4P49A

The structure of a chicken anti-prostate specific antigen scfv
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
243
structure length
226
Chain Sequence
b'ALTQPSSVSANPGETVKITCSGSSGSYGWYQQKSPDSAPVTVIYQSNQRPSDIPSRFSGSKSGSTGTLTITGVQAEDEAVYYCGGWGSSVGMFGAGTTLTVLGAVTLDESGGGLQTPGGALSLVCKASGFTFSSYAMGWVRQAPGKGLEWVAGISDDGDSYISYATAVKGRATISRDNGQSTVRLQLNNLRAEDTATYYCARSHCSGCRNAALIDAWGHGTEVIVS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antibody scFv B8
publication title Reconciling the structural attributes of avian antibodies.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Immune system
total genus 59
structure length 226
sequence length 243
ec nomenclature
pdb deposition date 2014-03-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4p49A01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4p49A02
1CFQA 3QIWA 4MJ6B 4WWKA 4DQOH 1OM3H 5ESQB 3FQXB 4KC3B 3NA4A 5F7EH 1OSZA 4NCDA 1S8DA 4TUOA 1XGPB 4YBQC 3RGVD 3QDMA 2DD8H 2DB8A 1YECH 3D3VB 1B90A 2HFFB 5DJYB 4ODSH 3RFZC 5LXGL 2W59A 1F3JA 3VMOA 2NTSP 4RGNC 3SGEI 1XGTB 4D9QD 4JFXA 1ZLUH 5IB4B 1K4CB 4OFPA 1B3JA 3B9DA 5CIPH 4QF1A 2Q87A 2YR3A 2D31B 3QDGB 5DF0A 1A14H 4Z7VA 5IHBA 3RKDC 3MUGA 1AHWC 4K94H 3P9WB 2EKJA 3CH8A 1ACYH 1OCWL 2VL5B 1T1YB 4APQD 4U1KB 1I8IA 2Y36H 1WAAA 4X98B 4F57L 3HNVL 3I9GH 1YEFL 2XYCA 4X9IA 4X4ME 4K8RL 5HI3D 4R8WL 2JTDA 3VGEA 1FYHB 5EC2B 5A2JH 2OK0L 5FV2A 3VXSB 2F5BH 5KSAC 5I19L 1DR9A 3E6FA 5FB8B 2BERA 1I9RL 3BQUB 1ZLVK 1MFBH 3MRGB 2VISA 3ROLB 1NFDE 5GSRB 1UA6L 4HULB 2MKWA 3MCLH 5J9PB 2XY1A 4R7DB 1NBZA 1FVCB 3V52L 1WITA 4HV8B 1EBAA 1BOYA 2HTKC 2O5ZH 1I75A 4F9LA 2FGWH 3WBDA 2C3VB 5D7LD 4YXKH 1U3HC 5I15H 2BOCA 1QSFD 5DJ8A 2YC1B 1W72L 3RNKA 2DQCH 2R2EB 2CUHA 2EDNA 4M9OA 4MD5B 1P4IH 2AQ3A 4JKPH 4BYHA 5FYKL 1NGPL 5GRVK 4NZRL 3B2VH 3ZDYE 4TVSa 3RVWC 5LBSH 4P4KA 1F02I 2IFFL 3L95A 1U92A 3VA6A 2XIDA 2YK1H 4D0BA 1I1FB 5J56B 1P5UA 5T5NG 3WLWC 5JQ6L 3TA3D 3ZDYF 4ODHH 5DHXB 3FO2B 4APQA 4P3CL 2HAZA 1P7QB 2MCPL 1XCTA 5F1KC 5T3XL 4JFFE 3VW3L 3BW9B 3HLAA 3MZTA 2Y7QB 3TFKC 3SJVD 3KHOA 2ICEB 1BBJB 1HHKA 2VXVL 3ARFD 5BXFA 1PKOA 2D7TH 1CFSA 1MRFL 1OLLA 4XNUL 4M43L 4XX1G 4ZPTB 4PJ5B 5EORH 5IB1B 1XF1A 3V8CA 1KCSL 2CKNA 4MJ2A 5DQ9B 4F58L 3THML 3IJYA 3INUH 1PG7L 4YHNA 4R2GB 5FEBA 4NKDB 2X41A 2E6QA 3FQWB 5J1AA 1ED3A 3BKML 5IB3A 4XHJC 2HT3C 1FH5L 1Y6KR 3V5HA 4ZFFB 2CLRA 1QLRB 3VH8B 1MRCL 4NO2B 3NACH 1A6TB 3NFPB 5FOJA 4XXDB 3E1F1 2CIKB 5JQHC 1GGTA 1FLRL 3U7YH 3VGBA 4I2XE 1MWAA 5EO1B 3K8MA 1D6VL 3PL6C 4AMKH 1J8HE 2DDQL 4LDLB 3MROA 3NA9H 3TEUA 4MNHB 4OI8A 3MRFA 2EIBA 2R9HC 2X4UA 5IW1B 3O0RH 4FQLH 2Z35B 4G6AD 1T2QL 3BSZH 2FX9H 2PW1B 4F9PC 5B8CB 1LO4H 3TA3A 1T5WB 3MXVH 1T3FB 1I8MB 1AE6H 1BFOA 4QLRA 2WUBL 3TNNB 1XIWC 1VADB 2EH8H 3IDJA 2A9MH 1OP3H 4PB0L 1QRND 3NH7H 4Z0XA 4GQPH 1IQDB 1NL0H 4KJQD 1RSFA 5IEKA 1KB5A 2JK5A 2XKUA 3IAQA 3QEQB 1EAPA 2CO7B 2CPCA 4UNTA 2EDQA 2F54B 5BQ7B 4GG6A 4LLQB 2IBBA 2WBJB 2NY4B 4JPKH 4ODTH 4OZHA 4ZUSB 5F3BB 1BLNB 3ZHKA 3KPLA 1CK0L 1KEGL 2NW2A 4JY4A 4QXUL 1ZANL 4H5SA 1G1YA 3LMJL 2WW8A 4CNIB 2V2TA 4P46D 2RQ8A 1T03L 4KHTL 1Q1JL 4P5TC 1YEGH 3RDTB 4PGCB 1MCOH 3TVMA 4U1MB 1W72A 4PJXF 2FR4A 5C0BE 1MUJB 4NHCH 1E4KA 1FO0A 4U1GB 2D0GA 1UKQA 1EBPA 2YMXL 2QADD 3WSQH 1X5LA 1GC1L 4OFVA 4WU5B 4NO0B 1HKFA 2IAMA 4CUCA 4JN1H 2ILLA 3MRQB 4L3EA 5B39A 4URTB 1IM3B 3BIKB 4UDTB 3RWIB 3MGTB 4M03A 5MI0B 5JDSB 1RIVL 4O2FA 4AEHH 4PTTA 4HWNA 2AGJL 1YQ2A 5DI8A 2NX5B 3UTZA 1A7QL 5EBWA 4L9LB 1HIML 3GBLA 3T8XB 4HJGB 4ZXBB 3D9AH 3WHXA 4OUUA 2QR0B 4XZUB 5C6TH 3O6FD 4JZOA 4NBXB 4FQ1H 1QRNA 5IKCA 5C0CD 1HH9B 2E8YA 4QNPE 5IB2B 1DBJL 3FTGA 3QUZD 3QHFH 4R4FL 3TBSA 4UNUA 3P9LB 1ZGLM 5E6ID 4ZDHB 5EBGA 3IXAA 3OKLA 2I9LB 1A3LL 1IT9H 3W0WE 4ZUTB 2J8UE 4PV9A 1BQHG 2Z91A 1RIHL 2ATPB 5GS0C 3QG7L 3B43A 4HFWB 4JCMA 3Q2CA 4RNRB 4Y16B 2QQKH 1WGOA 1QR4A 1IGCL 2Y07H 4QY8B 4X8XA 5IQ7H 4C56B 1PQZB 1L7TH 4ONGL 1MHPL 1Z9SA 3GHBL 1NC4D 4JO4H 1F4XH 4I0PB 3RVXD 5C0FB 1DBAH 5D72H 5I1JL 3HZMB 1SVCP 3GMRA 3F58H 4WI6A 3ARDA 4G9FE 3SGKC 3QCVL 5E24E 4WIQA 1P4LB 1GZQB 2BXZA 1JZ3A 3RKPA 5J57B 3MGOB 5EU4B 2ZUQB 3ZL4L 4PLJD 3G5XB 2VDOL 4MA7L 1OT1A 1MAJA 2EEBA 3CFKA 1NCCL 2CMRL 2QEJA 2FZ3B 3U4AA 1SHMA 5F9AC 5B4MC 2C1OB 5GS1C 2HKFH 4MB4A 3LEVH 5CBEA 3T1FB 1M05B 4BH8A 1QEWB 2L7JA 3LV3A 1S7WA 5EIIB 3F7PC 2YEZB 3HRZA 4FQIL 5L0QC 2Y06H 4Q0XL 3QUZA 5HI4C 3LPFA 1U8NB 3MRIA 2UUDK 3RHWF 1MLBB 2X4OA 1A6ZB 4QXGH 5HYJD 1AC0A 4PP2B 2JJWA 1RUKL 4PREB 4G43B 3FO9B 3KS0H 4MXWH 3BEVB 4UB0H 3GSNB 1HCFX 4NNXB 1FVEA 4LSTL 1JGLL 1VFAB 1NC4A 1Z5LA 3O6KL 5A3ID 2OR9H 5CGTA 1CFQB 4WWKB 4MAUH 4P2RE 2AJXL 1MI5A 3PHQB 2ZOKA 4DZBA 3VXNA 1E6OL 3QDJD 1X9QA 3BGMA 3BYYA 4I5BB 4TUOB 4K3GA 1ZHLB 3QDMB 5IF0A 5GGVH 4PLKD 1NANH 1YJDH 2O5YL 4MQ7A 1F3JB 1S5HB 2AXFA 4Y5XB 4O2CA 4U1HA 1A6AB 3VI4E 4JFXB 4O5LH 3SY0B 1EK3A 3HUJF 3H9SE 2KKQA 1EUTA 1I9JL 1KACB 3HE6C 3V6OA 1QHPA 4ZTPH 3BQUC 3TGXA 4R0LA 2DM4A 3MUGB 1FGNH 2EIDA 5B21A 1HOCB 4QHNA 1I8IB 12E8L 3VI3E 2A6KA 4Z8FL 1N4XL 4MAYC 5F6HJ 5AD0A 4L4VE 5HYJA 3VU2A 4BQ6A 1S7XA 5C3LD 4P2CG 1RVFH 4OCRH 3VI3F 4K3DH 4LEXH 2PXYB 4LLMB 1FG2A 3R06A 1X5IA 5JXAL 1HZHL 5JORA 4QRRE 4YEFA 2CKBH 4K7FB 4PJIF 2VISB 2Y9RT 3BYTA 2BY2A 2P5EB 4TNVK 4OFDA 4BK5A 3QQ4A 2V7NA 3CD4A 1NBZB 4LMQI 4YDLC 2GAZA 4XP9H 1XCQA 5IWLA 2P7TA 5H2BA 3P73B 1MFDH 4IRZL 3V4UL 2O61B 1UACH 4YFDB 3WUZA 3C9NB 4NZUL 3H3BC 3ARTA 4I9WD 2BOCB 5DJ8B 3RPIA 3RNKB 2JE8A 1U6AH 1ES0B 3KYKL 4JRXB 1PX3A 4MYWB 4KY1H 2W9DL 1KTRL 4X6CF 5IHUH 4ZO8A 5JZ7D 3CVHB 5FCUL 4C83B 5C71A 1G9EA 3STZA 2V6HA 1BD2B 3EO0A 5E99H 2Q86A 2V9QA 4F80A 3L95B 1U92B 5FGBA 1ZT4A 4FQXD 1U42A 5D7JC 5BZWA 3S37H 4DVRL 4YX2H 3LRHA 3EZ8A 1ZGLP 3QRGH 4R2GC 2R56L 5F70A 2Z93A 4X6DF 3VJ6A 2R4SL 2HJLA 4WTZG 3FO0H 3DARA 3GSXA 4FXKA 3HLAB 5EULV 1HSBA 4MA1B 3C8DA 1S78D 5BXFB 4QCIA 5KBNC 1AXSB 4OF6A 2FBOJ 4U6VL 1NC2D 2YD7A 2EH7L 4POYA 4XAKD 5T33L 4WI8A 4Y8DC 3NBNA 5KN5A 4NKMA 1PKQE 3SDDD 1QFPA 4I0KA 5IQ9A 2X7LA 5F1IB 1ITCA 3IJYB 4LSUH 4YHNB 1GPOH 1IC5L 4TTDD 4NWUH 4U05A 5ISZD 4HWBA 3OBAA 3GIZH 5DD5H 1AQKL 1ED3B 1JRHH 5IB3B 1HHHA 3HE7A 4FOMA 1AGBB 1HE7A 3V5HB 5BMFH 4U3HA 1OAQL 4G8GD 4TSAH 1IILE 5MEND 5BOPA 1NGQL 3VXQB 5B8CC 2QSCH 4XNXH 2KBGA 4LFHD 5E8EA 1ONQA 4IDJH 1II4E 3IDXL 4NQDD 3RRQA 1LP9E 1BPVA 3TBVA 2NY2B 4OJFL 3MROB 5CEYA 4RISL 5DVMA 3Q6GH 5C0RL 4OD2A 1MCBA 5ELIA 2ERJB 2GTWA 4HK3J 2KPNA 2F8VA 3VFVA 5E7BA 5E56A 4H1LH 5KVMC 3KPMA 1TVBB 3F62A 4FQHB 2G5RA 1F6FB 1EO8L 2X4RB 5E03A 3ARED 3KHQA 5CJXA 1UWGH 5AYUL 3IDJB 5C0AE 2QKIB 1I1RA 4Z0XB 5I1DA 2LU7A 1N5YH 2A6JA 3RDTC 2JK5B 3TT3L 1WV7T 4PGEA 1EAPB 5KJRH 4F7PA 4N68A 1QFWH 5C92A 4U1GC 4CL7A 1INQA 3QDAA 2E27H 4OZHB 4C4KT 3HUJA 4QRPD 4PJDF 3SDDA 3KPLB 4WHYG 5FUOL 1LVEA 3U4BH 5DEZA 2ZSVA 4RMQA 3PWPA 3Q48A 4JM2C 3RU8H 3T0EE 3QPXL 5E0QA 2V2TB 3EOTL 2Q8BH 4PFEA 1A7RH 3RWCA 2FR4B 3TVMB 2BCKB 1W72B 4DCQA 1MJUH 4L9LC 3PUCA 4G6ML 5E9DE 4XPGL 1HH6B 4LCUA 5EU6E 15C8L 4YXHH 4ZXBC 4Y5VA 4RAVA 2WM0A 5HHNA 4WRLA 3X3GH 4PJFA 4HUMB 3UC0L 4NQDA 2XN9A 2IAMB 3NAAL 4LHJB 4L3EB 3ARYA 4HIJB 4WHTA 1A8JH 5IOPA 5JOEA 4OSUH 5E4EB 1FNEB 1Z0NA 3UTZB 1H5BC 5EBWB 2Q7YA 3ULVL 5DLML 1EHXA 5HHME 3N85H 3SBWC 4M48H 3WHXB 1F6AA 1XGUB 4OUUB 3LKSA 3EOYG 4M6MH 1OL0A 5DRWB 2ENYA 1DN0A 3RVVC 5I18L 1KLUA 4JVWA 4P2OA 5IKCB 5GJSH 1EEQA 2V7HA 4J4PC 5BS0B 2VLRE 2WNGA 3FT4B 4NWTH 1BQHA 5FYJD 3TBSB 3EKCA 2GHWB 4Q9BA 4PUBH 1Q0XH 4F7CA 3OKLB 3G6JF 4PV9B 3TV3H 4TN9A 5KTEH 2Z91B 4X83A 2PR4L 5F3HA 3R0MA 2IG2L 3DI3B 2YKLH 1JGVH 2VLME 2X9XA 2Y5EA 5AG9A 4ZYKA 3EDKA 2X05A 2CQVA 5E1AA 3G5VB 4L8SA 5DRXA 2H26A 2OYPA 4AEIH 3BKJH 2GYSA 1BZ9A 3U0PB 3GMRB 2ZCLH 1LO0L 4KKCD 3ARDB 4XVTL 1V5JA 3TO4C 1ZLSH 5E7FA 2DLIA 3QUYB 3GJFA 3DRQB 3RX7A 1JPSL 3PWLA 3S3JA 1MRDL 5HVFB 4NO3A 1F8TH 4DGVH 3QI9C 4U1SA 1NCAH 3GM0A 5IT2L 1JVKA 5D2NA 2ZUTA 3DO3A 4FFVC 5CJQL 1G0DA 3GK8H 5SWZE 4EQ3A 4JLRA 1OTSC 4JPWL 3GIVA 5LCVL 2NY0B 4WW2B 1NFIB 2HYMA 2IQ9H 3MUZ1 5CBEB 5CLTA 1TNNA 4LRNL 2VMFA 1S7WB 3GRWL 3QIBD 3HRZB 3OAZH 1A6UH 3HB3C 4I48A 3SE8L 4LNVA 1W8NA 3QIWC 1G1CA 3RAJH 3LSOB 1AIFA 1VEPA 1EDQA 4RRPA 2ZSWA 3MRIB 3TNMA 1RD6A 3KGRA 1V3JA 2MFNA 2ORBH 2F53D 2HT4C 3JWDC 3LEYH 5E8PA 4U49A 3ZTNL 4WUUD 1SMAA 1FL3A 1I1AB 2BSRB 2YPLD 1JFQL 1KFAH 2OXHA 3EBAA 5KVDH 3CLEH 4I3RL 1F42A 3BOVA 3VFNB 3FRUA 5TE6L 3NCBB 4DFHA 1MI5B 3ULUC 4DZBB 3VXNB 4D3CL 1A6WH 2DWDA 5SX5K 1P4BH 5DFWH 3B9KD 5IF0B 3MREB 1MCCA 1CWVA 2BSTA 4MLSA 1JCKA 5TDOA 5CINL 2ADJA 4MQ7B 2AK4D 2KQNA 1I9IL 3T0XA 2AXFB 1G9NH 1AO7E 4JDZA 2ICWJ 4U1HB 4KTYA 5K9KA 1YPZA 4LP4A 4YDKL 2X2YA 2F19L 1Q72L 3GMNA 4KPHL 4WO4A 4X6BA 2IBZX 4QKXB 4LDEB 4BQCA 1DBKL 1UKTA 1YNLH 4OCYL 1AGCB 4ZPVA 3X13A 3BIAX 4IOIA 2GTZA 2DICA 1UM5H 4N8CL 2X6MA 1FRGL 4H88H 4ORZC 5GS3A 4TNWF 3NABH 4J7RA 1KELH 4LHUG 1C16A 3BUTA 1IC4L 5IFAL 3ZSTA 1WISA 5GIRB 2F58L 3O3EA 5AD0B 1RU9H 1HNGA 3O81A 4F9LC 3RGVC 5I8OH 1MH5A 2NY7L 5BRZD 4POZD 5DSCA 3KYOA 4WUUA 2AP2A 4K7PL 3IETB 5FHAL 5JORB 3CZJA 3HC4H 4P23B 4PV8B 3WNKA 5I17A 3H7BA 5GS2D 5LGKA 3RZCB 2A38A 1CICD 5HVWA 4LLUA 3ARWA 3RX8A 3U1SH 5L88H 2CDGB 2V7NB 4GAGH 3IDNA 5DT1L 4D94A 4PG9B 3HRPA 1XCQB 5HHOD 5TPWL 4P4KC 4FTVB 2P7TB 2OJEB 3HZKA 4ZMAT 2EC9U 5D71H 5GZND 1UZ6E 2YOCA 1LWRA 3OSKA 4OTXH 3LKRA 4APQC 3MMEA 1YY9D 1ZHBA 3MA9L 4HUWA 4Z0BH 1NCUA 5D7IA 3DSFH 2I9TA 1ZLWK 1U8HA 3L5XH 3P30L 4WTXA 4BM7A 1NSNL 5JW4Q 4JPVH 3STZB 5DMIH 3S5LG 3UTPE 2X89D 3P4NB 3EO0B 4OQTA 1WC7A 5GRXG 4E0RA 4S10A 1Z3GH 4HH8A 1FZKA 1V7ML 1ZT4B 5J13B 5BZWB 5J3HC 1W8OA 4WTZA 2R0KL 4JHWL 5EBLA 4QGTA 2DMBA 2MHAA 4FHBD 2B5IB 4NJ9H 2N7AA 2Z93B 3LB6D 3REWA 3VJ6B 4UZGA 1DLFH 3EJYD 3O2DH 3W82A 1UXSA 4FXKB 1HSBB 4XB8A 1FZMB 3HR6A 3EYSL 4BQBA 4HT1H 4Y19D 1KN2L 1N0XL 1KEMH 4IJ3C 4KK8D 2HH0L 1GAFH 4M7ZC 1DVFD 3TWCH 4X9GA 4AM0B 5KN5B 2CK0H 3P4LA 3DUUA 3JUZA 4GKOA 4I3GA 1CE6A 5IQ9B 4YPGB 2NQCA 2X7LB 3MO1A 2WZPD 1AGEA 4KMTH 4N8PA 1CICA 3MV9E 2NY2C 4H0GA 5F7EL 4ORGA 3ZHLA 2UZYB 4WY7H 3MV7D 1MJ7H 3EO1A 1ADQH 1HHHB 3CFCH 3HE7B 5HI5C 2DD8L 4WI3A 4XMLL 2D03H 1HEZA 1YC7A 1YECL 4YNYA 3TO2A 3TA3C 4X99B 5E8EB 1OSPH 5HVGB 4D0DB 5CBAA 4ISVA 2BNQE 3BEWB 1KBGH 3KPSD 4N8VB 4L9DA 1TTGA 5GGQH 5CEYB 2V5SA 1WZ1H 1G6VK 3QXUA 4OD2B 4P57A 1N26A 4C59B 1RJCA 2OCFD 4LQFL 1S9VA 4N0UE 4K94L 4NN5B 1DSFH 4XCYB 3VFVB 1D5BB 1YY8A 3FZUD 5GHWH 3B2UD 5JIIA 3KPMB 1SM3H 4ZODA 2Y36L 4LCCA 43C9A 5DQJB 4G9DA 5C07B 5K59E 4L29B 4P5MA 2ZNWA 3P4OA 5H8DA 2A6JB 2OR8A 2R8SH 3TVMC 4QWWD 4DUVA 4PGEB 4Y19A 5K59F 4F7TB 3IVKB 1E4KC 3REVA 3PDOA 4YZFE 1NGZB 1NQBA 1YEJL 3MCLL 2IAMC 1Z9OA 2ZSVB 1TITA 3PWPB 3O11A 1FAKT 4YHYB 3I6LD 1RMFH 2EDKA 4FNLL 5E4EC 2C3XA 2O5ZL 3T0VA 2EEDA 2FGWL 2YUWA 3T77A 3WJLA 4YXKL 4DCQB 5I15L 2XRAH 4OZIB 1IKNA 3VFWA 2DQCL 4LCUB 1CGSH 4FFZH 4QHLA 5E5MA 4RAVB 5HHNB 2E9IA 4G5ZH 3O4OB 4PJFB 4PR5A 5I1LA 1P4IL 2XN9B 2Z92B 5EH1A 4BELD 4OLVL 4Z7OF 3KPSA 4WHTB 5IG7B 5IFJA 5IOPB 4PJBE 4XWOD 2BNUB 2NY5L 2YK1L 4V1DE 5I9QB 4FQCL 5ID1B 3NGBB 5CP3A 4ODHL 3W81A 3MRDA 3CU1A 2DQTL 3BRGC 3LKSB 5F9OH 5AUMB 1DN0B 3DPBA 4FABH 1KLUB 2EDWA 4G7VH 1OP5K 3ZKND 4KK5D 1SEBA 2D7TL 2VDPH 1BQHB 2AV1B 4NN7C 5FGCE 4F7CB 1DQML 5EORL 3U7WH 4NQCE 1IE5A 3ARDC 5DJ2B 1HXYB 3QCUL 2CR3A 2XZQH 3S36H 3RIFF 2CRIA 3MLZL 2XZZA 4ZYKB 5K9OB 3WDHA 4ODWB 2K1MA 2NXYB 1A3RL 4L8SB 5DRXB 1YNTB 3WS6C 3NACL 4E41B 4UU9B 1BZ9B 5HPOA 2G75A 4E5XA 3U7YL 3HMXA 5CIPA 1MJJB 1J1XH 5K9QG 3ALXA 4CVWA 4AMKL 3IB4A 4ONHA 3NA9L 4KQ4H 3U9UB 3QUZC 4NO3B 1IAOA 3BH9A 1PYWB 4RCAA 1VPOL 5D2NB 5KSVA 4FQLL 3IRPX 5CZVH 2V2XB 3CC5B 3QO0A 1RK0A 2FX9L 1JP5A 2EEAA 1LO4L 2MMXA 3M45A 3SDCB 1AE6L 1Q94A 3GIVB 4MB5A 1LO2L 4GQ9H 3QB7C 1HINH 4GXUN 1TQBB 4CW1A 3UYOD 3Q6FA 2VE6A 1Y18A 4LHUD 2A9ML 3NH7L 1KC5L 1N8ZA 4JANA 5C0JB 1NL0L 2IANA 1MCJA 4I48B 4JHBA 4Z5RA 2WP3T 3UBXG 1AIFB 2G9HB 1CDBA 4PJ8B 5C8JA 2ZSWB 4OV5B 3QEHA 2ZUXA 3TNMB 4JPKL 1CN4A 2EECA 5F9WB 4Z7QE 3SOBH 1OAZH 3EIFA 4EXKA 4JKLA 1CXLA 3LS5H 4YE4H 4DOHB 2W0FA 1EUUA 1S9KC 1RZ7H 5DHVH 3C6SB 4LPWA 4M3JA 3B9AA 2VDNH 3I02B 5I1AA 1MCOL 1IQWH 4MQXC 5DJCA 2IBZY 5IVXF 3FRUB 4R96B 1DDHA 4LPUA 2ATKA 3SDXE 3V6OC 3OJ2C 4GW1A 2GFBA 1IKFH 3UJTH 2EYSA 4R0LC 1IAKB 4PRAA 5FK9B 5J6GA 2I60H 5JOPE 5LAXA 3SDXF 2GT9A 4AEHL 4AG4L 4HK3N 2ADJB 1MIML 1QPXA 5I75B 3V5KA 1YPZB 3E6HB 3QFDA 5JIPA 1YEHH 4AK1A 2VDLH 4GAJL 2Z0BA 1PW3A 4YR6A 4X6BB 2ED8A 3QUXB 3W5MA 2OBGA 5C6TL 4ZPVB 1TLKA 5ICXA 4M3KB 3TM6A 4FA8A 5KVFH 4LHUA 4JN2B 3WXWH 1K4DB 2B1AH 3WO4C 3DO7A 3QHFL 2E7HA 4L4TA 1KB9J 1T1WB 1CLYH 3HAEH 5D5MF 5DEGA 2YUZA 3EYFA 1C16B 1IT9L 2GITA 1BOGA 3O3EB 2VLJD 2QQKL 3VGFA 3GO1L 3MV11 2BVUA 2AEQH 3DVNA 4WFHE 3BWAA 4GRMB 1L7TL 4WHCA 5EU7E 1NAKH 3BISA 1NBVH 3QT2A 4DVBA 4X80H 1YYML 3HNSL 3P4MA 4Z6AT 2X5PA 2B0SH 1DBAL 4LLUB 4DEPC 3B5TA 3RP1A 4PRPE 2DQUH 2IQAA 5CCKH 2BNRD 1A6VH 1R3IH 2PCPB 3JTTB 5L8JB 1P1ZA 1CBVH 1CXEA 4MJ4A 4M6OH 1TMCB 1JTPA 1GGBH 2XI9A 5FGBC 5J13C 1IGYA 3V8OA 1SJEA 3QEGH 1YEDA 5FECA 4HXAH 3QFJD 5DD1H 1BVLB 3FQNA 5I8KL 2B5IC 2LVCA 3LKRB 4TOYH 3AFLA 4OZGB 3H2WA 8FABA 1OGAE 3S5LA 2I9TB 1U8HB 3P3YA 4H1LG 3W2DH 2HKFL 2AW2A 4J3UA 3LEVL 3K3QA 2P47B 3NTCH 3GBNH 3HI6H 1I7UA 1T89A 5EUOF 4ELKB 1F4YH 1FZKB 2FYYA 2HFGH 2XFXA 4W6XB 3DRTA 5EBLB 5K33A 5FAAA 2MHAB 3VFOA 1UQSA 5T3ZD 2FEEL 4XGZA 4JFHD 3REWB 4MJ5B 4QXGL 5D93C 3T3MF 2VOTA 1A21A 1H3GA 1UXSB 2AS5M 4X4MA 4HX1B 4IMLA 5HHQB 4UB0L 4MXWL 2EXYC 3Q5TA 1CVRA 1BWMA 4PJAE 4DK3A 5D7KE 2DQDL 4JAMA 2OR9L 1FQ9C 3I6KB 1CE6B 3O4LB 3UTTD 1MCQA 4KV5F 1NFDA 3RQ3A 3DURB 3MV8B 4NZJA 1QD0A 1DCLA 4BA8A 4ORGB 4RFNC 3I3BA 2BNRA 3UDWC 5B3NA 3UJIL 3N0PB 3B3IB 5GGVL 4NN5C 1HEZB 1PEWA 3GBML 4YNYB 5EG6C 3AY4A 3DOSA 4ZFGH 3TO2B 3QNYA 2ESVE 1JMXA 4O5LL 2W38A 3BH8A 1G7MA 3IDGA 2VSCA 5JOFA 5CJXC 2YRZA 5CBAB 3CDCA 3DETD 5HHXL 4JR9H 5IJKA 1S78C 3QUML 3GMMB 4ZTPL 1R0AH 2IADA 3SE3A 4OKVA 1S9VB 1BWWA 4ZFOA 1HQRA 2APFA 4S1SH 1YY8B 2DIAA 5L2JB 1FGNL 2C1PA 3SDDC 1FZOB 3DMMD 4K55A 4LCCB 1ORQB 3ZSSA 1RV6X 4DUXA 1KCLA 3DV4B 4UQ2B 4JFFA 3P4OB 1E4XH 4NM4H 4K3DL 4PJHE 4LEXL 4ZOBA 1WCQA 5IBLD 4Y5VC 3SCMB 2VC2L 3BGFB 3REVB 1NDGB 2VKWA 4ODUB 4HJJH 4KROC 4JRYE 3MLVH 4HZLA 5LWYL 4XBPB 3O11B 1O7SA 3BP4A 1ZA3A 3WUWG 4FQPA 2H32H 4MNQE 4UILL 4R90H 1MFDL 5EU5A 1UACL 4JFDD 3T4YA 4IOFD 3JWOH 3T77B 4GUPB 3C2SA 3KPOB 3UYPA 1Q9LA 3VFWB 1PY4A 3HFMH 4QHLB 5E5MB 5KVGH 1BQUA 4KY1L 4ZNEE 4GRWF 4PR5B 5I1LB 4I2XA 3VWKB 5GISH 1LEIA 4P2OC 1J8HA 5HGHA 3IAPA 2HG5B 1Z6JT 5ITBH 1N3NA 4GRLA 4PJCA 2HLFD 3EYOB 5E99L 3LS4H 1V3KA 1YMMB 1SYVB 4YX2L 3S37L 2HRLA 5GGRA 1FNAA 1UM4L 1KGCD 3MRDB 3QRGL 4C57C 3LEXA 3O2VH 4BH7A 1QLEH 3FO0L 3RWDB 2AK1H 1EV2E 1EZVX 4LPTA 5D70L 2NXYC 4XPAH 1KJMA 1KJ2H 4G3YH 4JDTL 1UJ3B 4KVNL 4L8SC 4PRBB 3N1PC 3S35H 2NNAA 2A74A 5IVZB 4FRWA 3HG1E 5D8JH 4R6UA 5JDJA 2OR7A 5MERB 4LSUL 2GQHA 3KYAA 1GPOL 2LV4A 5I1CH 3GIZL 1JRHL 4JY5H 1KXQE 5D2NC 5E2VH 1NGWA 3IFLL 5F7DA 5BMFL 3NPSB 5J0BA 3WL9A 4JFDA 4TSAL 4M6NH 5C0BA 3D85D 4MS8C 3TZVA 2ZJSL 4DGIH 1CFTB 5CIPB 3I85A 4RX4D 3FFCD 3MRMA 2JCCF 1N6VA 3L5IA 4YHKL 3ZKMC 3PNWB 4ONHB 5MEOA 1G84A 3Q6GL 2VDRH 2WK2A 3GJFK 1BD2E 3IDMA 5DK3A 3SE4A 1IAOB 3BH9B 1Q38A 2CGRL 5KSVB 2NPLX 5TH2A 3RJQB 4BFIA 1WIPA 3QO0B 3FT2A 1RK0B 3QIUD 4OCNC 5DJXB 4HIHA 1FL5B 4XCFH 5FUZH 5A43C 1Q94B 3S96B 3RY4A 5F6HI 2QQQA 1UWGL 1Y18B 2SEBA 5DDHA 3RTQD 2A1WL 3AVEA 1N8ZB 2GUOA 1BJ1H 4JANB 5JW4R 1PDKA 5EZLB 1ZVHA 1MHEA 4Z5RB 2CKBA 5AAMA 5KJRL 1QSEE 1QFWL 3SQOH 4Z78A 2C26A 5D1XD 1WBYA 3W0WA 3OB0K 3DXAD 5E5UB 3W9DB 4JJ5A 4TVPD 2HA1A 1KIQA 3QJHA 3FOLB 2VTFA 5MEPA 2W0FB 4DFIA 3HPLA 3QAZB 2FWOB 3RU8L 2G5BA 3N1MC 4XHQA 3MCG1 3UROR 3B9EA 4MJIE 4X4YA 5I75C 5I1AB 1EFXD 1MJUL 5DJCB 1AJ7H 1AKJD 5FYJU 1DBBH 3G04A 1U36A 4WO4C 3U9PL 3NCYS 3D85A 4OLYH 2EXWD 3X3GL 1IBGH 4K3EH 1RUPH 3N06B 3OKOA 4GW1B 1X5GA 4G9FA 2GFBB 3FJTA 4IRSB 1FNSH 4P9HH 4DUWA 3OGOE 3OB8A 2EIEA 4PRAB 2VIRA 2EDYA 5J6GB 1L6ZA 5LAXB 2GT9B 5KZCD 5HYFA 4Y2OA 4OSUL 2FX8H 1CFBA 3BHBA 4HGKC 3KPNB 1DL7H 2HVJA 4JDVA 4EUPA 4UDUA 4ELMF 4O51A 3QFDB 3RUGE 1O5DT 1BX2A 2HKHH 3QIUA 4J6RH 4XXCA 5B38G 4M48L 2EDJA 4RMSA 4M6ML 4LK4A 3WFEH 1SJVA 3ARBA 3RUGF 1C5CH 3CDFA 5ICXB 1EJ6A 4MLIA 4XB7A 3RTQA 3F7YB 1QBBA 5GJSL 3VXRD 3KPQB 2GJ6E 4L4TB 1X5XA 1QG3A 5DUBB 2GJJA 5DEGB 4PUBL 1Q0XL 2H2PD 4X5XA 2GITB 3QR2A 3TV3L 5KTEL 3UX9B 5D1XA 3TH4T 3LRSA 2OX5A 1OB1A 1GGIH 2XWBA 2YKLL 3DI2B 4OAWA 1JGVL 1KV3A 2EZ0C 3SGDH 4W6YB 3DVNB 5GGUA 3FFDA 2VITB 2MPAL 4CVXA 3CFBA 5IP4A 1KLFA 4XBGB 3OXRB 1M7DA 3S3PA 4BFBD 5I0ZA 5JW5A 4DVBB 4HIXH 2J6EH 1EFXA 3BKJL 1CDJA 4O58L 4D8PB 4P2RA 4PRDA 2ZCLL 3VGGA 5FO9A 4DK6A 1P1ZB 2NZ9C 2DL2A 5E2TH 4O2EA 4DAGH 4GAFB 4PYHA 5FYKE 2FEDD 3LKNA 3RA7H 1XFPA 2W0LA 1MFCH 2OL3L 1F8TL 1N2RB 1NCAL 5EUKA 1R3LA 2OXGA 2H3NA 2HWZH 3VRLE 4HWEH 3AB0C 1C5BL 3ZYJA 4NC1C 4PJGE 4JY6A 3GK8L 3H9SA 5FDYA 3ZT6A 1PLGH 4HFUH 1A2YA 1HYRC 1FG9C 4POZC 5T3XE 1P5VA 3C5ZD 4PJGF 1I7UB 3QA3A 3I75A 1A6UL 2FYYB 2XFXB 4IIQA 4EIGB 4M62H 2IGFH 1OAXL 3ARGA 3RAJL 3KNBA 1D5ZA 4JB9H 2IPUK 1RAMA 1CICC 2CLVB 2QHRH 2ADGA 2P8MA 3IJHA 1CG9B 4CDGC 4EDXB 4LLDA 2NY6B 3STBA 2W07A 2AJYH 3LQMA 4L4VA 1D7FA 3LEYL 1UGNA 4ZAKD 3MSPA 32C2A 4Y2DB 5GZNC 1D3CA 2CXKA 4XPBL 1WF5A 4GT7A 1TCRA 4PJ7E 1KFAL 4QRRA 4RGNE 4NNPH 4JAMB 3EJZD 5BV7H 5DMGD 3NN8A 1YY9C 3VRJA 2R23A 1NFDB 1MIEH 3MRRA 2P5WE 2GK0A 4PJ7F 5H35B 1UCTA 3P2TA 4GMTL 2PKDA 5D2LF 5IMKB 3MBED 2KZ1B 3Q5OA 3ZKXC 1BEYH 1RHHA 2J1KA 1P4BL 4OM1L 4MA8H 4IDLA 4PJEF 3K2UL 3O6MH 3S97C 1JZ2A 2FLBT 1AI1H 4P59L 1P84K 3C09C 4EDWL 5TDNA 3L1OH 2J4WH 2R2HA 4JZJC 3QNYB 2EYTA 4Z7WE 2XT1B 5LXGH 1NCWH 3BH8B 1IRAY 1G7MB 5JPMA 2UYLA 3LB6C 3IDGB 5E94A 3SDAA 5HD8D 5JOFB 1SBSH 1YN6A 3EJYC 4P46B 3U79A 2IMNA 2FEEI 1WEJH 5IVNA 2UWEE 2MQ0A 3FOMA 2DJSA 4GXUM 2IADB 4YHOH 1UM5L 3C5ZA 2CDFB 3VCLA 3NIFF 1HQRB 2XQYG 4H88L 4XNYH 3VG9B 1FJ1B 5D1QD 2C1PB 2UWEF 3KXFE 2E7MA 1KELL 1PSKL 4CMHB 1J8KA 1B0WA 3IDUA 4F57H 1EJOH 3ARZA 2VLKD 4XVSH 4Q2ZA 4JFFB 4LKCB 5I8OL 4K8RH 3WJLC 4R8WH 4EI5A 4PBXA 3QJFB 1YMHA 1IKNC 3HA0A 2NR6C 1RZ8A 2Q8AH 2IMMA 1FFPA 4L8DA 1RJZA 5F1NB 1I9RH 1R3KA 2PTVA 4Y7MA 3DGGA 3V95A 1JGDB 5IW6A 1NANI 3WUWA 3O6FB 3U1SL 5KG9A 3SPVA 1UA6H 4GAGL 1AQDB 3V4PL 4JQXA 5K9QI 1ZA3B 2VN7A 5CJOL 4WGWB 2CRYA 2OTWB 3R4DA 1MOEA 2F74B 1C7SA 4EN3A 4HIIB 5IROA 3ZHDA 3MXWH 1FFNA 4P0DA 5BJTA 4KJYA 1GZPB 1EZVY 2X10A 5I1KH 3CSGA 4TNWK 3EOBA 4Z0BL 1F58H 4I2XB 3DSFL 3OJVC 5B3JE 1IGJB 3TJEH 4RQQA 3EUUA 4C55A 2W1NA 3L5XL 1LP9A 4JKWA 1J8HB 3M8OH 4JPVL 1N3NB 4GRLB 5DMIL 4QWWC 4O02H 5FYKH 1NGPH 1GHFH 1G9MH 4FXLA 4HHAA 3NOIA 4NZRH 4NKOB 1Z3GL 1BJ1J 2XNAB 2ZOLB 2RAMA 1G7HB 3UBXI 3DROA 3DECA 4C58B 5IMMA 5EC1A 4NJ9L 5JQ6H 5SWSD 2UV3A 3OKMA 1MPAH 3O2DL 1OWRM 4UINH 1DUYA 3FKUS 1QNZH 5C0AA 2VLKA 4HUXA 2MCPH 5F21B 5T3XH 1UYWH 5IMLB 3WXVL 3LZFH 1DQJA 5ENWA 1GAFL 3RKDD 3TWCL 4LCWD 2CK0L 5ERWA 3DVIA 3L3JA 5GRYA 2XG5A 3P0VH 3FAWA 1L4IA 2K7QA 4PJXB 1WCBB 3MUHL 1CGVA 2W60A 1BHGA 1MJ7L 2VN4A 3T0EA 4QHMB 3DVGA 4QXTA 3CFCL 4MCZA 3KDMA 1NGWB 4FTVE 3WL9B 4L4JA 1UWXH 5KSAD 1GGCH 1HDMA 5C0BB 3TZVB 1MRCH 4YHZH 5E9DA 2DKSA 2ICWI 3LN9A 4H8WC 4EVNA 1FLRH 3WMSA 4J8RA 1ZLUK 3QNXB 3P9MB 2C4FU 5GPRA 1KBGL 3ISWA 5GGQL 1J0HA 4KRPD 3ZKNC 2DDQH 5KSBF 4KK5C 3BP7A 3CK0L 2LABA 1BM3L 3KVQA 3IDMB 1H3VA 2Q76A 2HTKD 1DSFL 3ZDZE 1K5NA 3VFUA 1OF2A 5GHWL 3FT2B 1U3HD 3QDJB 2Y25A 4FQQB 4OGZA 3LPWA 2I07A 3HAEG 3QP3A 4QHUA 1UC6A 2SEBB 3UBXB 4N0YH 1X44A 6CGTA 2GUOB 5DC0A 1CXIA 3OF6D 2B39A 3KYNB 3W11C 2CKBB 2D9QB 4PY8I 3N50A 1JRHI 4HG4K 4R4BA 3UZEA 4Y1AD 4Z78B 1WBYB 3W0WB 2J8UB 2X70A 4JJ5B 3QJHB 4XCNA 5MEPB 3C6LB 1CK0H 3HPLB 5JHDE 4QRTA 4IM8A 1ZANH 2G5BB 5DFTA 1W0YT 4DKDC 5CP7B 1MLCA 3MNWA 1HWGB 2XRAL 4F2MB 1T03H 4P3DB 2XY2A 5DS8A 1Q1JH 3G04B 4QTHA 2ENSA 4FFZL 1DTUA 4M61A 4G5ZL 3EW3B 5CEZD 5MEQA 3WKNA 4G9FB 3MJ7A 1R5VA 3GZKA 2OTPA 4UIKL 1MCDA 4M7KH 2VIRB 2ICWB 3ELAT 3OAUH 2H8PB 3PGDA 5JW3L 4NCC1 1XF2B 2IC2A 5C08D 3BHBB 1MQKL 2HVJB 4IRJA 4XHJD 5B38A 2Y4SA 3PP4L 4UDUB 4O51B 1EERB 3GUTA 2QLVB 2EDFA 3V79C 1XMWA 1A7QH 2OSLA 5EFIA 3KYMB 1HIMH 3O2DA 3RVUD 5F9OL 3V5DA 1QFWI 3ARBB 4FABL 1T80A 3UTSD 4LU5H 2YA2A 3PL6D 4RIRA 4I77L 2VWEE 5IR1A 4X7CC 4ZNCD 1F97A 3B8YA 5EPMA 4YQXH 1G7LB 3U7WL 2R9HD 3JV0A 3PGFH 1U8KB 1CLZL 4Y1AA 1A3LH 1QZ1A 1OB1B 1AR1C 2XZQL 3TYGH 3BRFA 3S36L 1QLFA 1RIHH 1SBBA 4QOKE 3HPJA 3IDYC 1T4KA 3GI9L 1ADQA 3C60D 1IGCH 3LQAL 2HVKB 3CFBB 4U0RB 1XIWD 4CVXB 1OAUH 4Y4HB 1M7DB 4RDQG 5JW5B 5FHBL 4ONGH 1MHPH 6FABH 4P2QD 3TPUA 4P2RB 4PRDB 2VUOA 4IBLT 4LGSB 1RULH 1SJHA 4Z95L 2R1YA 4R26H 2JJSA 4Q6IB 4O2EB 1T89C 4NQEE 3UTQA 5F89A 4MNGE 1XAUA 5L2KB 3X12A 3VWJD 5EUKB 2H3NB 4JFED 1I3RA 4NQVA 4H1LB 5CZVL 1KCVH 4MA7H 1CDUA 4X7FC 2XTJD 4JY6B 1MCIA 3S6CA 3RIAF 3H9SB 1CDCA 1NCCH 3PQYD 1U8JB 4GQ9L 1A2YB 3VDCA 4CKVX 5INCA 1KG0A 1T83A 1R5WA 1EGJL 3RIFK 5D1ZD 5C09E 4NM8L 3GSQA 3V7MA 3QA3B 3I75B 4IIQB 4X7SL 4YC2C 5TFSH 3KR3H 3SKUD 3RBGA 2ADGB 2H9GA 4Q0XH 3IJHB 3VA2C 3X3FL 1MJ8H 3Q1SL 3ZKSD 4LLDB 2FIRT 5JLZA 4NYLA 7FABL 5GRZA 2PW2A 4L4VB 1U3ZA 3LS5L 4YE4L 1F4HA 1LEKA 2Q1EA 4PJIB 3TP4A 1RUKH 1EEZA 3AY4C 1RZ7L 1ZHNB 3MRLB 4I18B 3T4AA 3C60A 3V6FA 1TCRB 1HHGA 4IOSD 4QRRB 1IQWL 4HGWA 3VFRB 3NN8B 4DN3L 4QRQA 4X6FB 3O6KH 1QR1B 1LD9A 2GK0B 5E4IA 5IJKC 4TUJB 5GGTA 1RHHB 2ZCHL 2X4PA 4MXQD 4HH9A 3QHTC 3UJTL 5GS0D 3SE3C 1LO3L 4XVJH 5FYLE 1C7TA 5DK0A 4PRIE 2I60L 3VG9C 3CAFA 1JNLL 5TDNB 4JFZH 5A2FA 3HI1A 2MJWA 1L6XA 3VWJA 3HKFA 3C5SB 4JREB 1FV1B 1IMHC 5E94B 3CFDA 3OR7B 3SDAB 4BFGA 5KAQG 4S1RH 1Q9KA 5JA8B 5DRNB 3VXMD 1QFWM 3PQYA 1I9JH 1MREH 3WXWL 5H37H 1CIDA 1JN6A 4UBDD 1E4WL 4PD4K 2B1AL 1HXMA 5D1ZA 5J89A 4J2XA 5EIQA 4L8CA 3NIGE 1CLYL 1ORSB 4NO5A 3K7UA 3CSYA 5DGQA 5L6YH 3O3AA 1T6WA 1TTFA 2DBJA 5JPNB 3ABZA 5DK2A 4J3TA 2FB4L 1RUQH 5CGYD 1YMHB 5F7WC 1UVQA 1A1NB 1NAKL 1RZ8B 4PB9L 1HN1A 1NBVL 4Z7UF 2AVGA 1FFPB 4L8DB 4YH6A 1RJZB 4YBLC 1JPTH 3HHRB 1PKQB 3MJ9H 2NY1B 5IW6B 4X5WA 3TBWB 2DQUL 2DBLL 5KG9B 1MCWM 3MNZA 3SPVB 5EO0A 1A6VL 1OARH 3MV9A 3RL2B 4WU7B 4DN4L 4GRLC 1ZHKA 1C12A 3VXOA 1CBVL 5ADOH 4HCRH 4M6OL 1CDYA 3PGCA 3RWJA 5TF1H 2UUDH 1ZK9A 2ITDB 3QEGL 4EN3B 1YUHB 1WWBX 2FDBP 3D3VD 2BOBA 3KPRE 4HXAL 3V4UH 4ENEC 5DD1L 1WFOA 5BJTB 4KJYB 4LAQH 4TOYL 3EOBB 3IF1A 5E8OB 3ULVE 4RQQB 4G8EA 4U1NA 1LP9B 2V2WA 3W2DL 1CGYA 3Q3GB 5FCUH 3KLDA 3NTCL 3QDGD 3GBNL 1H3PH 4ZSOE 3A6CH 4HHAB 3BE1H 4WW1B 1L9MA 4N0UA 5GQBA 2Q3AA 1RZJC 2HTLC 1AY1H 4ODXA 3DROB 1IVLA 5IMMB 5F97E 4DVRH 3DTXB 4KTEL 4KZDH 5DHYB 3OKMB 2VABA 2X1OA 2R4SH 5C0AB 4XNQA 1OWWA 3NVQA 1YJDC 5DHVA 1L0XA 4CADB 1NAMH 3VXSD 5ENWB 3TZVC 3VFGH 1TZIA 3BQUD 4RGMB 1ROWA 5ERWB 4U6VH 2JIXB 3L3JB 5T33H 4YWGH 1X3DA 2P8LA 4R3SA 5GGRY 1UXWB 4PRHD 2KDGA 2CDEB 5ESQA 2W60B 5AEAA 1KJVB 5DQDH 3T0EB 3ZE0F 2HLFC 3DVGB 4QXTB 4MSWB 4NT6A 3SE4C 3KDMB 4EZMA 2N56A 1QFHA 4OKDA 1FLTX 5IB5A 5E9DB 3IJSB 2HFFA 5EU6B 5DJYA 2F53B 4ALAL 2XZAH 2DLFL 2H2SC 1XGTA 4OZGE 1JGUH 1JMZA 1URLA 3MCKA 4OI7A 3ETBF 4NZTL 1T0NA 4JR9L 1JTTA 3JUYA 4OCSL 5F9JB 1S5IH 4X7TB 3BP7B 3CGTA 4RISH 1RZFL 5FYLH 2OJZH 4LPXA 5C0RH 5GGVY 4S1SL 3HAEA 5ECJE 5CHNB 4PJBA 4WI7A 4JZNA 4HBCL 2I26N 3CCHA 3D2UA 4YHIB 1A64A 2R1XB 2O5XL 5HHMB 4QHUB 3PWNB 2PETA 1T1YA 4U1KA 5DTFB 2BP3A 1P7QD 2AEWA 4XTRC 4GLRH 3T0WA 4NM4L 4KMLB 2XTLA 1TQCB 2WLYA 3B5HA 5HYIA 4NKIL 2VLRB 4XVUD 3TT3H 3VXSA 4JM2F 3WN5A 3ES6A 1EMTL 2R0WH 3H8NA 4PJ5D 4R4BB 1M6OA 4NQCA 2YRPA 4HJJL 1FDLH 2X70B 4JHAH 3R8QA 2UY6A 3MRGA 2JELH 3F12A 4XCNB 3MLVL 5GSRA 3MV8E 3F8UB 4R2GD 4U7SA 5J9PA 1YEKL 4R7DA 5HDOA 3MACH 4QRTB 1JWMA 2VO5A 4J23A 4R90L 1NJ9B 1FVCA 4YAQA 1MLCB 3MNWB 4HV8A 4LVEA 4UT6L 2EDEA 1D6EB 1IGMH 4QTHB 3QIUC 3E8UH 2IPTH 3HFML 4XXCC 2YC1A 4M61B 1A7NL 1X6NA 4XPGH 5E6YA 2V5MA 3MJ7B 1MHHB 1R5VB 2XA8H 4HEPG 3RTQC 4JM4L 1F5WA 4TPRL 4LQ1A 2V9TA 2DI7A 2MQ3A 5C0IB 3PGDB 4U1JB 2YD5A 4YFEA 3LS4L 3I3EA 2B4CL 3CX2A 4IRJB 5B38B 1CXHA 2HLAB 1A4KB 5D1XC 5IW3A 4X7DC 2R0ZH 3VFTB 2APWA 2OSLB 2QSQA 3ULVH 5SWZB 3V5DB 1CVSC 1QLEL 3T2NH 2AK1L 4NUGL 4U0RC 4FS0A 3X11B 4G3YL 1KJ2L 1P7QA 5EZJA 1OD7A 1IZJA 3BW9A 2Y7QA 2D7QA 3ARUA 1KJ3L 2ICEA 3UYRL 1NFKA 1KIRA 3QEQD 1OTTD 2F54D 5D8JL 1R3HB 3LIZH 5EPMB 1FYTE 1VDGA 2RIKA 4ZPTA 3I2CL 2WBJD 1FSKC 2EXWC 3MOQA 1VACB 4KDTA 3ARQA 5DUPL 5ANME 4JCLA 3HPJB 4S0SD 2IG2H 2VH5H 5I1CL 1DANT 4NKDA 5HYEA 3EDDA 5E2VL 3FQWA 2AV7B 3RDTD 4C54A 4YK4B 1QLRA 2VXUH 2GCYB 4NO2A 1NGXB 4XNZC 5IMOB 4DGIL 4OT1L 2PYEE 1AGFB 3QRFM 3QZWG 3L7FB 1SJHB 2R1YB 1U9KA 1LO0H 3NZHH 2AKRA 1YYLL 1P9MA 4NO0D 1QPPA 5C3TA 1KNOA 1B9ZA 1DVFB 3NFSH 2VDRL 5F89B 1GOFA 4IIQC 1R5IB 3X12B 3ARGC 2R0LL 4YHPA 1I4FB 2DM2A 4JM2D 2DYPD 4NQVB 2H2PC 1GXEA 1AO7B 4J3VA 4QTIL 3WFDL 2NX5D 5IW1A 5TE4H 4GKNA 1CU4H 4XCFL 4Y89A 1DQQA 2VZ1A 5FUZL 2PW1A 4ZXBD 4KTDH 4KK6C 5I0DA 4M9PA 3MLTA 1ZSDA 3D39E 4KKBD 1T3FA 1I8MA 4JPWH 5HYQB 2ICES 1E28B 2H6PA 1GL4B 1VADA 4S1QH 4X7EC 1VENA 2ARWA 2X42A 1IQDA 3MOBH 4GS7B 3QEUB 1A7PH 1SYSB 1MVUA 1H0DB 3SQOL 1DQDH 3ULUE 5JLZB 4RA3A 2WBJA 2WWKO 5F44A 4WI9A 5F3BA 1LNUB 4LEOA 1BLNA 1J0JA 3UJJH 1LEKB 2H32A 1EFQA 4WFGD 3L3IB 3TESA 2FEDC 1ZGLA 4C56D 1JWSB 5HGBA 3V6FB 4CNIA 4Z7VF 5E2WH 4LSVL 4I0PD 3EYUH 3SDAC 4U1MA 4MQSB 2I5YH 1X4ZA 1LD9B 3FB6A 4PRPA 1FC2D 3K8KA 5TE6H 1IBGL 2BMKA 1RUPL 3GJEA 1WAAF 4XPHL 2X1XR 3MRCB 3EHBC 3T08A 5DUML 4PP1D 1U93A 3C5ZC 3QH3A 4WFFE 4NO0A 5DK0B 4KI1A 1T20A 1T1ZA 3MRQA 3CFJA 1CLOH 4LF3A 2FD6L 3CDYA 3HI1B 1IM3A 3RWIA 5CINH 1YN7A 3H3PH 2HKHL 5LGJA 1OGAA 4OGYH 1Q72H 1Q9KB 4KPHH 3T8XA 2UZIL 3BO8B 4EI5C 3WFEL 3AGVA 3FAXA 3TO4D 1KJ2A 2Z9TA 4Y4FA 4XZUA 1JN6B 2DLHA 1G0YR 4L8CB 3OTTA 5K9JH 3EJZC 5IK3B 2VKXA 1HH9A 4D9QE 5DMGC 1JK8A 4NO5B 5IB2A 2WV3A 3CSYB 3QI9D 4P99A 3O3AB 2YA0A 3O8XA 3P9LA 4JQXC 4ZDHA 5IFAH 1IC4H 2ZP0T 3MBEC 4ZUTA 4NN6C 3ARXA 1TENA 1RQ5A 2F58H 3WDIA 4Y16A 4EN3C 5IROC 4QY8A 2BXYA 5LGHH 1UVQB 4PJAA 4JVPA 2MCG1 2NY7H 1CR9L 1F11B 2A2QT 4HIXL 4U6XB 2J6EL 2FHBA 3ZT5A 2B20A 4K7PH 5FHAH 4J3XA 3HB3D 4I0PA 4M7LT 4X5WB 3O41B 3QIWD 5C0FA 4WWKD 3U30B 5EO0B 1QO3A 4YDVB 1ZHKB 1KYOK 1TVHA 3ARVA 1JZ4A 3RWJB 3W9EB 1TJHH 5DT1H 5CS7A 1LEGA 3V6ZA 2HT4D 1KT2B 3QDMD 4YGAB 1P4LA 4F33A 1RHFA 1FFQA 3TF7C 1MFCL 3MGOA 2QJDA 3SKMB 3FQUB 3O9WB 5BZDA 1QQDB 2NY3B 5FUCE 2HWZL 4K3JH 1UB5B 4HWEL 2ESVA 4I8DA 5F7HA 3IF1B 2J5LC 1EHLH 2F5AH 4U1NB 4KFZC 1MY7A 3F5WA 1AD0B 2BNQB 1PLGL 5FIEA 3BESR 5D7LE 2C1OA 5KS9E 1QSFE 4Z7NE 1LO5A 4N0UB 3I6GB 5BO1L 5T1MB 3T1FA 4AIOA 2NCMA 2BHUA 3PABA 2IGFL 3UO1H 3OWEA 1QEWA 1S9WA 5EIIA 2YEZA 3OAZK 1A1OA 5SX5H 1V7MH 2QHRL 4ZFZA 1HCVA 4XPTH 4JHWH 4L3AA 2VABB 3PDGA 3T0EC 2AJYL 3FHQA 2WMPA 1MLBA 1A6ZA 4XNQB 4PP2A 1FP5A 4PJHA 3EYSH 4JGJA 4PREA 1G9NC 2PXYD 3FO9A 4N5UA 1U8MB 2R2BB 4IMKA 3L7EA 1TZIB 1N0XH 5GSVB 3EAKA 5BV7L 3FB8B 2MTPA 5EOTA 2CXGA 1MIEL 1XEDA 3TBYB 5GRWA 3ULUH 4R3SB 3H9HA 4JRYA 2P5ED 1ODAA 3DBXA 1WFTA 3SJVE 4LGPB 3PXHA 3PHQA 3ILPA 1BEYL 2DQHH 5HBBA 1TPXB 3QULB 4MA8L 4NT6B 4I5BA 4F37F 2XZCH 3O6ML 4GW5B 4LOUC 5D7SL 1AI1L 1ZHLA 1ERNA 3SKOB 3L1OL 4HMCA 35C8H 4XMLH 2J4WL 3LVEA 5IB5B 4CRPA 1G6RL 4JRXD 1I7ZA 3OMZA 1NCWL 1JUFB 5I74C 4ZNEA 4GG6F 1S5HA 4Y5XA 1WQVT 3SKJL 1A6AA 1SBSL 4OZHF 3MCKB 2IWGA 3MJ8B 3SY0A 3ARPA 2ZG2A 4H26B 1F90H 1T0NB 1JPGB 3K8LA 1TQCC 1WEJL 3T0AA 4OQ1A 4LPVA 3DHJA 5DMKA 4YHOL 4P4KD 4XNYL 3HAEB 4PJBB 2NW3B 4LQFH 2BVEA 4JZNB 4V1DB 3CCHB 4MA3A 3D2UB 3IXTA 4LVHB 2DTMH 4OLEA 4X6EB 4OBSA 4TUKH 2X4SB 1F2QA 1HOCA 2DQJH 3ULSA 2DF3A 2R29H 2YBRA 1EJOL 4XVSL 2JJVA 5DWUL 3GSOB 2MNUA 5ALBL 4G8IB 4E9LA 5I1HH 1F45A 2PXYA 2Q8AL 4LLMA 5FGCB 3WN5B 2CD0A 3ES6B 4QO1A 1M6OB 4NQCB 1B0RB 4K7FA 5J3HD 4K71B 3IT8D 3F12B 1U8LA 2YPVH 1YEJH 2P5EA 4KRPC 5T1KB 1JWMB 1JNNH 4M1CD 4YAQB 4IRJC 2E7BA 4FNLH 2Y5TB 2FL5A 3P73A 2O61A 2OI9B 3MXWL 3C9NA 2VLJB 5FO8B 3WJJA 1XF5A 1ES0A 5I1KL 1QVOB 4JRXA 3VFSA 2VQTA 1F58L 3TJEL 3SO3B 4WV1C 1M71B 2BHYA 3M8OL 3EFDH 3CVHA 2NY2D 4EQ2A 4C83A 4HQQL 5DJ6B 4O02L 4OLVH 3SE9L 3MLYL 2GY5A 1GHFL 1G9ML 1BD2A 3S34H 5HI5D 1E4XI 5HSFA 2W92A 3V0VA 2NY5H 4RBPK 1FIGH 4FQCH 1NCDL 1MPAL 1J0YA 4OZFB 2DQTH 4UINL 3FMGL 4K8RD 3AMKA 1DN2A 3T3PF 1QNZL 4YUEL 3QFJB 5EZJB 1BJMA 5DYOA 1UYWL 3LZFL 3FQTB 4F15B 5D96B 1KIRB 2R39A 3NZ8B 1MWAH 1AXSA 3P77A 1S7UA 1KXVC 1DQMH 3QWRD 5INDA 2JJSC 4JJHA 3P0VL 3P0YL 4BQ8A 3QCUH 2XACC 5F1IA 4PTUB 3G5YA 3NIDF 4R4NC 3MLZH 5C0CE 4WW2F 1T7WA 2VAAB 4OFKA 1NH6A 2BK8A 4CMMA 4MJIA 3F65A 3AROA 4BKLB 1A3RH 3TVMD 1AGBA 2AJ3B 1GGCL 2CR6A 1RPQA 4YHZL 4EXPX 3CMGA 3E2HB 4B5EA 1WTLA 3VXQA 2FH6A 3RVUC 3SDXB 2PTUA 4LL9A 2AKRB 2ADFL 1WBZB 3U83A 2IAMD 3MYJA 1KNOB 1E6JL 4L3ED 5GRUH 1MCLA 4GS7C 4YHPB 3WE6A 1XGRA 3O2WH 4N8VG 1VEMA 1VPOH 2NYYD 3BMWA 5H37G 4GKNB 1DQQB 1TVBA 3AAZB 4FQHA 4XP1H 3RNQB 3VXPA 2BFVH 1ZSDB 3MLTB 4ZG1A 2X4RA 1LO2H 3C60C 4N0YL 3PG2A 4DKEH 4HPYL 2H6PB 1ZKAA 1TETL 2QKIA 1KC5H 5BS0D 2YRLA 3QQ3A 5I30H 1FO0H 1MVUB 2DS4A 2ARJQ 3NCFB 4GMSL 3MRKB 4M7LL 4N9OB 3BDBA 2KUTA 3QO1B 5GRVL 1BBDL 1XGYL 3V6OE 4NGHL 5TQ0H 3QWRA 3GSVB 4LEOB 2D7OA 5FV1L 2H32B 3VFPA 1NLDH 1ZGLB 3PWVB 1I8KB 4PJXE 5ID0A 5HGBB 3VWJC 3ZT7A 3UZQA 3CDGA 4WI2A 5FM5M 5JXED 3EO9H 3C8KA 1IGFL 2BCKA 2FNBA 3B83A 4G42A 4M4RA 5I73C 2XTJC 3FB6B 5HYJE 1N7MH 3JWNC 4PRPB 1OP5H 1HH6A 2BMKB 3GJEB 1G7JB 3ARDD 4K9EC 1HILA 3QUYD 1U93B 4M7KL 3QH3B 5D1ZC 5ICYB 1T20B 2F8OA 3WFBL 1QUNA 1T1ZB 3OAUL 3CFJB 4LF3B 4OLXL 4HIJA 4YXLL 2Y6SC 1YN7B 4AG4H 1FNEA 1MIMH 4GOSA 5LGJB 1OGAB 1AR2A 3QDJE 2J7LA 2LTQB 1JYNA 4GAJH 5DEFA 1UJTA 4HIEA 4LKXB 5FGRA 1K2DA 3BAEH 2NY0D 1XGUA 1L7IH 1KJ2B 4Y4FB 5DRWA 1EVUA 4LU5L 3W5NA 4RGOH 1H9VA 1F4WH 4RMVA 1DEEA 5HPMA 1NEUA 5JIKA 1JK8B 3ZE1F 5BS0A 3FT4A 1RUAH 4YQXL 3U30C 3M17A 2AJUH 3O8XB 3LKPB 3PGFL 3AUVA 3WV0A 5AWNH 3TYFA 3TYGL 4PRNB 4WFED 1JYXA 4MXQC 4AQ1B 3GMOB 3LAFA 2VJXA 1V3LA 4GKZA 2UZXB 3GO1H 3LD8B 3CX5K 4PJAB 1OAUL 2NY3C 1I1AD 5T5NF 1IJ9A 5HGGS 4QT5A 6FABL 5JXEA 3G5VA 1C5DA 1YYMH 3HNSH 5D4QA 2CRMA 4LPYA 1IC7L 2P5WA 1QO3B 1MI5D 4GBXA 4AT6B 3U0PA 4Z76B 1RULL 1TVHB 4R26L 5KVEH 1VFBA 1LEGB 3V6ZB 3BN9D 3QUYA 4F33B 4UBDC 5CSGA 3D87B 1S3KH 3DRQA 2LU4A 3O45A 5BZDB 4HD9A 3S88L 4NOFA 2ESVB 4NSKB 4Z7WA 3BZFB 4OFIA 5I8KH 4MQXD 1KCVL 2FECI 2X9WA 5HDQL 4I13B 4CAGA 3S35X 4MDJA 2GW5A 1W0VA 1H15A 3F5WB 5IUSA 3LKQB 5DGRA 5CGYC 3A67H 2QSTA 1GH7A 3TH3T 4WW2A 1NFIA 4I9WE 1J88A 1LO5B 3ECBA 3PABB 3SGDI 2E9JA 1S9WB 4N1EA 1HI6B 5TFSL 3NCCB 3KR3L 1A1OB 4ZFZB 4ODVL 2W9EL 1MJ8L 3LSOA 2YN5A 5I8EB 5HTSA 5IGXL 4K23L 5T5FL 3TH2T 4KZEL 1TPXC 3U0WH 3P0GB 4Z9KB 3DYOA 4PJHB 5K93A 2B2XL 3L7EB 4N90D 3K46A 4P23D 1I1AA 2BSRA 4JQIL 2AJZA 1EVTC 4Y5YA 3RY5A 2DQDH 1MCFA 1LDSA 5EOTB 5SWQB 3RZCD 2DWEA 5JMOC 2N7BA 3VFNA 2XWTA 3HN3A 3H9HB 1JJUA 3OJMB 4JRYB 3WEXB 3DBXB 3ILPB 1OW0A 3BD5A 5JW4N 3RIAK 3CH1A 4MNQB 3IS1X 4XVJL 3UJIH 5CJ8A 3MREA 3MR9B 4JFZL 4XAKE 3GBMH 4LVHC 4PBVC 5L2KE 3HUJE 4MD0B 1M4KA 1I7ZB 5FM8A 4OLZH 3TJHD 3O3BB 1HK6A 2I27N 4S1RL 5ISZE 4NFBA 1RZGB 1T0MB 2YPKB 2BY3A 1GCFA 1AKJB 5HHXH 5DMKB 1CF8H 1AGCA 1MREL 3QUMH 4FFYL 4G8GE 4UOW0 4JQVA 5AZ2L 5MP6H 3WN5C 5MENE 2PO6A 3GSWA 5DD0H 3WNOA 1CD0A 4MA3B 5DR5H 3IXTB 4K71C 4OZIF 3VGAB 4NQDE 5L6YL 1U8IA 1A7OH 2RB8A 2BSSB 1EO7A 1UZ8A 3MNVA 3ULSB 5HVHB 4QHKJ 2YBRB 2N4IA 3VG0H 3RWEB 4PJFF 1RUQL 1ZWIB 4XWGH 5GIRA 5C0GB 2FBJH 5FOBB 4JGMA 3RBSA 5EO9B 4PJIE 3VD7A 3HG1B 1LK3L 2HN7A 1JPTL 3IETA 3LRGA 2D4FA 4F8QA 4P23A 1UEYA 3MJ9L 4PV8A 4RA0C 1CD1A 2VC2H 1GOGA 3SO3C 1U8LB 3RZCA 3TN0B 1OARL 3TC9A 2CDGA 5ADOL 4HCRL 5LWYH 1EEYA 5TF1L 4PG9A 3HE7D 4UILH 4FTVA 1KCKA 2DL9A 2EXYD 2FL5B 2OJEA 3VXUB 2Y1VA 3M07A 5E8NA 1XF5B 4X6CE 4LAQL 4QRPE 3FRPG 43CAA 4XC1L 3G5ZA 3VFSB 4FMKA 2RHEA 4BZYA 5HDLA 4NQUA 3RZWA 4NZDA 1Y0LB 4NHUA 1T7ZA 3QXTA 2YD1A 2YD8A 3E3QC 2A77L 3H0TB 3BPLB 5TGBA 4F15C 5D96C 4OLWH 2VNCA 1H3PL 5HXMA 4ZUVA 3A6CL 4RZCA 4XVUC 1T2JA 3BE1L 3P4NA 3HNTH 2EKSB 1AY1L 4X6DE 3V0VB 1J5OL 3C08H 1UM4H 4KZDL 3D0VB 3STLA 4MWFA 5C07D 2OS7A 2DJUA 3K4DA 2CUIA 5D70H 5DYOB 5F88B 1FZMA 1NAML 3FB5B 4P5TA 3ZTJH 4JDTH 1GGYA 4KVNH 3VFGL 3ZYIA 5DURB 1QSEB 5BV7B 3RWHB 3P77B 4U7MA 1S7UB 2NLJB 5J1TC 3BGAA 3BJLA 1ND0B 5INDB 4YWGL 4AM0A 2NTFB 1P9MC 4FP8L 4LLWB 4YPGA 4YGVA 1JTOA 4TSCH 3G5YB 3GGWA 3PWPD 5DQDL 5TQ2L 4UOW1 5JHDA 2DN7A 3BT2H 4CMMB 1RY7B 5FYJE 2XXCB 4MD4A 4MJIB 1MELA 3QZWB 2FATH 5BVJA 3IFLH 2BVQA 2XZAL 4ZAKB 1CGUA 1MFNA 2ZJSH 4KKLD 1J9CT 1JGUL 2M8XA 4X99A 4LBEA 1WIUA 5SV4A 2NMSA 2XN9D 4KROD 3MYJB 4WNQB 5F6IB 1NCNA 4D0DA 4NRZA 3BEWA 1S5IL 4YHKH 4N8VA 1VGEH 5FYLL 2OJZL 2J8OA 3WE6B 3CXHK 1KPRA 1XGRB 1OTTC 1CXFA 4CU6A 4X8JB 2WBJC 2CGRH 3RUGB 4XCYA 2NY4C 1D5BA 4LSSH 3VXPB 3WLBA 1NMCB 4PGBA 1VESA 1CFNA 3JWOC 1IARB 5DQJA 5C07A 4L29A 5EU7C 4PJ9B 4P2OD 5LQBH 2A1WH 4Y4KB 2GJ6B 1IC1A 1KTDB 3QQ3B 1J87A 4RWHA 4PJDE 4NRXA 2R0WL 4F7TA 3MJ9A 4XI5D 4A6YH 3IVKA 4JO1L 1B4JH 1CIUA 1YPZF 1FDLL 2X4NA 4JHAL 3DX9B 1IM9A 4A2LA 2JELL 1NGZA 1RZKC 4QOKA 2QQNH 4HCRA 4TRPH 3EOAB 3VFPB 2D2OA 2WBWB 1BZQK 2DLEA 3MACL 5ID0B 4BSVA 5MI0C 4OGXL 3H42H 2NXYD 3GMPB 3CDGB 3Q0HA 1EXUA 3V6BR 1IGML 3C8KB 3E8UL 2IPTL 4G42B 4E41D 1UCBH 3KLHD 2LTQC 4OZIA 3WDJA 3U9PH 2F53E 4PY7A 1VFMA 2QL1A 2YD9A 3RWFA 4UT9H 3CVIH 4KKBC 2XA8L 1HILB 1Z2KA 3BDYH 2BRRL 3DIFB 2BX5A 3HZYB 4QGYA 4WUUE 2C7UB 2Z92A 3CZFA 2YPLE 1CT8B 5IG7A 3O8XC 5DC4B 3KPTA 2BNUA 3BPOB 2R0ZL 3U4EA 4PJGB 1GYAA 1U0QA 4MS8D 5ID1A 1HWHB 5DEFB 3U36A 3UAJC 4HIEB 2WWKT 4RAHA 1U41A 4Y16C 1K2DB 3SDCD 3T2NL 5I76A 2VQ1B 5AUMA 4D9LL 2EC9T 3ZKMD 5ICZB 3V0WL 1NAMA 2W65B 3GSUA 2YXFA 2AK4E 1VHPA 1DEEB 5HPMB 1JWUB 2DM7A 3G6JE 4I0PC 2FHCA 1M7IB 5D7IE 4UV4H 3EFFB 3LIZL 3ZYZA 2HMIC 5HHVH 2AV1A 4PJ8D 3M17B 3LDBB 5JO5A 3KAAA 5I66B 1AD9A 3TYFB 2VZSA 5DJ2A 1QBMH 5D7IF 5GXBB 1HXYA 4MXVF 4PP1C 2LFGA 2J2ZA 2VH5L 3O6LL 4GKZB 3EDEA 4AY0A 5DD6B 4XBEH 2ZUQC 5K9OA 2VRAA 3CMOL 4ODWA 2UY7A 3A0OA 3HTLX 2MPAH 4P3WA 4PJ7B 4QT5B 5HGDB 4RGNB 5D2LB 1JHTA 4NRYB 5SWSB 1C5DB 5E2JA 1UFUA 3V7AE 1YNTA 2VXUL 4E41A 4PJEB 4UU9A 2P5WB 2BZDA 4O58H 4GBXB 2QQLH 2VDQL 3HE6A 5I1IL 1VFBB 2J12B 2RR3A 3NZHL 3HR5B 1SEQH 1MJJA 2GY7B 5BRZE 4OCLC 4YJZL 2VAJA 3OGCA 3IKCB 3NFSL 4XP6L 2YXMA 4PRIA 2EDTA 1AHWB 4LARL 5FYJH 3O45B 1TCMA 3U9UA 2OL3H 1HHIA 4Z7WB 2XQBH 5TE4L 5CAYB 4W70A 1PYWA 4IS6A 5EIVA 4N0FA 3MLRH 4MDJB 2V2XA 1CU4L 1C5BH 1W0VB 3CC5A 4RMTA 4J3WA 1H15B 4WO4D 4EOWL 4NQTA 4S1DD 5HHOE 2DKUA 4KTDL 1NCBL 2EDBA 3SDCA 1T6VN 2E7LA 1T0PB 3OV6A 4IMKC 1E0OB 2UWEB 1DFBH 4MZ3A 4S1QL 1IEHA 3ECBB 1KIUA 1BZ7A 3MOBL 5C0JA 3GKZA 1A7PL 2YHGA 3SO5A 1H3TA 3JV4A 3JV6A 3KXFB 1PG7X 1D9KA 1OAXH 1DQDL 4WWKC 2G9HA 4PJ8A 5FF6A 2L4OA 3IGAA 4OV5A 4P9HC 3FT3B 1TVDA 3GDBA 1NMAH 4OFYA 2ZUUA 1NGYA 3UJJL 2A9NL 1C1EH 1FC1A 4U3CA 3FN0L 1CXKA 2VXTH 4JG0L 5E2WL 4XPBH 3C6SA 3D69B 2EDRA 2AJZB 3EYUL 4Y5YB 4Y5XC 3I02A 1U2CA 3LQZA 4BZ2H 4HUVA 2DWEB 2I5YL 5E1HB 2XWTB 2Q20A 5KSUB 1FFRA 4R96A 1XR8A 4GMTH 5DO2C 2VUYA 4Y19E 3B6SB 3CH1B 5DVOA 2EZ0D 4OM1H 4B50A 1IAKA 1LE9B 1CLOL 4NQSB 1G7PA 3K2UH 5FK9A 3KPRA 4M1GH 1P6AB 4P59H 3VGAC 4EDWH 1XZ0A 2DMCA 3H3PL 4XMKH 1HHJB 3OR6A 1NUNB 4HW6A 3E6HA 4OGYL 2FJGA 1ACZA 4OLUL 4KK9D 3MV7E 4OD1H 3D0LB 2AEIT 3QUXA 2B8OT 2PXYC 4HS3A 3PWUA 2NZ9D 4ZSOA 5HHPA 5EOCH 2PO6B 3GSWB 5K9JL 4JN2A 1K4DA 1TZGL 3CNKA 3LN5A 3OHXB 2KH2B 1T1WA 1U8IB 3QXAB 4PS4L 1UZ8B 3MNVB 1PSKH 2BDNL 3HZVA 5DJDA 1OPGL 1DEDA 3KPSE 5IFHH 5C08B 5CMAB 4NQXB 5LGHL 4NP4H 1TFHA 3WJJC 4GRMA 2HN7B 1CD1B 3OX8A 1MSPA 4HLJA 3O4LD 1D5IH 1TXKA 3PL6B 1SJXA 4P9ML 3BPLC 1EEYB 3V4PH 2KQMA 1TJHL 2PCPA 3JTTA 4CN1A 2RCSL 4KH2A 3FRPA 5CJOH 5L7XL 3UMTA 5E8NB 4NDMB 3RX5A 4K3JL 3PV7A 4NC0B 1CFVH 43CAB 1A1MB 3BD4A 3G5ZB 1BVLA 3QG6A 4I4WA 4LHQB 1F00I 1EHLL 1I8LA 1VB9A 2F5AL 3IRZA 4OZGA 4M7JL 4NHUB 3HCVA 3L3KB 5ITFA 4KUZH 3I6LE 2ZUVA 1DLHB 4MA1C 5TGBB 5MHSD 4X9HA 3U0TA 4ZUVB 4RZCB 3WIIH 5BV7C 5FDWB 3GRWA 4OIAA 4YO0B 3UO1L 2APTA 1KLGA 5GS2H 4KI5F 4ELKA 4Q9CA 4BUGA 1N5AA 4GSDH 4XPTL 1INDH 2ID5A 4Y0GA 4GW4B 3TCLA 3STLB 3MRHB 2P49B 4MWFB 3JWDL 4MJ5A 4NPYA 4QRSB 4JFEB 4HX1A 4M1CC 2MOVA 5HHQA 5LG1A 2XICA 4P5TB 5B39G 4OIBA 3WXVH 5SX4H 3SCMD 3RWGA 3ULUL 3I6KA 3O4LA 3QXDB 4YGVB 1KTKE 5F6IC 3L5JA 3MPCA 3DURA 5CJBA 3MV8A 4J3SA 3GGWB 2V17H 2AJVL 2DQHL 5JHDB 4CBPA 2EDDA 2XZCL 2G2RA 2ERJC 4MD4B 4W81A 5E8DH 3B3IA 2H1PH 35C8L 5BVJB 1GJIA 1ETZA 2KZWA 5ETUA 4CJ1A 2BVQB 3MLSL 3I50L 2DQGL 2NR6D 2DM3A 1J86A 3SKNA 1K6QL 4AEEA 1NMCC 2D4DA 1PJ9A 2GSIA 4LBEB 5EDXA 3VWKD 3TLRA 1IGIH 4K8RC 1WZLA 1IEAB 5J4MA 1F90L 4NRZB 5HDBE 4KDWA 2Z4QB 5KANI 3MODH 3K1KC 4GKSA 4JE4B 3BZEA 1KPRB 2BY1A 3GMMA 3CK0H 4UQ3B 1YMMD 1BM3H 4EIZC 3QWQB 3GKWH 1NPUA 1YEIL 5HDBF 3PHOA 3F7VA 1VA9A 2DTML 5L2JA 4TUKL 3WLBB 2DQJL 2EIZB 3S3SA 1FZOA 4PGBB 2R29L 3JTSB 1BAFH 1CFNB 1ORQA 3QBTB 4B7LA 2YS4A 2A83A 3DV4A 4WWID 4UQ2A 1EPFA 4AL8H 1J12A 4BQ9A 5I1HL 3K0WA 5EA0L 4F37K 5E00B 4NRXB 1JPFA 2EC8A 2BY0A 3ZDXF 3SCMA 2X4NB 4ZS7L 1IM9B 2BSED 1NDGA 4ODUA 2P24A 1YNKH 4Q58C 2YPVL 1IAMA 4D9RD 4QOKB 5ANMA 2BVPB 4XPFH 4BSVB 4XBPA 1JNNL 1NLBH 5JW4M 1EXUB 1BMGA 4KI5D 5ABDE 4GUPA 3KPOA 2NYYC 5I8CA 3L3OB 2PYEA 4PY7B 3RWFB 4Z7OE 4N5ED 2DLTA 5GS1B 3VWKA 2P48B 3EFDL 4NQEB 3CZFB 1QHOA 4UIKH 4MNGB 2HG5A 4M00A 5L0QB 5JW3H 4DTGL 3S34L 4HAGA 3EYOA 3LDBC 4RFEA 4GLRI 2VXSH 1MQKH 1YMMA 2KL6A 3G08A 3PP4H 3U4EB 1SYVA 4HJ0C 1FIGL 2VDML 3JZ7A 3U36B 5IIEA 1G7IA 2VZUA 4UT7L 4WI5A 5I76B 3D39A 4KJWD 2G60H 3I84A 4PG2A 3RWDA 3VRIA 4XMPH 5FYKU 1L9NA 5C09B 1NAMB 3GSUB 2BRQA 2AERT 2IAND 2AI0H 2XV6B 4I77H 5JXEC 1CZ8L 2R2CA 1UJ3A 4PRBA 3HMXH 4O4YH 1MWAL 4GBXC 5IVZA 5JO5B 1AD9B 2EYRB 4M93B 1EIBA 5FKPA 1CLZH 5MERA 1WZMA 1BFVL 3QUYC 4YHLH 4P5KB 4BZ1H 3GI9H 3O3DA 4RAUA 1FE8H 3LQAH 1CE1H 4AH2B 3BUYA 2ZWLT 1JHTB 5FHBH 3U48A 2E9BA 3WNMA 2Z31A 4OGAD 4GXVL 3W11D 4S11A 2OP4L 1KULA 2VLLA 1UWXK 2VLJE 2APBA 4H8WH 1U95A 3HE6B 1KCRL 1CFTA 2P46B 2XWJA 2NY0C 4WW2C 4GAYA 1KB5L 4IRSD 4Z95H 4EBQH 3LPGA 3MRNA 3OGCB 4JG1H 4KDVA 5GRUL 3PNWA 4PRIB 5J11B 1DBMH 4DZ8B 4TTGA 1HHIB 3O2WL 5I16A 5IJVB 5C1MB 5EOCJ 4IS6B 4PRHB 4N0FB 4MCYB 4X4XA 2WANA 3MFFB 2BNRE 5ILTH 3B4NA 4JO2H 4MAYB 5FO7A 1NFDF 4XP1L 5DJXA 4DKAA 2BFVL 1FL5A 3RGVA 3S96A 2WUCL 5JNYB 4PGDA 5CSZA 4DKEL 3QFJE 1R24A 1I1AC 1EGJH 5C0DA 3T09A 4Y5YC 5JHLH 1BZ7B 1FL6A 3NCMA 4NM8H 4L4TD 5I30L 1FO0L 5H94A 4HBQA 5EZLA 3JV4B 3JV6B 2VXQH 4X7SH 1D9KB 2HFTA 5FF6B 4N0CD 3IGAB 1OW0C 1UH2A 3X3FH 1GC1C 5TQ0L 1X5KA 3Q1SH 4AENB 1NGYB 3GNMH 4YDLB 1BIIA 7FABH 3AMLA 4Z7UB 3W9DA 1FGVL 3PIQB 3BN9C 1N64L 1NLDL 3FOLA 4OZ4A 3FHAA 2FWOA 5IVXE 4HS6A 3BVNB 3R0NA 3TBTA 5T3ZE 5HYSG 3EO9L 3LQZB 4JFHE 4R9HA 2D7PA 4HUVB 4HF5L 1JGEA 2Z8SA 1N7ML 4DN3H 3T0BA 1XR8B 5I1EH 1S9XA 1UB6A 4LPCA 1QA9B 5FA3A 1AR1D 4FQJH 4JQVC 5CSBA 2PO6C 3DX6A 3VDBA 2ZCHH 4IRSA 3S4SG 1LO3H 1IGTB 1G7PB 1CGXA 2UVFA 3KPRB 2HJKB 1JNLH 1XZ0B 5D7JB 3UTTE 4KRNA 2AJSH 3JV5A 3KPNA 3OR6B 4JVUA 2I24N 2AEPH 2FJGB 2GSGB 1GSMA 1Q0YH 3NMEA 4BSWB 3BAEL 5DJ0A 1L7IL 4G6KL 5HGAA 1P84J 4HS3B 3PWUB 5D5ME 5D7LA 4ZSOB 5HHPB 5KS9A 4RGOL 1YDPA 4HC1H 1QSFA 1F4WL 3TT1L 3BZ4A 4P23C 4UMGA 3F7YA 5ACZA 3LN5B 1E4WH 1U8PB 2WINA 3DYMA 3KPQA 3E0GA 5CFHA 4Z18A 2ADIB 3NFNB 1RUAL 2AXGA 4ZO6A 3ZTJG 4LLVB 2EICA 4NIKB 5DUBA 3RZCC 1FNGB 2AJUL 1RK1A 4OF0A 1FNFA 1X5HA 3HZVB 5DJDB 5AWNL 2FSEA 2NY6D 4PJCE 4S2SB 4HWZA 1WT5A 4ZOCA 5IWLC 2FB4H 4KWUA 4Y2DD 4LSPH 3U6RB 2PF6A 4G6FB 4PJCF 3VGHA 1V05A 4KHXH 2VITA 2ZPKL 1AP2B 4PB9H 4M5ZH 4XBGA 5IBTH 1TJIL 3GMLA 3OXRA 1OGTA 3OX8B 2X40A 3TJHC 2PYFB 3BPCB 1KUMA 1P7KA 1LDPH 4HKJB 2DBLH 4D8PA 5KVEL 1I9EA 3SJVA 4DN4H 3ARFA 4G80A 4UOJA 3BKYH 1S3KL 2M2DA 2X1QA 3BD3A 5EBMA 2WLZA 1N6QH 4DKFL 3PHSA 2PTTB 1N2RA 1MFEL 4FXGA 1P2CA 2RGSA 3RY6A 3QG6B 4I4WB 2HRPH 5KW9H 2B7DT 4YEEA 1RFDH 4JPIA 3HCVB 3QXVA 1IZKA 5ITFB 5E6ZA 4UIMB 3A67L 5EUOE 1PFCA 3ARSA 4JFDE 3U0TB 3OAYK 1VKXA 1F3DH 2DOCA 3TIDA 4BFEA 1A0QH 1KLGB 1S9YA 4AQOA 1N5AB 3T3ME 1Q9OB 2ZUWA 5SV3A 3TCLB 2CLVA 4ZOEA 4M8VA 1FBIH 1CG9A 5HJ3A 3U0WL 4HS8L 4KTEH 4LFHG 4NPYB 4EDXA 1NDMB 4JM2B 3MOAH 3PE9A 4JFFD 2DYPB 4OZFH 3HE7C 4Y2DA 4JRWA 4KV5E 5FXCH 3L3DB 1EO5A 4M6AA 1KGCE 3MA7A 3GMQA 5T1LB 1BECA 3RWGB 4LASL 1A5FH 3HS0A 25C8L 2V5RA 5H35A 3AU1A 5F1OB 4XP4L 1CL7L 5IMKA 3EGSB 2G2RB 1UADC 3LHPH 4KJPC 1ETZB 5ETUB 3OZ9H 1H5BB 4QNPF 1KTLB 5T3ZH 2B1HH 3SKNB 3N9GH 2GIYA 3DJ9A 4OUOA 4OLZL 2GSIB 4ALAH 5FCSH 2X44D 2XKSA 2DLFH 2J8UF 1I7TB 1TJGL 3LKOB 2Q7NA 5DXWA 1J8HD 4P46A 2WP3O 1DUZB 2VWEC 1JF6A 5EOQL 5C0EA 3MLPA 1DE4B 4GRLD 4NZTH 4QYOB 2A6IB 1CF8L 4OCSH 4GKSB 5MP6L 3BZEB 4UUJB 5F7FA 3ZE2E 5DD0L 1HYSD 1RZFH 1GRWA 4DGYH 2CDFA 3PHOB 3F7VB 5DR5L 1FJ1A 4NJAH 4ENED 4HBCH 1A7OL 3FFCE 3ZE2F 1Z9MA 1AGDA 2O5XH 3VG0L 4ZUWB 4MB3A 4XWGL 2A83B 5D6DA 2FBJL 4YHYC 4HKBA 1PGRB 2YZ1A 4LKCA 2WIIA 2FJFA 3A6BL 3WS6A 3QJFA 1WTGT 4H0HB 4NKIH 1JPFB 1T5XB 4XAWL 1FYTB 5CJ5A 1ZT1B 3WD5L 4KKLC 1EMTH 2HTLD 3O4OC 5F1NA 2P24B 1SY6H 5C6WH 3TO4B 1JGDA 1OTUD 1KXTB 5ANMB 3RI5K 4CN6A 3O6FA 4P4RA 1AQDA 4TYUA 4KRLB 2HJFB 5C0CA 1YEKH 4WCYH 1FPTH 3AM8A 3QI9B 1S7QA 1A7BA 1FORH 2MWCA 2OTWA 4HG4J 3RPKA 1YC8A 5E6IA 1UH3A 5I9QC 2F74A 4GRWE 1S7RA 4UT6H 3GB7B 4G8FB 5C0BD 1SMOA 4HIIA 3NGBC 3TZVD 3DXAE 5I8CB 3GSRB 2PYEB 4TVPE 4RRPG 1GZPA 1A7NH 4WTWA 5LKNA 1JHLL 4R97B 3PXJA 1BFSA 2NXZB 1IGJA 3VD5A 4JM4H 5CLWA 4TPRH 4OLWL 4LVNB 4NBZB 1UENA 3QIWB 1LE5A 3HNTL 1J1PL 4LCYA 4RFEB 1MHCA 1RZJH 4Z77A 4XI5C 2B4CH 4NKOA 3G08B 3C08L 4OCMC 1OSZB 4M93C 2XNAA 5DZNA 1QACA 1S8DB 2ZOLA 1G7HA 2AABL 5IIEB 1G7IB 3QQNA 4HWBL 3D39B 2H2SD 2AXJA 1ZVSA 4K7PX 3VRIB 5C9JA 5L9DH 4NUGH 1KJ3H 2A0LC 3UYRH 5IMLA 3KLHC 2P4AB 3QXWA 4QF1B 4BJLA 3W0WD 3VI4F 3I2CH 5FKPB 4U6TA 2X4QA 1XF3A 4EEEA 1JZ5A 4Z7VB 1B2WL 4TSCL 1MCPH 1JPST 5DUPH 3C6LD 5J11C 3VXRE 5EN2A 3K80A 4PJXA 3O3DB 1WCBA