4P4HI

Caught-in-action signaling complex of rig-i 2card domain and mavs card domain
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
97
structure length
97
Chain Sequence
MPFAEDKTYKYICRNFSNFCNVKVVKILPYLPCLTARDQDRLRATCTLSGNRDTLWHLFNTLQRRPGWVEYFIAALRGCKLVDLADEVASVYQSYQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular Imprinting as a Signal-Activation Mechanism of the Viral RNA Sensor RIG-I.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Probable ATP-dependent RNA helicase DDX58
total genus 33
structure length 97
sequence length 97
chains with identical sequence J, K, L, M, N, O, P
ec nomenclature
pdb deposition date 2014-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF16739 CARD_2 Caspase recruitment domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.533.10 Mainly Alpha Orthogonal Bundle Death Domain, Fas Death Domain, Fas 4p4hI00
3EZQA 4M9ZA 1D2ZA 2N83A 1E3YA 2MS7A 2BBRA 1A1WA 3YGSC 1CWWA 4IZAB 4ZBWA 2KM6A 2MN4A 3CL3A 2YGSA 1DGNA 3QF2A 4N1LA 1E41A 2F1SA 2L6AA 1UCPA 2VGQA 2GF5A 2BBZA 3MOPG 4F44A 1D2ZB 1WMGA 4UZ0A 4JUPA 2OF5A 2MB9A 3MOPA 1C15A 4DWNA 3YGSP 2G7RA 2LWDA 4LWDA 2B1WA 3CRDA 4E9MA 4A2QA 2LS7A 3KATA 2DBDA 1DDFA 2IB1A 1CY5A 4I16A 4O9FA 4NQKA 2YVIA 4RHWA 3EZQB 1YGOA 2A5YB 2DBGA 2N80A 4M9XA 2YQFA 2A9IA 4D8OA 4IZ5E 1WH4A 3J63A 4O7QA 1A1ZA 4QOBA 2O71A 3T6PA 2NZ7A 2N1FA 2MPCA 1FADA 4FH0A 1WXPA 2NAQA 1NGRA 4F42A 2DBHA 4O6XA 1ICHA 3LQQA 2N97A 4O9LA 4N1KA 4P4HI 2YU0A 2LWEA 2OF5H 1N3KA 2P1HA 2M5VA 1Z6TA 3LQRA 4N1JA 2N00A 2KN6A 2MS8A 4P4HA 2NSNA 3J6JA 2L9MA 1PN5A 4A2WA 3MOPK 4IZ7B 4JQWA 4M9SA 2N7ZA 2D96A 4RHWE 2DBFA 2DO9A 4EWIA 2HM2Q
chains in the Genus database with same CATH superfamily
2MJMA 3EZQA 4M9ZA 1D2ZA 2N83A 1E3YA 2MS7A 2BBRA 1A1WA 3YGSC 1CWWA 4IZAB 4ZBWA 2KM6A 2MN4A 3CL3A 2YGSA 2XV9A 1DGNA 3QF2A 4N1LA 1E41A 2F1SA 2L6AA 1UCPA 2VGQA 2GF5A 2BBZA 3MOPG 4F44A 1D2ZB 1WMGA 4UZ0A 4JUPA 2OF5A 2MB9A 3MOPA 1C15A 4DWNA 3YGSP 2G7RA 2LWDA 4LWDA 2B1WA 3CRDA 4E9MA 4A2QA 2LS7A 3KATA 2DBDA 1DDFA 2IB1A 1CY5A 4I16A 4O9FA 4NQKA 2YVIA 4RHWA 3EZQB 1YGOA 2A5YB 2DBGA 2N80A 4M9XA 2YQFA 2A9IA 4D8OA 4IZ5E 1WH4A 3J63A 4O7QA 1A1ZA 4QOBA 2O71A 3T6PA 2NZ7A 2N1FA 2MPCA 1FADA 4FH0A 1WXPA 2NAQA 1NGRA 4F42A 2DBHA 4O6XA 1ICHA 3LQQA 2N97A 4O9LA 4N1KA 4P4HI 2YU0A 2LWEA 2OF5H 1N3KA 2P1HA 2M5VA 1Z6TA 3LQRA 4N1JA 2N00A 2KN6A 2MS8A 4P4HA 2NSNA 3J6JA 2L9MA 1PN5A 4A2WA 3MOPK 4IZ7B 4JQWA 4M9SA 2N7ZA 2D96A 4RHWE 2DBFA 2DO9A 4EWIA 2HM2Q
chains in the Genus database with same CATH topology
2MJMA 3EZQA 4M9ZA 1D2ZA 2N83A 1E3YA 2MS7A 2BBRA 1A1WA 3YGSC 1CWWA 4IZAB 4ZBWA 2KM6A 2MN4A 3CL3A 2YGSA 2XV9A 1DGNA 3QF2A 4N1LA 1E41A 2F1SA 2L6AA 1UCPA 2VGQA 2GF5A 2BBZA 3MOPG 4F44A 1D2ZB 1WMGA 4UZ0A 4JUPA 2OF5A 2MB9A 3MOPA 1C15A 4DWNA 3YGSP 2G7RA 2LWDA 4LWDA 2B1WA 3CRDA 4E9MA 4A2QA 2LS7A 3KATA 2DBDA 1DDFA 2IB1A 1CY5A 4I16A 4O9FA 4NQKA 2YVIA 4RHWA 3EZQB 1YGOA 2A5YB 2DBGA 2N80A 4M9XA 2YQFA 2A9IA 4D8OA 4IZ5E 1WH4A 3J63A 4O7QA 1A1ZA 4QOBA 2O71A 3T6PA 2NZ7A 2N1FA 2MPCA 1FADA 4FH0A 1WXPA 2NAQA 1NGRA 4F42A 2DBHA 4O6XA 1ICHA 3LQQA 2N97A 4O9LA 4N1KA 4P4HI 2YU0A 2LWEA 2OF5H 1N3KA 2P1HA 2M5VA 1Z6TA 3LQRA 4N1JA 2N00A 2KN6A 2MS8A 4P4HA 2NSNA 3J6JA 2L9MA 1PN5A 4A2WA 3MOPK 4IZ7B 4JQWA 4M9SA 2N7ZA 2D96A 4RHWE 2DBFA 2DO9A 4EWIA 2HM2Q
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EZQ A;  4M9Z A;  1D2Z A;  2N83 A;  1E3Y A;  2MS7 A;  2BBR A;  1A1W A;  3YGS C;  1CWW A;  4IZA B;  4ZBW A;  2KM6 A;  2MN4 A;  3CL3 A;  2YGS A;  1DGN A;  3QF2 A;  4N1L A;  1E41 A;  2F1S A;  2L6A A;  1UCP A;  2VGQ A;  2GF5 A;  2BBZ A;  3MOP G;  4F44 A;  1D2Z B;  1WMG A;  4UZ0 A;  4JUP A;  2OF5 A;  2MB9 A;  3MOP A;  1C15 A;  4DWN A;  3YGS P;  2G7R A;  2LWD A;  4LWD A;  2B1W A;  3CRD A;  4E9M A;  4A2Q A;  2LS7 A;  3KAT A;  2DBD A;  1DDF A;  2IB1 A;  1CY5 A;  4I16 A;  4O9F A;  4NQK A;  2YVI A;  4RHW A;  3EZQ B;  1YGO A;  2A5Y B;  2DBG A;  2N80 A;  4M9X A;  2YQF A;  2A9I A;  4D8O A;  4IZ5 E;  1WH4 A;  3J63 A;  4O7Q A;  1A1Z A;  4QOB A;  2O71 A;  3T6P A;  2NZ7 A;  2N1F A;  2MPC A;  1FAD A;  4FH0 A;  1WXP A;  2NAQ A;  1NGR A;  4F42 A;  2DBH A;  4O6X A;  1ICH A;  3LQQ A;  2N97 A;  4O9L A;  4N1K A;  4P4H I;  2YU0 A;  2LWE A;  2OF5 H;  1N3K A;  2P1H A;  2M5V A;  1Z6T A;  3LQR A;  4N1J A;  2N00 A;  2KN6 A;  2MS8 A;  4P4H A;  2NSN A;  3J6J A;  2L9M A;  1PN5 A;  4A2W A;  3MOP K;  4IZ7 B;  4JQW A;  4M9S A;  2N7Z A;  2D96 A;  4RHW E;  2DBF A;  2DO9 A;  4EWI A;  2HM2 Q; 
#chains in the Genus database with same CATH topology
 2MJM A;  3EZQ A;  4M9Z A;  1D2Z A;  2N83 A;  1E3Y A;  2MS7 A;  2BBR A;  1A1W A;  3YGS C;  1CWW A;  4IZA B;  4ZBW A;  2KM6 A;  2MN4 A;  3CL3 A;  2YGS A;  2XV9 A;  1DGN A;  3QF2 A;  4N1L A;  1E41 A;  2F1S A;  2L6A A;  1UCP A;  2VGQ A;  2GF5 A;  2BBZ A;  3MOP G;  4F44 A;  1D2Z B;  1WMG A;  4UZ0 A;  4JUP A;  2OF5 A;  2MB9 A;  3MOP A;  1C15 A;  4DWN A;  3YGS P;  2G7R A;  2LWD A;  4LWD A;  2B1W A;  3CRD A;  4E9M A;  4A2Q A;  2LS7 A;  3KAT A;  2DBD A;  1DDF A;  2IB1 A;  1CY5 A;  4I16 A;  4O9F A;  4NQK A;  2YVI A;  4RHW A;  3EZQ B;  1YGO A;  2A5Y B;  2DBG A;  2N80 A;  4M9X A;  2YQF A;  2A9I A;  4D8O A;  4IZ5 E;  1WH4 A;  3J63 A;  4O7Q A;  1A1Z A;  4QOB A;  2O71 A;  3T6P A;  2NZ7 A;  2N1F A;  2MPC A;  1FAD A;  4FH0 A;  1WXP A;  2NAQ A;  1NGR A;  4F42 A;  2DBH A;  4O6X A;  1ICH A;  3LQQ A;  2N97 A;  4O9L A;  4N1K A;  4P4H I;  2YU0 A;  2LWE A;  2OF5 H;  1N3K A;  2P1H A;  2M5V A;  1Z6T A;  3LQR A;  4N1J A;  2N00 A;  2KN6 A;  2MS8 A;  4P4H A;  2NSN A;  3J6J A;  2L9M A;  1PN5 A;  4A2W A;  3MOP K;  4IZ7 B;  4JQW A;  4M9S A;  2N7Z A;  2D96 A;  4RHW E;  2DBF A;  2DO9 A;  4EWI A;  2HM2 Q; 
#chains in the Genus database with same CATH homology
 2MJM A;  3EZQ A;  4M9Z A;  1D2Z A;  2N83 A;  1E3Y A;  2MS7 A;  2BBR A;  1A1W A;  3YGS C;  1CWW A;  4IZA B;  4ZBW A;  2KM6 A;  2MN4 A;  3CL3 A;  2YGS A;  2XV9 A;  1DGN A;  3QF2 A;  4N1L A;  1E41 A;  2F1S A;  2L6A A;  1UCP A;  2VGQ A;  2GF5 A;  2BBZ A;  3MOP G;  4F44 A;  1D2Z B;  1WMG A;  4UZ0 A;  4JUP A;  2OF5 A;  2MB9 A;  3MOP A;  1C15 A;  4DWN A;  3YGS P;  2G7R A;  2LWD A;  4LWD A;  2B1W A;  3CRD A;  4E9M A;  4A2Q A;  2LS7 A;  3KAT A;  2DBD A;  1DDF A;  2IB1 A;  1CY5 A;  4I16 A;  4O9F A;  4NQK A;  2YVI A;  4RHW A;  3EZQ B;  1YGO A;  2A5Y B;  2DBG A;  2N80 A;  4M9X A;  2YQF A;  2A9I A;  4D8O A;  4IZ5 E;  1WH4 A;  3J63 A;  4O7Q A;  1A1Z A;  4QOB A;  2O71 A;  3T6P A;  2NZ7 A;  2N1F A;  2MPC A;  1FAD A;  4FH0 A;  1WXP A;  2NAQ A;  1NGR A;  4F42 A;  2DBH A;  4O6X A;  1ICH A;  3LQQ A;  2N97 A;  4O9L A;  4N1K A;  4P4H I;  2YU0 A;  2LWE A;  2OF5 H;  1N3K A;  2P1H A;  2M5V A;  1Z6T A;  3LQR A;  4N1J A;  2N00 A;  2KN6 A;  2MS8 A;  4P4H A;  2NSN A;  3J6J A;  2L9M A;  1PN5 A;  4A2W A;  3MOP K;  4IZ7 B;  4JQW A;  4M9S A;  2N7Z A;  2D96 A;  4RHW E;  2DBF A;  2DO9 A;  4EWI A;  2HM2 Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...