7VA 1HQ4B 2ICWJ 4QRUB 2AJVH 3UZEA 3GSRA 3TZVC 3HMWL 2Y36H 4BELD 2R0WH 5DD0L 5KSAD 2DMKA 2HFGL 1NMCC 3BHBA 4W6YB 5BJTA 4O5LH 4XWGL 4ZXBD 1OQOA 3H7BA 3PHSA 1YYLL 4LKXA 1QSZA 4U6XA 5KG9A 4Z7VE 5HYFA 3IDXH 4KQ4H 2VDPH 3ES6A 1DQDH 1V3KA 2CDGB 5D2LF 4KVCH 3V0VA 3VFSA 5D8JH 3OBAA 4NNYB 5JORB 1KELH 4XXDA 3BH9B 4XVSH 1IC4L 3CMOH 2F9BT 1D6EB 3LD8B 1Y6MR 4HS8L 2A6IA 4HUVB 5EIIA 3SKOA 1MUJA 4Q58C 3QWOB 3BEVB 5IHZB 5IFJB 3RU8L 2HN7A 3T2NL 2NY7L 3LEVH 3OAYH 1T1WB 4JFOA 4JHZA 5T5FL 4M1CD 4UT9H 4XP4H 5HYSB 4MDIB 4LSSL 2OJEB 2A77L 2PXYD 4PYGA 3FQWA 4LNRB 4X4MA 4NO3B 4YDKH 1N5YL 1ZT7B 2C3XA 2ZKHL 4UTBH 5C7XH 4X7SL 1H3VA 4Y1AA 4U1HB 4D2NA 3MLTB 1E27A 4LNVA 2QTEA 4NKOA 43C9B 3O6FA 5D7SL 1DQML 2UV3A 2ZUXA 3OKDB 3HZKB 5ISZB 1R3JA 2YWZA 4N0UA 4IMLB 4P2RB 4ZMAT 4YFEA 4FP8L 2WUCL 1OP3H 5DK2B 4YHPA 1N3NB 1BFVH 4UIMA 4YWGH 1G7IB 4G3YL 4LLYB 2VITA 3JWNC 4AQ1B 3BUTA 4NRXB 1BQHA 4QRPE 1DANT 1ZSDB 4U31A 1NAMH 4NJAH 4X8JB 3O3DB 2E27L 4HUXB 4LCIL 4AQOA 4ONFL 4L5FH 4D0BB 4K23H 4F33A 2FX9L 4N8PA 3E2HC 5I17A 2WW8A 4PJBA 1Z9MA 2W65B 5C0CE 2CD0A 1HH6B 5D7JD 5HBBA 1I7ZA 3GNMH 1VFMA 2WLYA 2XZQH 1B4JH 1H3WM 5E8PA 2YD9A 4AT6B 4MSWB 3KPMA 5D7LE 4U6HB 1YMHA 4KK5C 3FT4B 5DRWB 5JO5B 4QNPF 1IGTB 5IQ9B 1BFSA 1CFSA 4Y4FC 3SGEI 1L0QA 1B88A 2P8MA 3EJZD 1IC7H 3HE7A 3CFDB 3IKCA 3JWDL 3B9EA 3DXAE 1NEUA 4JRYB 5LVEA 4S1SL 4TSAH 1RZKH 1IAIL 4MAYD 3UJTH 4UT7H 5I1GL 1PG7L 1EXUB 3TPUB 1A2YA 3G5YB 4ODTH 3CX5K 4HK0B 4NKDA 4ZUSA 4PJEF 4F7EB 1YEGH 4YE4H