4P4IA

X-ray structure of human glutamate carboxypeptidase ii (gcpii) in complex with a phosphoramidate inhibitor t33
Total Genus 261
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
261
sequence length
696
structure length
692
Chain Sequence
KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glutamate carboxypeptidase 2
publication title Design of composite inhibitors targeting glutamate carboxypeptidase II: the importance of effector functionalities.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 261
structure length 692
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2014-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 4p4iA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4p4iA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4p4iA02
4P45A 5D29A 5LYFA 3HUVA 4MHYA 2PIZA 2ZOFA 3WABA 5DS0A 2J9AA 4ZYQA 4P4EA 4MCRA 1ELLP 4PXEA 1VIXA 2QVPA 4R76A 4EMEA 3KASA 4EWTA 4PXDA 1LOKA 4TJVA 3IIBA 1Z2LA 4CPAA 3KQXA 4O23A 5K8OA 3N5FA 1FT7A 1F2PA 2CF4A 2ZEOA 2PIYA 3PB6X 4PXBA 4K3NA 4P4FA 4JZ0A 1CBXA 4G1PA 4GM5A 4UEZA 1Y0RA 2V8VA 2F7VA 5THWA 1BLLE 2PJ0A 1ZLHA 3ISZA 5HVHA 2O53A 1ELMP 5J1QA 2PJ8A 3SJGA 2QYVA 1YW6A 1Y0YA 1IY7A 4FUUA 4P4DA 1XJOA 2ZENA 2GLJA 3ISXA 2XEFA 1VHEA 4PPZA 4R6TA 4MXUA 3T8WA 1TKHA 3FX6A 2AFOA 4C9VA 4C8PA 2BOAA 2PJCA 3H8FA 4FWUA 4C8FA 4EFDA 4OC0A 1EE3P 4JYWA 4WWVA 2DEAA 1PYTB 1VHOA 2ZEDA 3B35A 3RAMA 1HEEA 3IWWA 3WC6A 2O4HA 1XRYA 4MMOA 2EK9A 3MN8A 3B3CA 1CP7A 3TC8A 3S9NA 4KSIA 3B7IA 4IHMA 3I6SA 3IEHA 5HXDA 2AFSA 2CTCA 2ZOGA 3KI9A 3VARA 3B3VA 3KGQA 2ZEEA 1CPSA 2OR4A 2QJ8A 3SJFA 3B3TA 3KHZA 1LAMA 3KZWA 4DUKA 4F9UA 1FNOA 5I4MA 4ZX8A 3FH4A 4YN3A 1R43A 3WC7A 2AFWA 3CT9A 3JRUA 5LRGA 5JH9A 4C8TA 3NA6A 3H8EA 3KR4A 4IAVA 3PB9X 3WC5A 4X3RA 4UIAA 3BI0A 2ZEGA 2JBKA 4MRIA 3FEEA 1F57A 5LYLA 4TWEA 2BCOA 3SI2A 5K8MA 2ZEPA 1XBUA 2C1CA 3H8GA 4OC5A 3FEDA 4R7MA 4F9VA 3S9MA 3ICUA 4TJXA 4AXVA 1CX8A 3D68A 4YU9A 1LANA 3KQZA 2NSMA 2PCUA 4OKOA 2AFUA 1TF8A 3D7GA 3D7FA 2PE3A 1TF9A 2BO9A 4NGRA 1BAVA 4P6YA 4MHNA 4NGTA 3IC1A 3D4UA 1IGBA 2PJ4A 5HVGA 4A94A 4OIWA 4NGQA 3IFEA 2F8HA 4C9AA 5ELYA 4NGMA 3KR5A 3V7ZA 3I74A 4P10A 3CPXA 3CPAA 4UIBA 3FMCA 4NGSA 3PBEA 3FVLA 3PEIA 4CDKA 2WZNA 2PJ6A 4F8ZA 5LYDA 4ZY2A 1HDQA 5CPAA 4UF4A 3SI1A 3VTAA 2JBJA 4NJRA 4DYOA 4C9RA 4TNUA 3K9TA 2XEIA 4YWYA 5HVFA 3NFZA 4UEFA 2XEGA 1ZG9A 4C9EA 4NGPA 2FVGA 3K2KA 3D7HA 1KWMA 8CPAA 4NJQA 5F09A 1YSJA 1XFOA 2C6GA 1QMUA 5JGFA 4H2KA 3B3WA 1H8LA 3FF3A 2Q51A 7CPAA 4C99A 4ONWA 3B3SA 2RFHA 1AMPA 3PRTA 2EK8A 3PFEA 1CP6A 4P44A 1LCPA 4OC2A 4R8FA 4FAIA 1HDUA 3DGVA 1DE4C 2OOTA 1M4LA 5LRKA 2HB6A 3EIFA 4PXCA 2IQ6A 4BD9A 3PBBA 4OP4A 4A37A 2ZEHA 1ZLIA 1XF1A 3GB0A 1YMEA 1WVMA 3PB4X 2Q4ZA 3QNVA 1UWYA 3IJ3A 1NSAA 1PCAA 2CTBA 2V8GA 4FBEA 2V8DA 4MHPA 4OC1A 2PJBA 4ZX9A 4PQAA 2ZEFA 3KL9A 2AFZA 2VL1A 4IK2A 2Q43A 1DTDA 3PFOA 4C86A 2PVWA 2G9DA 2PJ7A 2AFXA 1Z8LA 3GLJA 4WJBA 4DJLA 2JEWA 1RTQA 1ZG8A 3PB7X 6CPAA 4RUHA 4P4BA 1Y7EA 1CG2A 1QQ9A 3SI0A 2HC9A 2C6CA 4W9YA 2PJ2A 1JQGA 4X8IA 2ABZA 3RBUA 3LMSA 5JM6A 3LWUA 4A39A 2V8HA 4C8CA 4OMEA 4UEEA 1TKFA 2ZEMA 2PJ9A 2PJ3A 3D67A 3VH9A 1BPMA 2PJ5A 3HLPA 1R3NA 3I1UA 1LAPA 3L2NA 3GUXA 1V6CA 2IJZA 3S9LA 1XMBA 3MRUA 3CDXA 3D7DA 4NGNA 4C8UA 3DLJA 4ZI6A 4C85A 3BHXA 5LYIA 1BPNA 2PRQA 1ARMA 4C9UA 3VATA 4OC4A 1Q7LA 2V77A 3PB8X 2GREA 2AFMA 1AYEA 1YW4A 5K8PA 3IO1A 3SJXA 4NFRA 1OBRA 3FJUA 2GU2A 1TXRA 2PJ1A 2IMOA 2C6PA 5IB9A 1Y9ZA 1CPXA 1ZG7A 2RB7A 3V38A 4ZY1A 4OC3A 3B2YA 2WYRA 4Z65A 5K8NA 4Q7AA 4MCPA 2PJAA 1VGYA 4P4IA 1GYTA 5CBMA 2CIJA 4CDJA 4P4JA 2I3CA 3NH8A 2ANPA 2EWBA 3NH5A 5LRJA 3D66A 4B6ZA 2ZELA 3BXMA 4LQGA 4KNGE 4C8AA 4C84A 4X2TA 1F2OA 1ARLA 1TKJA 4OIDA 2GLFA 1Z5RA 4A38A 2NYQA 1YLOA 3KHXA 2PVVA 3WT4A 4MHZA 4MCSA 3TX8A 4ZY0A 4MCQA 2XEJA 5D8NA 3SJEA 3RZAA 3NH4A 1LFWA 2POKA 3FECA 3BI1A
chains in the Genus database with same CATH superfamily
4MFPA 4P45A 5D29A 5LYFA 3S6HA 5HMNA 3HUVA 5JYBA 4MHYA 2PIZA 2ZOFA 3WABA 5DS0A 2J9AA 4ZYQA 4MI1A 1Z8XA 4P4EA 2OZGA 1Q5XA 3QAYA 4MCRA 1QSTA 2BUEA 2FM4A 1ELLP 4A4BA 2B3VA 2EBJA 4PXEA 2X0SA 1VIXA 2J8RA 4YFJA 2QVPA 3T07A 2REFA 5K99A 4R76A 4EYSA 4JWPA 3TOAA 4EMEA 4INJA 2Z3PA 3LD2A 3HPHE 2Z3LA 2B5GB 3KASA 3LODA 4EWTA 5C82A 4PXDA 5H84A 1LOKA 4B5PA 4TJVA 3TLGA 4E0AA 5AXIA 2CNSA 3D2PA 3IIBA 4PK3A 1C3OB 5JQ4A 2FL4A 1QSOA 1Z2LA 4C2ZA 4CPAA 3KQXA 2PR1A 1KC7A 4O23A 2C27A 3KRVA 5K8OA 1QSRA 3N5FA 1FT7A 1F2PA 5BY0A 2AE6A 2CF4A 2ZEOA 2B4BA 4FD7A 4NCZA 4XPDC 2PIYA 3PB6X 2P6EA 3A9LA 1IICA 4ZGYB 4PXBA 4K3NA 4P4FA 2D4OA 4JZ0A 1CBXA 1U6MA 4G1PA 4GM5A 4UEZA 1Y0RA 2V8VA 3PT1A 4CS0B 1Z9UA 3U88C 2F7VA 5THWA 3PLFB 1BLLE 2PJ0A 2X7BA 1ZLHA 3B8GA 4MFJA 3F9KC 2Z3MA 3ISZA 2YNCC 1Y7RA 5HVHA 4II9A 5F5XA 2O53A 1ELMP 3VRPA 1YREA 1Z4EA 2PJ8A 5J1QA 3GJZA 3SJGA 2QYVA 1YW6A 4BPWB 4H6UA 4KLWA 1Y0YA 2Z3OA 3CXQA 1IY7A 1Z8TA 4P4DA 2Z11A 4FUUA 1XJOA 2ZENA 4C68A 4MI4A 2B5GA 2GLJA 5F46A 3QAHA 4F6AA 4KVXA 2ZW7A 3ISXA 2XEFA 1VHEA 4PPZA 4R6TA 4MXUA 3T8WA 1TKHA 3FX6A 2AFOA 4Y49B 4C9VA 1YGHA 4XNHC 2BOAA 2Q7BA 4C8PA 2PJCA 2PC1A 3H8FA 4FWUA 3TFYA 2YNEA 1CS0B 4C8FA 3DR6A 3VRRA 4EFDA 3VRNA 1EO0A 1JWQA 3OAKA 5AGEA 4E5SA 3EO4A 4OC0A 3ZNIA 4JYWA 1EE3P 3ZJ0A 4WWVA 4CRYB 4QBJA 3JVNA 2DEAA 1PYTB 2CY2A 1VHOA 2ZEDA 4KS9A 3B35A 1CE8B 4JXRA 4A2ZA 3EXNA 3RAMA 3OP0A 1HEEA 2P0WA 2OZHA 3IWWA 3BJ7A 4BTFA 3C26A 3WC6A 2O4HA 3TTHA 3T05A 5F47A 1L0CA 1XRYA 4CAXA 1VBGA 4MMOA 2EK9A 3RNZA 3MN8A 3B3CA 1KUYA 3VRQA 2RC4A 3NFQA 1CP7A 3TC8A 1XE4A 1WWZA 3S9NA 2J8NA 4KSIA 4YRHA 5E96A 3B7IA 3G8WA 3TLCA 1M4DA 4IHMA 3I6SA 5G1ZA 5HH1A 2XPOA 3IU2A 4AG9A 3IEHA 5HXDA 1FY7A 3E0KA 2O28A 4MY0A 4C7IA 5I0CA 1IB1E 5ISVA 2AFSA 2CTCA 2ZOGA 1K4JA 3KI9A 1Q2DA 4JLYA 3VARA 4C2XA 2D4PA 4KOVA 3B3VA 4KOTA 3T0TA 3KGQA 4B5OA 5KTCA 4CAEA 2ZEEA 2I79A 1CPSA 2OR4A 1KZFA 2B4JC 1RXTA 2PRBA 2QJ8A 5DWMA 1IIDA 1A2ZA 3SJFA 1OZPA 3TLYA 1ON0A 3B3TA 3KHZA 3P2HA 4ZBGA 2ATRA 1LAMA 3KZWA 4DUKA 2B4DB 4F9UA 1FNOA 4UBRA 5I4MA 4ZX8A 4E2AA 3FH4A 4YN3A 1B87A 1KUVA 1R43A 4JD6A 4Q38A 3WC7A 1BXRB 2CXAA 2GFQA 1C30B 2AFWA 3CT9A 3JRUA 2R82A 4R3KA 3D8PA 3K9UA 4KOSA 5LRGA 4A31A 5JH9A 4C8TA 3HPGG 1YX0A 3NA6A 3FBUA 2G0BA 1RO5A 3IGRA 4HKFA 3H8EA 3KR4A 2EZCA 3S6GA 3EY5A 4UFXA 4UWJA 4U9ZA 2VZZA 1GGOA 4IAVA 4IIYA 1XF1A 2XPNA 2FIAA 2R1IA 3PB9X 2ZW6A 2VBQA 3WC5A 4X3RA 4UIAA 1MJAA 3GKRA 3HMJG 1M1DA 3BI0A 3V8IA 2HQYA 2ZEGA 2JBKA 4NF1A 1ZL0A 4MY3A 4MRIA 2DPSA 3FEEA 1F57A 3ZZIA 5IB0A 5LYLA 4TWEA 2BCOA 3SI2A 3IU1A 2ZEPA 5K8MA 1IOIA 1XBUA 2C1CA 3H8GA 3C8OA 3JUWA 4OC5A 3T5MA 3FEDA 1YR0A 2B3UA 4R7MA 1MK4A 5JVLA 2G3TA 4F9VA 3PP9A 2FXFA 1QSMA 3S9MA 4RN7A 3ICUA 5IV0A 4CAFA 4I49A 4B10A 3SXOA 4TJXA 2Q7SA 4AXVA 2OB0A 1CX8A 4OAEA 1Z9EA 3D68A 2B4DA 2PSWA 4YU9A 1EZAA 2Q44A 1LANA 3DSBA 3KQZA 2NSMA 2PCUA 1A9XB 2FE7A 3R1KA 4OKOA 1SQHA 2AFUA 3IWGA 1BOBA 3D7GA 1TF8A 3D7FA 2PE3A 1TF9A 4XPKA 2BO9A 4HNXB 4PK2A 4UFWA 5IX3A 1S3ZA 1WJTA 4F0YA 4HNWB 4NGRA 1BAVA 4MJXA 2WPXA 4P6YA 4MHNA 5F9MA 4DNCA 5BWAB 4NGTA 3IC1A 4GXHA 4Y49C 3D4UA 1IGBA 2EZAA 1P0HA 2EO8A 1YQEA 2OZUA 1R57A 2CNMA 2PJ4A 4A94A 5HKYA 3D3SA 4OIWA 4NGQA 5HVGA 4QVTA 1YVOA 5FD8A 4M85A 3IFEA 3R95A 2F8HA 2MP0A 4C9AA 5ELYA 4HNYB 4NGMA 3KR5A 2JLMA 3V7ZA 1KEEB 3I74A 2UV8G 4P10A 1IYKA 4PV6A 2JEVA 1NSLA 3CPXA 3CPAA 4UIBA 2ZW5A 3GYAA 3F5BA 3FMCA 4H6ZA 2IL4A 4NGSA 3PBEA 3FVLA 4F0XA 3GY9A 3PEIA 4PSWA 4CDKA 2WZNA 4EVYA 2PJ6A 4GS4A 4F8ZA 5LYDA 5A27A 4KOYA 4ZY2A 1HDQA 2FS5A 5CPAA 4UF4A 4CGOA 3EZAA 2B0AA 3SI1A 3VTAA 2JBJA 1M44A 4NJRA 2ODFA 4KSAA 4M6HA 3NE8A 2PQ8A 4KLVA 3BUMB 3TE4A 4CGMA 2EVNA 4DYOA 3VGOA 2Z10A 4B12A 1WK4A 3EZEA 4C9RA 4TNUA 3K9TA 4NXYA 2XEIA 3CZXA 4YWYA 5HVFA 3TOBA 1IU8A 3NFZA 4UEFA 4JXQA 2OU2A 4M6IA 2HWGA 4UFVA 2GP4A 4AVBA 2XEGA 2BL1A 2ZPAA 1ZG9A 4C9EA 4R57A 3NOJA 3TO6A 4NGPA 4CAVA 3VWEA 4BPUB 2FVGA 3K2KA 3TO9A 3D7HA 1KWMA 4PSXA 5H86A 8CPAA 4NJQA 2DIKA 4QUSA 4M8DA 3DNSA 5KTDA 4QC6A 5F09A 3R9FA 3S6FA 3W91A 4COBA 1YSJA 1XFOA 2C6GA 1QMUA 4IIXA 4RS2A 4H2KA 5JGFA 3B3WA 1MJBA 1H8LA 4JVOA 1FBVA 2VZYA 1Y9KA 3FF3A 2FSRA 2Q51A 7CPAA 4C99A 4ONWA 2WUUA 3S6KA 3B3SA 1EZBA 4CGLA 4LUAA 1YVKA 2RFHA 4CGNA 3F0AA 1S5KA 3EFAA 1AMPA 2QECA 3EZBA 3PRTA 4FD4A 2EK8A 3PFEA 1CP6A 3K4IA 4K30A 1ZO0A 4P44A 1LCPA 4OC2A 1R61A 1Q2YA 4AG7A 4R8FA 4GPLB 5J8CA 1JDEA 4B11A 4A95A 3SXNA 3H5ZA 3SR3A 4FAIA 1S7FA 1HDUA 2DPTA 3DGVA 4CYOA 1DE4C 2FCKA 4MFKA 1BO4A 2I00A 2OOTA 4CAWA 4H1HA 1S7NA 2YNDA 1M4LA 2A4NA 2REEA 4UCNA 4LQ6A 5LRKA 2VEZA 2HB6A 4IF5A 3EIFA 2Y0MA 3UY5A 4PXCA 4C2YA 2IQ6A 2NMTA 2YGWA 4NSQA 4BD9A 2J8MA 3TLAA 5AG7A 1YLEA 4KVOE 1QSNA 1S60A 2JDCA 1ZRSA 1Z4RA 2GANA 3PBBA 5AG6A 2AJ6A 4HPSA 4OP4A 4CGPA 4ORFA 4A37A 1T36B 2N3AB 2ZEHA 1ZLIA 4CYPA 4KZTA 2HV2A 3G3SA 2BSWA 2P6FA 1YMEA 3GB0A 4KORA 5C88A 1WVMA 3PB4X 2Q04A 2VKZG 3TLGB 3TT2A 2WSAA 4A33A 5EBVA 2Q4ZA 3QNVA 5F48A 3NE7A 1UWYA 2KCWA 2WPWA 5HKWA 1PU9A 2DXQA 4MFQA 3CXSA 3IJ3A 1NSAA 1PCAA 2CTBA 2V8GA 4U5YA 3G23A 3MGDA 2V8DA 3BUNB 4M3SA 1XEBA 2Z3KA 4MHPA 4FBEA 2HI6A 4OC1A 1NBWA 2PJBA 4ZX9A 4PQAA 3EC4A 5A28A 2ZEFA 4KOUA 3KL9A 2AFZA 2VL1A 4IK2A 2ARHA 5EC4A 2Q43A 2ZXVA 1DTDA 5F13A 4BMHA 5J8FA 4E94A 3PFOA 4AVAA 2PVWA 5IR2A 2G9DA 4C86A 2FT0A 2PJ7A 3BJ8A 4KOWA 2AFXA 3R9EA 1Z8LA 3GLJA 2HROA 1I12A 3I3GA 4RI1A 4WJBA 4DJLA 2JEWA 1RTQA 4MJ8A 3SHPA 4BPXB 1MJ9A 4OLLA 1ZG8A 3OWCA 3PB7X 2F5IA 2CBLA 1PUAA 3IWEA 3GIUA 4B14A 6CPAA 2Z0ZA 4RUHA 4P4BA 3W6SA 1Y7EA 4AVCA 5G21A 1I21A 1Z8WA 4KOXA 1CG2A 1QQ9A 4C7HA 3DDDA 4Q36A 3SI0A 1VKCA 1AUGA 2HC9A 2PR8A 5G22A 4A32A 2C6CA 1VBHA 4W9YA 2C5QA 2B58A 3R96A 1JQGA 2PJ2A 4X8IA 2ABZA 3BLNA 5DWNA 3FRMA 4KUAA 1NMTA 2XPPA 3RBUA 3LMSA 3TLZA 4JJXA 5JM6A 2E28A 3OB2B 1S7LA 3LWUA 4A39A 1XF8A 2V8HA 4MBUA 2AUMA 4OMEA 1IYLA 1XIXA 1TKFA 4UEEA 2P6GA 2ZEMA 4C8CA 2PJ9A 2QIRA 4IUSA 2DF5A 2PJ3A 3D67A 4OADA 1B47A 2YJVA 3VH9A 4COGA 4BBHA 1BPMA 1TIQA 3P2FA 4X5KA 5F1YA 2EUIA 1S7KA 2QMLA 1M6VB 2PJ5A 1XMTA 1XOVA 3HLPA 3JTKA 1R3NA 3I1UA 1LAPA 4NEXA 5F49A 3TCVA 2K5TA 1J4JA 5HKZA 2PDOA 3L2NA 2PCNA 3BUWB 3GUXA 1V6CA 1X10A 2IJZA 3PGPA 3S9LA 2OLSA 1XMBA 3MRUA 1DIKA 2Z3NA 2DLAA 2VXKA 3CDXA 2GE3A 3D7DA 1I1DA 4UCPA 4NGNA 4RR2B 1VI4A 2D0OA 4C8UA 1Q2CA 4AB7A 2OH1A 3DLJA 2Q0YA 2R7HA 4ZI6A 1J3LA 1ZYMA 4C85A 3W6XA 3O8ZA 3BHXA 3TYXA 4J0NA 3FNCA 5LYIA 4XPDB 3FIXA 4QB9A 1BPNA 2PRQA 4R3LA 1ARMA 4FD5A 2D0PA 1M4IA 1Q7LA 4OC4A 1IOFA 2V77A 3PB8X 1M4GA 4UWIA 3VATA 2GREA 3F8KA 2AFMA 4BINA 1JDBC 4FD6A 1AYEA 1YW4A 5K8PA 4U9YA 3I9SA 3IO1A 4R87A 4CYNA 2BEIA 3BUXB 3SJXA 4H89A 4NFRA 1OBRA 3FJUA 4MFLA 4YGOA 2GU2A 4R9MA 1TXRA 3T90A 2PJ1A 5J3XA 2C6PA 1YK3A 2IMOA 5IB9A 4C9UA 1LRZA 2ZW4A 1CPXA 1Y9ZA 3U1BA 5G20A 1ZG7A 1V0CA 2AUNA 3BUOB 5KTAA 3TO7A 3FB3A 2RB7A 4XPLA 3V38A 5FVJA 4ZY1A 1NXJA 2YJTA 1CM0A 2CNTA 1GHEA 5AG5A 3PZJA 4OC3A 4M6GA 1UFHA 1B6BA 2VQYA 2WYRA 3B2YA 4UA3A 4UCMA 3WR7A 5GCNA 3VWDA 4Z65A 5JPHA 4J3GA 3CXPA 4CRZB 4L89A 5K8NA 3DR8A 4KVME 4Q7AA 3TLBA 1CJWA 1KBLA 4MCPA 4XNHB 4KUBA 3RYOA 3R9GA 2PJAA 4L8AA 4KSFA 1VGYA 4P4IA 3T9YA 1KUXA 1GYTA 1Y9WA 3VROA 2Y1MA 1X12A 2JDDA 2CIJA 3N7ZA 4A30A 5CBMA 1YVHA 3TLEA 4CDJA 2XPLA 3QB8A 4P4JA 2I3CA 3NH8A 2Q4VA 5CNPA 2ANPA 2EWBA 3NH5A 5LRJA 3D66A 4B6ZA 4CZ1A 2Y1NA 2ZELA 3FXTA 3BXMA 3OB1B 3PFVA 4LQGA 4LX9A 3D2MA 4KNGE 4C8AA 4C84A 4X2TA 1F2OA 1ARLA 1TKJA 4OIDA 4CYQA 2GLFA 1Z5RA 3LACA 4B5PB 4A38A 2NYQA 4CO9A 1YLOA 2R98A 4A4CA 2Q4YA 2YNCA 4MHDA 2GIVA 2VI7A 2PVVA 1P4NA 3KHXA 3WT4A 4MHZA 5AG4A 4MCSA 4ONUA 3TX8A 4B13A 4ZY0A 3FYNA 2H5MA 1N71A 5EMIA 4MCQA 1NE9A 3RO0A 1VHSA 2XEJA 3H4QA 5D8NA 2R8VA 3SJEA 3KKWA 4MFZA 3RZAA 2HUZA 2FIWA 4E8OA 3NH4A 2G3AA 1LFWA 2EZBA 2POKA 3FECA 3BI1A
chains in the Genus database with same CATH topology
4P45A 5D29A 5LYFA 3HUVA 4MHYA 2PIZA 2ZOFA 3WABA 5DS0A 2J9AA 4ZYQA 4P4EA 4MCRA 1ELLP 4PXEA 1VIXA 2QVPA 4R76A 4EMEA 3KASA 4EWTA 4PXDA 1LOKA 4TJVA 3IIBA 1Z2LA 4CPAA 3KQXA 4O23A 5K8OA 3N5FA 1FT7A 1F2PA 2CF4A 2ZEOA 2PIYA 3PB6X 4PXBA 4K3NA 4P4FA 4JZ0A 1CBXA 4G1PA 4GM5A 4UEZA 1Y0RA 2V8VA 2F7VA 5THWA 1BLLE 2PJ0A 1ZLHA 3ISZA 5HVHA 2O53A 1ELMP 5J1QA 2PJ8A 3SJGA 2QYVA 1YW6A 1Y0YA 1IY7A 4FUUA 4P4DA 1XJOA 2ZENA 2GLJA 3ISXA 2XEFA 1VHEA 4PPZA 4R6TA 4MXUA 3T8WA 1TKHA 3FX6A 2AFOA 4C9VA 4C8PA 2BOAA 2PJCA 3H8FA 4FWUA 4C8FA 4EFDA 4OC0A 1EE3P 4JYWA 4WWVA 2DEAA 1PYTB 1VHOA 2ZEDA 3B35A 3RAMA 1HEEA 3IWWA 3WC6A 2O4HA 1XRYA 4MMOA 2EK9A 3MN8A 3B3CA 1CP7A 3TC8A 3S9NA 4KSIA 3B7IA 4IHMA 3I6SA 3IEHA 5HXDA 2AFSA 2CTCA 2ZOGA 3KI9A 3VARA 3B3VA 3KGQA 2ZEEA 1CPSA 2OR4A 2QJ8A 3SJFA 3B3TA 3KHZA 1LAMA 3KZWA 4DUKA 4F9UA 1FNOA 5I4MA 4ZX8A 3FH4A 4YN3A 1R43A 3WC7A 2AFWA 3CT9A 3JRUA 5LRGA 5JH9A 4C8TA 3NA6A 3H8EA 3KR4A 4IAVA 3PB9X 3WC5A 4X3RA 4UIAA 3BI0A 2ZEGA 2JBKA 4MRIA 3FEEA 1F57A 5LYLA 4TWEA 2BCOA 3SI2A 5K8MA 2ZEPA 1XBUA 2C1CA 3H8GA 4OC5A 3FEDA 4R7MA 4F9VA 3S9MA 3ICUA 4TJXA 4AXVA 1CX8A 3D68A 4YU9A 1LANA 3KQZA 2NSMA 2PCUA 4OKOA 2AFUA 1TF8A 3D7GA 3D7FA 2PE3A 1TF9A 2BO9A 4NGRA 1BAVA 4P6YA 4MHNA 4NGTA 3IC1A 3D4UA 1IGBA 2PJ4A 5HVGA 4A94A 4OIWA 4NGQA 3IFEA 2F8HA 4C9AA 5ELYA 4NGMA 3KR5A 3V7ZA 3I74A 4P10A 3CPXA 3CPAA 4UIBA 3FMCA 4NGSA 3PBEA 3FVLA 3PEIA 4CDKA 2WZNA 2PJ6A 4F8ZA 5LYDA 4ZY2A 1HDQA 5CPAA 4UF4A 3SI1A 3VTAA 2JBJA 4NJRA 4DYOA 4C9RA 4TNUA 3K9TA 2XEIA 4YWYA 5HVFA 3NFZA 4UEFA 2GP4A 2XEGA 1ZG9A 4C9EA 4NGPA 2FVGA 3K2KA 3D7HA 1KWMA 8CPAA 4NJQA 5F09A 1YSJA 1XFOA 2C6GA 1QMUA 5JGFA 4H2KA 3B3WA 1H8LA 3FF3A 2Q51A 7CPAA 4C99A 4ONWA 3B3SA 2RFHA 1AMPA 3PRTA 2EK8A 3PFEA 1CP6A 4P44A 1LCPA 4OC2A 4R8FA 4FAIA 1HDUA 3DGVA 1DE4C 2OOTA 1M4LA 5LRKA 2HB6A 3EIFA 4PXCA 2IQ6A 4BD9A 3PBBA 4OP4A 4A37A 2ZEHA 1ZLIA 1XF1A 3GB0A 1YMEA 1WVMA 3PB4X 2Q4ZA 3QNVA 1UWYA 3IJ3A 1NSAA 1PCAA 2CTBA 2V8GA 4FBEA 2V8DA 4MHPA 4OC1A 2PJBA 4ZX9A 4PQAA 2ZEFA 3KL9A 2AFZA 2VL1A 4IK2A 2Q43A 1DTDA 3PFOA 4C86A 2PVWA 5IR2A 2G9DA 2PJ7A 2AFXA 1Z8LA 3GLJA 4WJBA 4DJLA 2JEWA 1RTQA 1ZG8A 3PB7X 6CPAA 4RUHA 4P4BA 1Y7EA 1CG2A 1QQ9A 3SI0A 2HC9A 2C6CA 4W9YA 2C5QA 2PJ2A 1JQGA 4X8IA 2ABZA 3RBUA 3LMSA 5JM6A 3LWUA 4A39A 2V8HA 4C8CA 4OMEA 4UEEA 1TKFA 2ZEMA 2PJ9A 2PJ3A 3D67A 3VH9A 1BPMA 2PJ5A 3HLPA 1R3NA 3I1UA 1LAPA 3L2NA 3GUXA 1V6CA 2IJZA 3S9LA 1XMBA 3MRUA 3CDXA 3D7DA 4NGNA 4C8UA 3DLJA 4ZI6A 4C85A 3BHXA 5LYIA 1BPNA 2PRQA 1ARMA 4C9UA 3VATA 4OC4A 1Q7LA 2V77A 3PB8X 2GREA 2AFMA 1AYEA 1YW4A 5K8PA 3IO1A 3SJXA 4NFRA 1OBRA 3FJUA 2GU2A 1TXRA 2PJ1A 2IMOA 2C6PA 5IB9A 1Y9ZA 1CPXA 1ZG7A 2RB7A 3V38A 4ZY1A 4OC3A 3B2YA 2WYRA 4Z65A 5K8NA 4Q7AA 4MCPA 2PJAA 1VGYA 4P4IA 1GYTA 5CBMA 2CIJA 4CDJA 4P4JA 2I3CA 3NH8A 2ANPA 2EWBA 3NH5A 5LRJA 3D66A 4B6ZA 2ZELA 3BXMA 4LQGA 4KNGE 4C8AA 4C84A 4X2TA 1F2OA 1ARLA 1TKJA 4OIDA 2GLFA 1Z5RA 4A38A 2NYQA 1YLOA 3KHXA 2PVVA 3WT4A 4MHZA 4MCSA 3TX8A 4ZY0A 4MCQA 2XEJA 5D8NA 3SJEA 3RZAA 3NH4A 1LFWA 2POKA 3FECA 3BI1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P45 A;  5D29 A;  5LYF A;  3HUV A;  4MHY A;  2PIZ A;  2ZOF A;  3WAB A;  5DS0 A;  2J9A A;  4ZYQ A;  4P4E A;  4MCR A;  1ELL P;  4PXE A;  1VIX A;  2QVP A;  4R76 A;  4EME A;  3KAS A;  4EWT A;  4PXD A;  1LOK A;  4TJV A;  3IIB A;  1Z2L A;  4CPA A;  3KQX A;  4O23 A;  5K8O A;  3N5F A;  1FT7 A;  1F2P A;  2CF4 A;  2ZEO A;  2PIY A;  3PB6 X;  4PXB A;  4K3N A;  4P4F A;  4JZ0 A;  1CBX A;  4G1P A;  4GM5 A;  4UEZ A;  1Y0R A;  2V8V A;  2F7V A;  5THW A;  1BLL E;  2PJ0 A;  1ZLH A;  3ISZ A;  5HVH A;  2O53 A;  1ELM P;  5J1Q A;  2PJ8 A;  3SJG A;  2QYV A;  1YW6 A;  1Y0Y A;  1IY7 A;  4FUU A;  4P4D A;  1XJO A;  2ZEN A;  2GLJ A;  3ISX A;  2XEF A;  1VHE A;  4PPZ A;  4R6T A;  4MXU A;  3T8W A;  1TKH A;  3FX6 A;  2AFO A;  4C9V A;  4C8P A;  2BOA A;  2PJC A;  3H8F A;  4FWU A;  4C8F A;  4EFD A;  4OC0 A;  1EE3 P;  4JYW A;  4WWV A;  2DEA A;  1PYT B;  1VHO A;  2ZED A;  3B35 A;  3RAM A;  1HEE A;  3IWW A;  3WC6 A;  2O4H A;  1XRY A;  4MMO A;  2EK9 A;  3MN8 A;  3B3C A;  1CP7 A;  3TC8 A;  3S9N A;  4KSI A;  3B7I A;  4IHM A;  3I6S A;  3IEH A;  5HXD A;  2AFS A;  2CTC A;  2ZOG A;  3KI9 A;  3VAR A;  3B3V A;  3KGQ A;  2ZEE A;  1CPS A;  2OR4 A;  2QJ8 A;  3SJF A;  3B3T A;  3KHZ A;  1LAM A;  3KZW A;  4DUK A;  4F9U A;  1FNO A;  5I4M A;  4ZX8 A;  3FH4 A;  4YN3 A;  1R43 A;  3WC7 A;  2AFW A;  3CT9 A;  3JRU A;  5LRG A;  5JH9 A;  4C8T A;  3NA6 A;  3H8E A;  3KR4 A;  4IAV A;  3PB9 X;  3WC5 A;  4X3R A;  4UIA A;  3BI0 A;  2ZEG A;  2JBK A;  4MRI A;  3FEE A;  1F57 A;  5LYL A;  4TWE A;  2BCO A;  3SI2 A;  5K8M A;  2ZEP A;  1XBU A;  2C1C A;  3H8G A;  4OC5 A;  3FED A;  4R7M A;  4F9V A;  3S9M A;  3ICU A;  4TJX A;  4AXV A;  1CX8 A;  3D68 A;  4YU9 A;  1LAN A;  3KQZ A;  2NSM A;  2PCU A;  4OKO A;  2AFU A;  1TF8 A;  3D7G A;  3D7F A;  2PE3 A;  1TF9 A;  2BO9 A;  4NGR A;  1BAV A;  4P6Y A;  4MHN A;  4NGT A;  3IC1 A;  3D4U A;  1IGB A;  2PJ4 A;  5HVG A;  4A94 A;  4OIW A;  4NGQ A;  3IFE A;  2F8H A;  4C9A A;  5ELY A;  4NGM A;  3KR5 A;  3V7Z A;  3I74 A;  4P10 A;  3CPX A;  3CPA A;  4UIB A;  3FMC A;  4NGS A;  3PBE A;  3FVL A;  3PEI A;  4CDK A;  2WZN A;  2PJ6 A;  4F8Z A;  5LYD A;  4ZY2 A;  1HDQ A;  5CPA A;  4UF4 A;  3SI1 A;  3VTA A;  2JBJ A;  4NJR A;  4DYO A;  4C9R A;  4TNU A;  3K9T A;  2XEI A;  4YWY A;  5HVF A;  3NFZ A;  4UEF A;  2XEG A;  1ZG9 A;  4C9E A;  4NGP A;  2FVG A;  3K2K A;  3D7H A;  1KWM A;  8CPA A;  4NJQ A;  5F09 A;  1YSJ A;  1XFO A;  2C6G A;  1QMU A;  5JGF A;  4H2K A;  3B3W A;  1H8L A;  3FF3 A;  2Q51 A;  7CPA A;  4C99 A;  4ONW A;  3B3S A;  2RFH A;  1AMP A;  3PRT A;  2EK8 A;  3PFE A;  1CP6 A;  4P44 A;  1LCP A;  4OC2 A;  4R8F A;  4FAI A;  1HDU A;  3DGV A;  1DE4 C;  2OOT A;  1M4L A;  5LRK A;  2HB6 A;  3EIF A;  4PXC A;  2IQ6 A;  4BD9 A;  3PBB A;  4OP4 A;  4A37 A;  2ZEH A;  1ZLI A;  1XF1 A;  3GB0 A;  1YME A;  1WVM A;  3PB4 X;  2Q4Z A;  3QNV A;  1UWY A;  3IJ3 A;  1NSA A;  1PCA A;  2CTB A;  2V8G A;  4FBE A;  2V8D A;  4MHP A;  4OC1 A;  2PJB A;  4ZX9 A;  4PQA A;  2ZEF A;  3KL9 A;  2AFZ A;  2VL1 A;  4IK2 A;  2Q43 A;  1DTD A;  3PFO A;  4C86 A;  2PVW A;  2G9D A;  2PJ7 A;  2AFX A;  1Z8L A;  3GLJ A;  4WJB A;  4DJL A;  2JEW A;  1RTQ A;  1ZG8 A;  3PB7 X;  6CPA A;  4RUH A;  4P4B A;  1Y7E A;  1CG2 A;  1QQ9 A;  3SI0 A;  2HC9 A;  2C6C A;  4W9Y A;  2PJ2 A;  1JQG A;  4X8I A;  2ABZ A;  3RBU A;  3LMS A;  5JM6 A;  3LWU A;  4A39 A;  2V8H A;  4C8C A;  4OME A;  4UEE A;  1TKF A;  2ZEM A;  2PJ9 A;  2PJ3 A;  3D67 A;  3VH9 A;  1BPM A;  2PJ5 A;  3HLP A;  1R3N A;  3I1U A;  1LAP A;  3L2N A;  3GUX A;  1V6C A;  2IJZ A;  3S9L A;  1XMB A;  3MRU A;  3CDX A;  3D7D A;  4NGN A;  4C8U A;  3DLJ A;  4ZI6 A;  4C85 A;  3BHX A;  5LYI A;  1BPN A;  2PRQ A;  1ARM A;  4C9U A;  3VAT A;  4OC4 A;  1Q7L A;  2V77 A;  3PB8 X;  2GRE A;  2AFM A;  1AYE A;  1YW4 A;  5K8P A;  3IO1 A;  3SJX A;  4NFR A;  1OBR A;  3FJU A;  2GU2 A;  1TXR A;  2PJ1 A;  2IMO A;  2C6P A;  5IB9 A;  1Y9Z A;  1CPX A;  1ZG7 A;  2RB7 A;  3V38 A;  4ZY1 A;  4OC3 A;  3B2Y A;  2WYR A;  4Z65 A;  5K8N A;  4Q7A A;  4MCP A;  2PJA A;  1VGY A;  4P4I A;  1GYT A;  5CBM A;  2CIJ A;  4CDJ A;  4P4J A;  2I3C A;  3NH8 A;  2ANP A;  2EWB A;  3NH5 A;  5LRJ A;  3D66 A;  4B6Z A;  2ZEL A;  3BXM A;  4LQG A;  4KNG E;  4C8A A;  4C84 A;  4X2T A;  1F2O A;  1ARL A;  1TKJ A;  4OID A;  2GLF A;  1Z5R A;  4A38 A;  2NYQ A;  1YLO A;  3KHX A;  2PVV A;  3WT4 A;  4MHZ A;  4MCS A;  3TX8 A;  4ZY0 A;  4MCQ A;  2XEJ A;  5D8N A;  3SJE A;  3RZA A;  3NH4 A;  1LFW A;  2POK A;  3FEC A;  3BI1 A; 
#chains in the Genus database with same CATH topology
 4MFP A;  4P45 A;  5D29 A;  5LYF A;  3S6H A;  5HMN A;  3HUV A;  5JYB A;  4MHY A;  2PIZ A;  2ZOF A;  3WAB A;  5DS0 A;  2J9A A;  4ZYQ A;  4MI1 A;  1Z8X A;  4P4E A;  2OZG A;  1Q5X A;  3QAY A;  4MCR A;  1QST A;  2BUE A;  2FM4 A;  1ELL P;  4A4B A;  2B3V A;  2EBJ A;  4PXE A;  2X0S A;  1VIX A;  2J8R A;  4YFJ A;  2QVP A;  3T07 A;  2REF A;  5K99 A;  4R76 A;  4EYS A;  4JWP A;  3TOA A;  4EME A;  4INJ A;  2Z3P A;  3LD2 A;  3HPH E;  2Z3L A;  2B5G B;  3KAS A;  3LOD A;  4EWT A;  5C82 A;  4PXD A;  5H84 A;  1LOK A;  4B5P A;  4TJV A;  3TLG A;  4E0A A;  5AXI A;  2CNS A;  3D2P A;  3IIB A;  4PK3 A;  1C3O B;  5JQ4 A;  2FL4 A;  1QSO A;  1Z2L A;  4C2Z A;  4CPA A;  3KQX A;  2PR1 A;  1KC7 A;  4O23 A;  2C27 A;  3KRV A;  5K8O A;  1QSR A;  3N5F A;  1FT7 A;  1F2P A;  5BY0 A;  2AE6 A;  2CF4 A;  2ZEO A;  2B4B A;  4FD7 A;  4NCZ A;  4XPD C;  2PIY A;  3PB6 X;  2P6E A;  3A9L A;  1IIC A;  4ZGY B;  4PXB A;  4K3N A;  4P4F A;  2D4O A;  4JZ0 A;  1CBX A;  1U6M A;  4G1P A;  4GM5 A;  4UEZ A;  1Y0R A;  2V8V A;  3PT1 A;  4CS0 B;  1Z9U A;  3U88 C;  2F7V A;  5THW A;  3PLF B;  1BLL E;  2PJ0 A;  2X7B A;  1ZLH A;  3B8G A;  4MFJ A;  3F9K C;  2Z3M A;  3ISZ A;  2YNC C;  1Y7R A;  5HVH A;  4II9 A;  5F5X A;  2O53 A;  1ELM P;  3VRP A;  1YRE A;  1Z4E A;  2PJ8 A;  5J1Q A;  3GJZ A;  3SJG A;  2QYV A;  1YW6 A;  4BPW B;  4H6U A;  4KLW A;  1Y0Y A;  2Z3O A;  3CXQ A;  1IY7 A;  1Z8T A;  4P4D A;  2Z11 A;  4FUU A;  1XJO A;  2ZEN A;  4C68 A;  4MI4 A;  2B5G A;  2GLJ A;  5F46 A;  3QAH A;  4F6A A;  4KVX A;  2ZW7 A;  3ISX A;  2XEF A;  1VHE A;  4PPZ A;  4R6T A;  4MXU A;  3T8W A;  1TKH A;  3FX6 A;  2AFO A;  4Y49 B;  4C9V A;  1YGH A;  4XNH C;  2BOA A;  2Q7B A;  4C8P A;  2PJC A;  2PC1 A;  3H8F A;  4FWU A;  3TFY A;  2YNE A;  1CS0 B;  4C8F A;  3DR6 A;  3VRR A;  4EFD A;  3VRN A;  1EO0 A;  1JWQ A;  3OAK A;  5AGE A;  4E5S A;  3EO4 A;  4OC0 A;  3ZNI A;  4JYW A;  1EE3 P;  3ZJ0 A;  4WWV A;  4CRY B;  4QBJ A;  3JVN A;  2DEA A;  1PYT B;  2CY2 A;  1VHO A;  2ZED A;  4KS9 A;  3B35 A;  1CE8 B;  4JXR A;  4A2Z A;  3EXN A;  3RAM A;  3OP0 A;  1HEE A;  2P0W A;  2OZH A;  3IWW A;  3BJ7 A;  4BTF A;  3C26 A;  3WC6 A;  2O4H A;  3TTH A;  3T05 A;  5F47 A;  1L0C A;  1XRY A;  4CAX A;  1VBG A;  4MMO A;  2EK9 A;  3RNZ A;  3MN8 A;  3B3C A;  1KUY A;  3VRQ A;  2RC4 A;  3NFQ A;  1CP7 A;  3TC8 A;  1XE4 A;  1WWZ A;  3S9N A;  2J8N A;  4KSI A;  4YRH A;  5E96 A;  3B7I A;  3G8W A;  3TLC A;  1M4D A;  4IHM A;  3I6S A;  5G1Z A;  5HH1 A;  2XPO A;  3IU2 A;  4AG9 A;  3IEH A;  5HXD A;  1FY7 A;  3E0K A;  2O28 A;  4MY0 A;  4C7I A;  5I0C A;  1IB1 E;  5ISV A;  2AFS A;  2CTC A;  2ZOG A;  1K4J A;  3KI9 A;  1Q2D A;  4JLY A;  3VAR A;  4C2X A;  2D4P A;  4KOV A;  3B3V A;  4KOT A;  3T0T A;  3KGQ A;  4B5O A;  5KTC A;  4CAE A;  2ZEE A;  2I79 A;  1CPS A;  2OR4 A;  1KZF A;  2B4J C;  1RXT A;  2PRB A;  2QJ8 A;  5DWM A;  1IID A;  1A2Z A;  3SJF A;  1OZP A;  3TLY A;  1ON0 A;  3B3T A;  3KHZ A;  3P2H A;  4ZBG A;  2ATR A;  1LAM A;  3KZW A;  4DUK A;  2B4D B;  4F9U A;  1FNO A;  4UBR A;  5I4M A;  4ZX8 A;  4E2A A;  3FH4 A;  4YN3 A;  1B87 A;  1KUV A;  1R43 A;  4JD6 A;  4Q38 A;  3WC7 A;  1BXR B;  2CXA A;  2GFQ A;  1C30 B;  2AFW A;  3CT9 A;  3JRU A;  2R82 A;  4R3K A;  3D8P A;  3K9U A;  4KOS A;  5LRG A;  4A31 A;  5JH9 A;  4C8T A;  3HPG G;  1YX0 A;  3NA6 A;  3FBU A;  2G0B A;  1RO5 A;  3IGR A;  4HKF A;  3H8E A;  3KR4 A;  2EZC A;  3S6G A;  3EY5 A;  4UFX A;  4UWJ A;  4U9Z A;  2VZZ A;  1GGO A;  4IAV A;  4IIY A;  1XF1 A;  2XPN A;  2FIA A;  2R1I A;  3PB9 X;  2ZW6 A;  2VBQ A;  3WC5 A;  4X3R A;  4UIA A;  1MJA A;  3GKR A;  3HMJ G;  1M1D A;  3BI0 A;  3V8I A;  2HQY A;  2ZEG A;  2JBK A;  4NF1 A;  1ZL0 A;  4MY3 A;  4MRI A;  2DPS A;  3FEE A;  1F57 A;  3ZZI A;  5IB0 A;  5LYL A;  4TWE A;  2BCO A;  3SI2 A;  3IU1 A;  2ZEP A;  5K8M A;  1IOI A;  1XBU A;  2C1C A;  3H8G A;  3C8O A;  3JUW A;  4OC5 A;  3T5M A;  3FED A;  1YR0 A;  2B3U A;  4R7M A;  1MK4 A;  5JVL A;  2G3T A;  4F9V A;  3PP9 A;  2FXF A;  1QSM A;  3S9M A;  4RN7 A;  3ICU A;  5IV0 A;  4CAF A;  4I49 A;  4B10 A;  3SXO A;  4TJX A;  2Q7S A;  4AXV A;  2OB0 A;  1CX8 A;  4OAE A;  1Z9E A;  3D68 A;  2B4D A;  2PSW A;  4YU9 A;  1EZA A;  2Q44 A;  1LAN A;  3DSB A;  3KQZ A;  2NSM A;  2PCU A;  1A9X B;  2FE7 A;  3R1K A;  4OKO A;  1SQH A;  2AFU A;  3IWG A;  1BOB A;  3D7G A;  1TF8 A;  3D7F A;  2PE3 A;  1TF9 A;  4XPK A;  2BO9 A;  4HNX B;  4PK2 A;  4UFW A;  5IX3 A;  1S3Z A;  1WJT A;  4F0Y A;  4HNW B;  4NGR A;  1BAV A;  4MJX A;  2WPX A;  4P6Y A;  4MHN A;  5F9M A;  4DNC A;  5BWA B;  4NGT A;  3IC1 A;  4GXH A;  4Y49 C;  3D4U A;  1IGB A;  2EZA A;  1P0H A;  2EO8 A;  1YQE A;  2OZU A;  1R57 A;  2CNM A;  2PJ4 A;  4A94 A;  5HKY A;  3D3S A;  4OIW A;  4NGQ A;  5HVG A;  4QVT A;  1YVO A;  5FD8 A;  4M85 A;  3IFE A;  3R95 A;  2F8H A;  2MP0 A;  4C9A A;  5ELY A;  4HNY B;  4NGM A;  3KR5 A;  2JLM A;  3V7Z A;  1KEE B;  3I74 A;  2UV8 G;  4P10 A;  1IYK A;  4PV6 A;  2JEV A;  1NSL A;  3CPX A;  3CPA A;  4UIB A;  2ZW5 A;  3GYA A;  3F5B A;  3FMC A;  4H6Z A;  2IL4 A;  4NGS A;  3PBE A;  3FVL A;  4F0X A;  3GY9 A;  3PEI A;  4PSW A;  4CDK A;  2WZN A;  4EVY A;  2PJ6 A;  4GS4 A;  4F8Z A;  5LYD A;  5A27 A;  4KOY A;  4ZY2 A;  1HDQ A;  2FS5 A;  5CPA A;  4UF4 A;  4CGO A;  3EZA A;  2B0A A;  3SI1 A;  3VTA A;  2JBJ A;  1M44 A;  4NJR A;  2ODF A;  4KSA A;  4M6H A;  3NE8 A;  2PQ8 A;  4KLV A;  3BUM B;  3TE4 A;  4CGM A;  2EVN A;  4DYO A;  3VGO A;  2Z10 A;  4B12 A;  1WK4 A;  3EZE A;  4C9R A;  4TNU A;  3K9T A;  4NXY A;  2XEI A;  3CZX A;  4YWY A;  5HVF A;  3TOB A;  1IU8 A;  3NFZ A;  4UEF A;  4JXQ A;  2OU2 A;  4M6I A;  2HWG A;  4UFV A;  2GP4 A;  4AVB A;  2XEG A;  2BL1 A;  2ZPA A;  1ZG9 A;  4C9E A;  4R57 A;  3NOJ A;  3TO6 A;  4NGP A;  4CAV A;  3VWE A;  4BPU B;  2FVG A;  3K2K A;  3TO9 A;  3D7H A;  1KWM A;  4PSX A;  5H86 A;  8CPA A;  4NJQ A;  2DIK A;  4QUS A;  4M8D A;  3DNS A;  5KTD A;  4QC6 A;  5F09 A;  3R9F A;  3S6F A;  3W91 A;  4COB A;  1YSJ A;  1XFO A;  2C6G A;  1QMU A;  4IIX A;  4RS2 A;  4H2K A;  5JGF A;  3B3W A;  1MJB A;  1H8L A;  4JVO A;  1FBV A;  2VZY A;  1Y9K A;  3FF3 A;  2FSR A;  2Q51 A;  7CPA A;  4C99 A;  4ONW A;  2WUU A;  3S6K A;  3B3S A;  1EZB A;  4CGL A;  4LUA A;  1YVK A;  2RFH A;  4CGN A;  3F0A A;  1S5K A;  3EFA A;  1AMP A;  2QEC A;  3EZB A;  3PRT A;  4FD4 A;  2EK8 A;  3PFE A;  1CP6 A;  3K4I A;  4K30 A;  1ZO0 A;  4P44 A;  1LCP A;  4OC2 A;  1R61 A;  1Q2Y A;  4AG7 A;  4R8F A;  4GPL B;  5J8C A;  1JDE A;  4B11 A;  4A95 A;  3SXN A;  3H5Z A;  3SR3 A;  4FAI A;  1S7F A;  1HDU A;  2DPT A;  3DGV A;  4CYO A;  1DE4 C;  2FCK A;  4MFK A;  1BO4 A;  2I00 A;  2OOT A;  4CAW A;  4H1H A;  1S7N A;  2YND A;  1M4L A;  2A4N A;  2REE A;  4UCN A;  4LQ6 A;  5LRK A;  2VEZ A;  2HB6 A;  4IF5 A;  3EIF A;  2Y0M A;  3UY5 A;  4PXC A;  4C2Y A;  2IQ6 A;  2NMT A;  2YGW A;  4NSQ A;  4BD9 A;  2J8M A;  3TLA A;  5AG7 A;  1YLE A;  4KVO E;  1QSN A;  1S60 A;  2JDC A;  1ZRS A;  1Z4R A;  2GAN A;  3PBB A;  5AG6 A;  2AJ6 A;  4HPS A;  4OP4 A;  4CGP A;  4ORF A;  4A37 A;  1T36 B;  2N3A B;  2ZEH A;  1ZLI A;  4CYP A;  4KZT A;  2HV2 A;  3G3S A;  2BSW A;  2P6F A;  1YME A;  3GB0 A;  4KOR A;  5C88 A;  1WVM A;  3PB4 X;  2Q04 A;  2VKZ G;  3TLG B;  3TT2 A;  2WSA A;  4A33 A;  5EBV A;  2Q4Z A;  3QNV A;  5F48 A;  3NE7 A;  1UWY A;  2KCW A;  2WPW A;  5HKW A;  1PU9 A;  2DXQ A;  4MFQ A;  3CXS A;  3IJ3 A;  1NSA A;  1PCA A;  2CTB A;  2V8G A;  4U5Y A;  3G23 A;  3MGD A;  2V8D A;  3BUN B;  4M3S A;  1XEB A;  2Z3K A;  4MHP A;  4FBE A;  2HI6 A;  4OC1 A;  1NBW A;  2PJB A;  4ZX9 A;  4PQA A;  3EC4 A;  5A28 A;  2ZEF A;  4KOU A;  3KL9 A;  2AFZ A;  2VL1 A;  4IK2 A;  2ARH A;  5EC4 A;  2Q43 A;  2ZXV A;  1DTD A;  5F13 A;  4BMH A;  5J8F A;  4E94 A;  3PFO A;  4AVA A;  2PVW A;  5IR2 A;  2G9D A;  4C86 A;  2FT0 A;  2PJ7 A;  3BJ8 A;  4KOW A;  2AFX A;  3R9E A;  1Z8L A;  3GLJ A;  2HRO A;  1I12 A;  3I3G A;  4RI1 A;  4WJB A;  4DJL A;  2JEW A;  1RTQ A;  4MJ8 A;  3SHP A;  4BPX B;  1MJ9 A;  4OLL A;  1ZG8 A;  3OWC A;  3PB7 X;  2F5I A;  2CBL A;  1PUA A;  3IWE A;  3GIU A;  4B14 A;  6CPA A;  2Z0Z A;  4RUH A;  4P4B A;  3W6S A;  1Y7E A;  4AVC A;  5G21 A;  1I21 A;  1Z8W A;  4KOX A;  1CG2 A;  1QQ9 A;  4C7H A;  3DDD A;  4Q36 A;  3SI0 A;  1VKC A;  1AUG A;  2HC9 A;  2PR8 A;  5G22 A;  4A32 A;  2C6C A;  1VBH A;  4W9Y A;  2C5Q A;  2B58 A;  3R96 A;  1JQG A;  2PJ2 A;  4X8I A;  2ABZ A;  3BLN A;  5DWN A;  3FRM A;  4KUA A;  1NMT A;  2XPP A;  3RBU A;  3LMS A;  3TLZ A;  4JJX A;  5JM6 A;  2E28 A;  3OB2 B;  1S7L A;  3LWU A;  4A39 A;  1XF8 A;  2V8H A;  4MBU A;  2AUM A;  4OME A;  1IYL A;  1XIX A;  1TKF A;  4UEE A;  2P6G A;  2ZEM A;  4C8C A;  2PJ9 A;  2QIR A;  4IUS A;  2DF5 A;  2PJ3 A;  3D67 A;  4OAD A;  1B47 A;  2YJV A;  3VH9 A;  4COG A;  4BBH A;  1BPM A;  1TIQ A;  3P2F A;  4X5K A;  5F1Y A;  2EUI A;  1S7K A;  2QML A;  1M6V B;  2PJ5 A;  1XMT A;  1XOV A;  3HLP A;  3JTK A;  1R3N A;  3I1U A;  1LAP A;  4NEX A;  5F49 A;  3TCV A;  2K5T A;  1J4J A;  5HKZ A;  2PDO A;  3L2N A;  2PCN A;  3BUW B;  3GUX A;  1V6C A;  1X10 A;  2IJZ A;  3PGP A;  3S9L A;  2OLS A;  1XMB A;  3MRU A;  1DIK A;  2Z3N A;  2DLA A;  2VXK A;  3CDX A;  2GE3 A;  3D7D A;  1I1D A;  4UCP A;  4NGN A;  4RR2 B;  1VI4 A;  2D0O A;  4C8U A;  1Q2C A;  4AB7 A;  2OH1 A;  3DLJ A;  2Q0Y A;  2R7H A;  4ZI6 A;  1J3L A;  1ZYM A;  4C85 A;  3W6X A;  3O8Z A;  3BHX A;  3TYX A;  4J0N A;  3FNC A;  5LYI A;  4XPD B;  3FIX A;  4QB9 A;  1BPN A;  2PRQ A;  4R3L A;  1ARM A;  4FD5 A;  2D0P A;  1M4I A;  1Q7L A;  4OC4 A;  1IOF A;  2V77 A;  3PB8 X;  1M4G A;  4UWI A;  3VAT A;  2GRE A;  3F8K A;  2AFM A;  4BIN A;  1JDB C;  4FD6 A;  1AYE A;  1YW4 A;  5K8P A;  4U9Y A;  3I9S A;  3IO1 A;  4R87 A;  4CYN A;  2BEI A;  3BUX B;  3SJX A;  4H89 A;  4NFR A;  1OBR A;  3FJU A;  4MFL A;  4YGO A;  2GU2 A;  4R9M A;  1TXR A;  3T90 A;  2PJ1 A;  5J3X A;  2C6P A;  1YK3 A;  2IMO A;  5IB9 A;  4C9U A;  1LRZ A;  2ZW4 A;  1CPX A;  1Y9Z A;  3U1B A;  5G20 A;  1ZG7 A;  1V0C A;  2AUN A;  3BUO B;  5KTA A;  3TO7 A;  3FB3 A;  2RB7 A;  4XPL A;  3V38 A;  5FVJ A;  4ZY1 A;  1NXJ A;  2YJT A;  1CM0 A;  2CNT A;  1GHE A;  5AG5 A;  3PZJ A;  4OC3 A;  4M6G A;  1UFH A;  1B6B A;  2VQY A;  2WYR A;  3B2Y A;  4UA3 A;  4UCM A;  3WR7 A;  5GCN A;  3VWD A;  4Z65 A;  5JPH A;  4J3G A;  3CXP A;  4CRZ B;  4L89 A;  5K8N A;  3DR8 A;  4KVM E;  4Q7A A;  3TLB A;  1CJW A;  1KBL A;  4MCP A;  4XNH B;  4KUB A;  3RYO A;  3R9G A;  2PJA A;  4L8A A;  4KSF A;  1VGY A;  4P4I A;  3T9Y A;  1KUX A;  1GYT A;  1Y9W A;  3VRO A;  2Y1M A;  1X12 A;  2JDD A;  2CIJ A;  3N7Z A;  4A30 A;  5CBM A;  1YVH A;  3TLE A;  4CDJ A;  2XPL A;  3QB8 A;  4P4J A;  2I3C A;  3NH8 A;  2Q4V A;  5CNP A;  2ANP A;  2EWB A;  3NH5 A;  5LRJ A;  3D66 A;  4B6Z A;  4CZ1 A;  2Y1N A;  2ZEL A;  3FXT A;  3BXM A;  3OB1 B;  3PFV A;  4LQG A;  4LX9 A;  3D2M A;  4KNG E;  4C8A A;  4C84 A;  4X2T A;  1F2O A;  1ARL A;  1TKJ A;  4OID A;  4CYQ A;  2GLF A;  1Z5R A;  3LAC A;  4B5P B;  4A38 A;  2NYQ A;  4CO9 A;  1YLO A;  2R98 A;  4A4C A;  2Q4Y A;  2YNC A;  4MHD A;  2GIV A;  2VI7 A;  2PVV A;  1P4N A;  3KHX A;  3WT4 A;  4MHZ A;  5AG4 A;  4MCS A;  4ONU A;  3TX8 A;  4B13 A;  4ZY0 A;  3FYN A;  2H5M A;  1N71 A;  5EMI A;  4MCQ A;  1NE9 A;  3RO0 A;  1VHS A;  2XEJ A;  3H4Q A;  5D8N A;  2R8V A;  3SJE A;  3KKW A;  4MFZ A;  3RZA A;  2HUZ A;  2FIW A;  4E8O A;  3NH4 A;  2G3A A;  1LFW A;  2EZB A;  2POK A;  3FEC A;  3BI1 A; 
#chains in the Genus database with same CATH homology
 4P45 A;  5D29 A;  5LYF A;  3HUV A;  4MHY A;  2PIZ A;  2ZOF A;  3WAB A;  5DS0 A;  2J9A A;  4ZYQ A;  4P4E A;  4MCR A;  1ELL P;  4PXE A;  1VIX A;  2QVP A;  4R76 A;  4EME A;  3KAS A;  4EWT A;  4PXD A;  1LOK A;  4TJV A;  3IIB A;  1Z2L A;  4CPA A;  3KQX A;  4O23 A;  5K8O A;  3N5F A;  1FT7 A;  1F2P A;  2CF4 A;  2ZEO A;  2PIY A;  3PB6 X;  4PXB A;  4K3N A;  4P4F A;  4JZ0 A;  1CBX A;  4G1P A;  4GM5 A;  4UEZ A;  1Y0R A;  2V8V A;  2F7V A;  5THW A;  1BLL E;  2PJ0 A;  1ZLH A;  3ISZ A;  5HVH A;  2O53 A;  1ELM P;  5J1Q A;  2PJ8 A;  3SJG A;  2QYV A;  1YW6 A;  1Y0Y A;  1IY7 A;  4FUU A;  4P4D A;  1XJO A;  2ZEN A;  2GLJ A;  3ISX A;  2XEF A;  1VHE A;  4PPZ A;  4R6T A;  4MXU A;  3T8W A;  1TKH A;  3FX6 A;  2AFO A;  4C9V A;  4C8P A;  2BOA A;  2PJC A;  3H8F A;  4FWU A;  4C8F A;  4EFD A;  4OC0 A;  1EE3 P;  4JYW A;  4WWV A;  2DEA A;  1PYT B;  1VHO A;  2ZED A;  3B35 A;  3RAM A;  1HEE A;  3IWW A;  3WC6 A;  2O4H A;  1XRY A;  4MMO A;  2EK9 A;  3MN8 A;  3B3C A;  1CP7 A;  3TC8 A;  3S9N A;  4KSI A;  3B7I A;  4IHM A;  3I6S A;  3IEH A;  5HXD A;  2AFS A;  2CTC A;  2ZOG A;  3KI9 A;  3VAR A;  3B3V A;  3KGQ A;  2ZEE A;  1CPS A;  2OR4 A;  2QJ8 A;  3SJF A;  3B3T A;  3KHZ A;  1LAM A;  3KZW A;  4DUK A;  4F9U A;  1FNO A;  5I4M A;  4ZX8 A;  3FH4 A;  4YN3 A;  1R43 A;  3WC7 A;  2AFW A;  3CT9 A;  3JRU A;  5LRG A;  5JH9 A;  4C8T A;  3NA6 A;  3H8E A;  3KR4 A;  4IAV A;  3PB9 X;  3WC5 A;  4X3R A;  4UIA A;  3BI0 A;  2ZEG A;  2JBK A;  4MRI A;  3FEE A;  1F57 A;  5LYL A;  4TWE A;  2BCO A;  3SI2 A;  5K8M A;  2ZEP A;  1XBU A;  2C1C A;  3H8G A;  4OC5 A;  3FED A;  4R7M A;  4F9V A;  3S9M A;  3ICU A;  4TJX A;  4AXV A;  1CX8 A;  3D68 A;  4YU9 A;  1LAN A;  3KQZ A;  2NSM A;  2PCU A;  4OKO A;  2AFU A;  1TF8 A;  3D7G A;  3D7F A;  2PE3 A;  1TF9 A;  2BO9 A;  4NGR A;  1BAV A;  4P6Y A;  4MHN A;  4NGT A;  3IC1 A;  3D4U A;  1IGB A;  2PJ4 A;  5HVG A;  4A94 A;  4OIW A;  4NGQ A;  3IFE A;  2F8H A;  4C9A A;  5ELY A;  4NGM A;  3KR5 A;  3V7Z A;  3I74 A;  4P10 A;  3CPX A;  3CPA A;  4UIB A;  3FMC A;  4NGS A;  3PBE A;  3FVL A;  3PEI A;  4CDK A;  2WZN A;  2PJ6 A;  4F8Z A;  5LYD A;  4ZY2 A;  1HDQ A;  5CPA A;  4UF4 A;  3SI1 A;  3VTA A;  2JBJ A;  4NJR A;  4DYO A;  4C9R A;  4TNU A;  3K9T A;  2XEI A;  4YWY A;  5HVF A;  3NFZ A;  4UEF A;  2GP4 A;  2XEG A;  1ZG9 A;  4C9E A;  4NGP A;  2FVG A;  3K2K A;  3D7H A;  1KWM A;  8CPA A;  4NJQ A;  5F09 A;  1YSJ A;  1XFO A;  2C6G A;  1QMU A;  5JGF A;  4H2K A;  3B3W A;  1H8L A;  3FF3 A;  2Q51 A;  7CPA A;  4C99 A;  4ONW A;  3B3S A;  2RFH A;  1AMP A;  3PRT A;  2EK8 A;  3PFE A;  1CP6 A;  4P44 A;  1LCP A;  4OC2 A;  4R8F A;  4FAI A;  1HDU A;  3DGV A;  1DE4 C;  2OOT A;  1M4L A;  5LRK A;  2HB6 A;  3EIF A;  4PXC A;  2IQ6 A;  4BD9 A;  3PBB A;  4OP4 A;  4A37 A;  2ZEH A;  1ZLI A;  1XF1 A;  3GB0 A;  1YME A;  1WVM A;  3PB4 X;  2Q4Z A;  3QNV A;  1UWY A;  3IJ3 A;  1NSA A;  1PCA A;  2CTB A;  2V8G A;  4FBE A;  2V8D A;  4MHP A;  4OC1 A;  2PJB A;  4ZX9 A;  4PQA A;  2ZEF A;  3KL9 A;  2AFZ A;  2VL1 A;  4IK2 A;  2Q43 A;  1DTD A;  3PFO A;  4C86 A;  2PVW A;  5IR2 A;  2G9D A;  2PJ7 A;  2AFX A;  1Z8L A;  3GLJ A;  4WJB A;  4DJL A;  2JEW A;  1RTQ A;  1ZG8 A;  3PB7 X;  6CPA A;  4RUH A;  4P4B A;  1Y7E A;  1CG2 A;  1QQ9 A;  3SI0 A;  2HC9 A;  2C6C A;  4W9Y A;  2C5Q A;  2PJ2 A;  1JQG A;  4X8I A;  2ABZ A;  3RBU A;  3LMS A;  5JM6 A;  3LWU A;  4A39 A;  2V8H A;  4C8C A;  4OME A;  4UEE A;  1TKF A;  2ZEM A;  2PJ9 A;  2PJ3 A;  3D67 A;  3VH9 A;  1BPM A;  2PJ5 A;  3HLP A;  1R3N A;  3I1U A;  1LAP A;  3L2N A;  3GUX A;  1V6C A;  2IJZ A;  3S9L A;  1XMB A;  3MRU A;  3CDX A;  3D7D A;  4NGN A;  4C8U A;  3DLJ A;  4ZI6 A;  4C85 A;  3BHX A;  5LYI A;  1BPN A;  2PRQ A;  1ARM A;  4C9U A;  3VAT A;  4OC4 A;  1Q7L A;  2V77 A;  3PB8 X;  2GRE A;  2AFM A;  1AYE A;  1YW4 A;  5K8P A;  3IO1 A;  3SJX A;  4NFR A;  1OBR A;  3FJU A;  2GU2 A;  1TXR A;  2PJ1 A;  2IMO A;  2C6P A;  5IB9 A;  1Y9Z A;  1CPX A;  1ZG7 A;  2RB7 A;  3V38 A;  4ZY1 A;  4OC3 A;  3B2Y A;  2WYR A;  4Z65 A;  5K8N A;  4Q7A A;  4MCP A;  2PJA A;  1VGY A;  4P4I A;  1GYT A;  5CBM A;  2CIJ A;  4CDJ A;  4P4J A;  2I3C A;  3NH8 A;  2ANP A;  2EWB A;  3NH5 A;  5LRJ A;  3D66 A;  4B6Z A;  2ZEL A;  3BXM A;  4LQG A;  4KNG E;  4C8A A;  4C84 A;  4X2T A;  1F2O A;  1ARL A;  1TKJ A;  4OID A;  2GLF A;  1Z5R A;  4A38 A;  2NYQ A;  1YLO A;  3KHX A;  2PVV A;  3WT4 A;  4MHZ A;  4MCS A;  3TX8 A;  4ZY0 A;  4MCQ A;  2XEJ A;  5D8N A;  3SJE A;  3RZA A;  3NH4 A;  1LFW A;  2POK A;  3FEC A;  3BI1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...