4P4IA

X-ray structure of human glutamate carboxypeptidase ii (gcpii) in complex with a phosphoramidate inhibitor t33
Total Genus 261
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
261
sequence length
696
structure length
692
Chain Sequence
KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Design of composite inhibitors targeting glutamate carboxypeptidase II: the importance of effector functionalities.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Glutamate carboxypeptidase 2
total genus 261
structure length 692
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2014-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 4p4iA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4p4iA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4p4iA02
5ELYA 4MHYA 2ZEGA 2RB7A 4MRIA 3TC8A 2WYRA 3D7GA 2HB6A 3S9LA 2POKA 3VTAA 3D68A 1Y0RA 4NGSA 1EE3P 2ZENA 5JM6A 3FECA 3B2YA 2O4HA 4MHNA 2NSMA 3EIFA 2ZELA 1QMUA 4MCQA 3IWWA 4JYWA 4NGTA 2AFUA 3KR4A 1LCPA 2GLFA 1YSJA 3L2NA 5K8MA 4R6TA 3B3VA 3D7HA 1TKFA 4OP4A 2C6PA 2PCUA 4P44A 1JQGA 1TXRA 1PYTB 5HVFA 1H8LA 4OIWA 1TKJA 1F2PA 3JRUA 2BO9A 1TF9A 2Q4ZA 2V77A 4NGPA 1LFWA 3NH8A 4G1PA 2O53A 4IHMA 2ZEMA 1ARMA 2RFHA 2PJ0A 3H8EA 5CPAA 3GUXA 3T8WA 3I74A 3PRTA 3KASA 5F09A 4DJLA 1AYEA 1R43A 1FT7A 5DS0A 4YU9A 2V8GA 2VL1A 4NGRA 2CIJA 1XRYA 3GLJA 3D7DA 2PE3A 3GB0A 2ANPA 1CBXA 3WC5A 2V8DA 5LRGA 3FMCA 4MCPA 3I1UA 2PRQA 3DGVA 3PB6X 2JEWA 3WC7A 4IAVA 2AFSA 5LYLA 4OC3A 4OC4A 1ARLA 4YN3A 3ICUA 4NGNA 3V38A 4C85A 4X8IA 5LRKA 3HUVA 4A94A 3KR5A 2PJBA 3NFZA 4PXBA 2PJAA 4EWTA 1TKHA 4WJBA 1Z2LA 2PJ8A 1AMPA 5JGFA 3KI9A 3NA6A 3IIBA 1F57A 2IMOA 2NYQA 4ZY1A 1NSAA 2ZEEA 4X3RA 1YLOA 3S9MA 2IJZA 4PPZA 3KZWA 1BPNA 1QQ9A 4IK2A 1CPXA 3CPXA 4OC1A 2GREA 4P4FA 3IFEA 4OC2A 2XEGA 3KQZA 3D7FA 4P10A 5I4MA 4NGQA 5K8NA 3CDXA 4C9AA 2PJ7A 2QJ8A 4BD9A 3SJXA 1CPSA 2ZEDA 2ABZA 2Q51A 3FJUA 5D8NA 1ZG9A 2PIYA 4C9VA 3D66A 4MHZA 1LAPA 3LMSA 4TJXA 4UEEA 3K9TA 1CP6A 1VHEA 1UWYA 4DYOA 3VH9A 1BLLE 3SJGA 4NJQA 2PJ5A 4CDKA 1Y9ZA 3H8FA 2WZNA 2XEFA 2PVWA 4C8CA 2F7VA 1V6CA 4Z65A 3NH4A 4GM5A 1Y0YA 5CBMA 3SJEA 4C86A 1VIXA 4X2TA 3PBBA 2CF4A 5HVHA 1XFOA 5LRJA 4MMOA 4F8ZA 3BI0A 2C6CA 4O23A 4F9VA 4EMEA 4F9UA 5K8OA 1DE4C 2AFMA 3H8GA 5D29A 3B7IA 3CPAA 4WWVA 2OR4A 4KSIA 4OMEA 2F8HA 3KHZA 2JBJA 4JZ0A 2FVGA 3SI0A 4P4EA 2Q43A 3SJFA 3RAMA 1LANA 2EK8A 1CG2A 4UIAA 7CPAA 4C8PA 4MXUA 4CDJA 4B6ZA 3KGQA 4ZY0A 4ZX9A 2C6GA 2QYVA 1HDUA 1Z8LA 2PJ9A 1BAVA 2ZOFA 4MHPA 3WT4A 2G9DA 3WABA 4A38A 1RTQA 3KHXA 4LQGA 1XF1A 2BCOA 1R3NA 1ELMP 2C1CA 4R8FA 2GLJA 2J9AA 2EWBA 1M4LA 5HXDA 5LYFA 4C9RA 4UEZA 4YWYA 3FF3A 3PFOA 3DLJA 1ZG8A 2JBKA 2PJ2A 4MCSA 3PB9X 4MCRA 1CX8A 2PVVA 2PJ6A 3PB4X 1FNOA 1YMEA 1IGBA 8CPAA 4OIDA 4C9EA 4P4BA 2V8HA 3SI1A 2AFWA 3MN8A 1ZG7A 4A39A 4KNGE 3HLPA 1LOKA 3PEIA 3B3SA 3WC6A 4UEFA 3PB8X 3QNVA 1KWMA 4TWEA 1PCAA 1BPMA 4H2KA 2ZEPA 4DUKA 3VATA 2OOTA 6CPAA 3BXMA 2PJCA 1ELLP 1CP7A 2BOAA 3N5FA 3TX8A 4AXVA 4FBEA 4P45A 2DEAA 3D4UA 4OC5A 4C8UA 2PJ1A 2AFXA 4RUHA 3D67A 1DTDA 3I6SA 3FVLA 2XEJA 4PXEA 1OBRA 2ZOGA 4UF4A 3PB7X 2XEIA 4W9YA 2ZEOA 3B3CA 4ONWA 2IQ6A 4ZX8A 1XMBA 4A37A 3B3TA 4P4IA 3SI2A 2CTBA 5IB9A 2CTCA 1VHOA 4FWUA 3IO1A 2AFZA 5J1QA 4PXCA 4C9UA 3S9NA 2AFOA 3ISXA 4NJRA 1XBUA 2ZEHA 2HC9A 3ISZA 4C99A 4FAIA 3IJ3A 1HDQA 1WVMA 4ZI6A 3FX6A 2V8VA 4NFRA 2PJ3A 1XJOA 3K2KA 4OC0A 3FEDA 1VGYA 2PIZA 1YW4A 1ZLHA 1TF8A 3PFEA 4R76A 1IY7A 4C84A 3IEHA 5JH9A 4UIBA 4NGMA 5K8PA 1YW6A 3MRUA 1F2OA 1Q7LA 2PJ4A 3NH5A 5HVGA 3PBEA 3BHXA 4P6YA 3V7ZA 4C8AA 2GU2A 4Q7AA 4P4DA 3KQXA 4C8FA 1HEEA 3FH4A 1GYTA 5LYDA 2EK9A 2QVPA 3B3WA 4TJVA 3B35A 4P4JA 3KL9A 4K3NA 3BI1A 5THWA 3VARA 3FEEA 4FUUA 3LWUA 3RZAA 4OKOA 3IC1A 4PXDA 3RBUA 4CPAA 4PQAA 4TNUA 4EFDA 4R7MA 3CT9A 1LAMA 4ZY2A 1Z5RA 1ZLIA 5LYIA 4C8TA 1Y7EA 2I3CA 2ZEFA 4ZYQA
chains in the Genus database with same CATH superfamily
2B3VA 5ELYA 4MHYA 2ZEGA 4KOSA 2RB7A 2YNDA 3NE8A 4A4BA 4MRIA 5G21A 3TC8A 2WPXA 2WYRA 3D7GA 3N7ZA 2HB6A 4R57A 3S9LA 3TLAA 2JEVA 5EC4A 2POKA 3VTAA 4M6IA 4M3SA 4ZGYB 2GIVA 4LUAA 4UA3A 2CNTA 3D68A 1Y0RA 4FD7A 2B4BA 3F5BA 4NGSA 1EE3P 2ZENA 3TLCA 2E28A 1AUGA 2Z3OA 3FECA 3B2YA 5JM6A 3U88C 2O4HA 1XE4A 1GGOA 4MHNA 4C7HA 2NSMA 2HROA 3SXNA 4MJXA 2REFA 5AG6A 3EIFA 3PGPA 3NOJA 3NFQA 5AGEA 5HKWA 1Z8TA 2HUZA 2ZELA 1PU9A 1QMUA 4HPSA 4NXYA 4BMHA 3FXTA 4MCQA 3IWWA 1IYKA 4JYWA 1WJTA 4NGTA 4MFQA 2XPOA 2AFUA 4CAFA 2Z10A 2ZXVA 3KR4A 3VRRA 4CYNA 5J8FA 1LCPA 2GLFA 1YSJA 3L2NA 5K8MA 4R6TA 2DPSA 3B3VA 4U9YA 3D7HA 1YR0A 1TKFA 2GE3A 4OP4A 1I1DA 2C6PA 2PCUA 4P44A 3TOBA 1JQGA 3VWEA 1TXRA 1PYTB 5DWNA 5HVFA 5C88A 1YVOA 3R95A 5JPHA 3OP0A 5K99A 3CZXA 2B58A 3IU1A 4CGLA 1H8LA 4OIWA 2ARHA 1TKJA 1F2PA 3JRUA 2BO9A 1B87A 1TF9A 2OZHA 2Q4ZA 2Q4VA 4PK3A 2V77A 4NGPA 1LFWA 3NH8A 2O53A 4FD6A 1XF8A 4G1PA 4IHMA 1Q5XA 2ZEMA 1S3ZA 1ARMA 4Q38A 2RFHA 2PJ0A 3VRPA 4A4CA 3OWCA 3H8EA 4MHDA 5CPAA 4KVOE 3GUXA 3T8WA 3EXNA 4K30A 3EZEA 3SR3A 4XPDC 1B47A 1IICA 5A27A 3D2MA 4KOVA 3I74A 2Z3LA 5AG5A 1P4NA 4Y49C 1XIXA 2HV2A 3PRTA 3KASA 1WWZA 3T9YA 3ZJ0A 2VZYA 4MI1A 4EYSA 1XOVA 1KUXA 3DR8A 4MBUA 5F09A 2B5GB 2J8RA 4DJLA 5E96A 1AYEA 1N71A 1R43A 2GFQA 1FT7A 5DS0A 4YU9A 2V8GA 2VL1A 4NGRA 3HPGG 1BXRB 2CIJA 1XRYA 3ZZIA 3GLJA 5FD8A 3D7DA 1MJ9A 3FYNA 2G3TA 4R9MA 2REEA 1KBLA 3TTHA 3OB2B 2FM4A 2PE3A 2HQYA 2G0BA 3GB0A 2ANPA 4CGOA 1CBXA 2PCNA 1RXTA 2D4OA 4KUBA 3R9GA 3WC5A 1M6VB 2V8DA 2CNSA 3TE4A 2ATRA 1CM0A 4L8AA 3VGOA 1Z9UA 2GANA 5LRGA 2CY2A 5CNPA 1X10A 4C68A 1A2ZA 3FMCA 5AG4A 4MCPA 2C27A 5F48A 1J3LA 4J0NA 3FIXA 3I1UA 3TLGA 2PRQA 3DGVA 3PB6X 4GS4A 1YGHA 2JEWA 3WC7A 4CAEA 4IAVA 4RS2A 4C99A 5I0CA 2AFSA 5LYLA 4OC3A 4OC4A 1YVKA 1ARLA 2Z3PA 5HKYA 3F9KC 3BJ8A 3LACA 1YQEA 4FD4A 3ICUA 4NGNA 4YN3A 2FT0A 3V38A 4C85A 4MFPA 1QSRA 1Y9KA 3HMJG 1EO0A 3HUVA 4X8IA 1MK4A 1VKCA 2YGWA 2Z0ZA 1M44A 4A33A 4BINA 4BPUB 2CXAA 3GJZA 4A94A 2X7BA 3KR5A 4QC6A 2PJBA 3NFZA 4PXBA 2A4NA 2PJAA 4COGA 3SHPA 4EWTA 3EFAA 3K9UA 2N3AB 1TKHA 1Z2LA 4BPXB 2F5IA 1AMPA 2PJ8A 4WJBA 5JGFA 2DPTA 3KI9A 2BSWA 3NA6A 3IIBA 1F57A 3OB1B 2FS5A 2Q7BA 4QB9A 5IX3A 2VXKA 4B12A 1IOFA 3GKRA 3QB8A 2IMOA 2D4PA 2NYQA 4ZY1A 4KOYA 3BUNB 1NSAA 2ZEEA 4X3RA 1YLOA 5JQ4A 2G3AA 3S9MA 3LD2A 2IJZA 3PP9A 4HNXB 2DLAA 2OZGA 1B6BA 2PRBA 3PLFB 1X12A 2FE7A 3SXOA 1U6MA 2P6GA 4PPZA 3O8ZA 3RNZA 3S6HA 3BLNA 3KZWA 1QSTA 1BPNA 1QQ9A 4UFXA 5F47A 1S7FA 4IK2A 3V8IA 1CPXA 3CPXA 2YNCC 4LQ6A 4YGOA 5JVLA 1M4IA 2ODFA 4OC1A 5AXIA 2GREA 4P4FA 2PR1A 2OLSA 3IFEA 3KKWA 4OC2A 4JWPA 1M4GA 2XEGA 3TO9A 2J8NA 3KQZA 3FNCA 3D7FA 1JDBC 3H5ZA 4P10A 5BY0A 4CAXA 5FVJA 5I4MA 4NGQA 4PK2A 5F13A 3JVNA 5K8NA 2BUEA 2R7HA 3CDXA 4Y49B 4C9AA 1I21A 2PJ7A 2QJ8A 4BD9A 3FBUA 1KC7A 3TFYA 3SJXA 1CPSA 2ZEDA 5IB0A 2ABZA 2Q51A 3FJUA 3RYOA 2QECA 1Z4EA 1RO5A 2Q7SA 5D8NA 4AVBA 4CGNA 1SQHA 4C2XA 4IF5A 1ZG9A 3HPHE 4MY0A 2PIYA 4XPKA 1QSNA 4CYPA 3BUOB 4KORA 4BTFA 2UV8G 3D66A 4ZBGA 3TOAA 1C3OB 4C9VA 4MHZA 1Q2DA 3T05A 3ZNIA 1LAPA 1YREA 1JDEA 4KOTA 3S6KA 1K4JA 3LMSA 4TJXA 1Z8WA 4CS0B 4UEEA 3K9TA 5F49A 4F0YA 1MJAA 1EZAA 1VBHA 1CP6A 3W6SA 1IB1E 4U9ZA 3GYAA 1VHEA 1UWYA 1KUYA 3VH9A 1BLLE 4DYOA 3TLZA 3SJGA 4NJQA 2JDCA 1KUVA 2NMTA 2PJ5A 4CDKA 4MFKA 1ZL0A 1Y9ZA 4GPLB 4CRZB 2Z3NA 3H8FA 2WSAA 2WZNA 2Q04A 1IYLA 4NEXA 2XEFA 3T90A 2P6EA 4JLYA 3H4QA 4UFWA 4JJXA 3VRNA 2PVWA 4C8CA 2K5TA 2F7VA 3EC4A 4NF1A 1FBVA 4RR2B 1V6CA 3W6XA 4Z65A 1IOIA 3NH4A 2EUIA 4GM5A 1Y0YA 5CBMA 3CXSA 4KZTA 3SJEA 3DSBA 4C86A 1VIXA 2WUUA 3W91A 4L89A 4F6AA 4KS9A 4X2TA 5H86A 1M1DA 4UCMA 2DF5A 3C8OA 4H1HA 3PBBA 1NSLA 4M85A 2CF4A 5HVHA 1XFOA 5LRJA 4MMOA 5HMNA 1EZBA 2C5QA 1Q2CA 4F8ZA 3BI0A 1JWQA 1IU8A 2XPLA 4JD6A 3IGRA 3QAYA 2C6CA 1KZFA 2ZPAA 4O23A 3I3GA 4KLVA 4A95A 3D2PA 4EMEA 4F9VA 1VI4A 4F9UA 5K8OA 1Y9WA 1S7LA 4M8DA 4AVAA 1DE4C 2AFMA 3H8GA 4GXHA 5J8CA 2QIRA 2R98A 4COBA 2B0AA 5D29A 3B7IA 3CPAA 4CYQA 2ZW4A 4WWVA 2OR4A 4KSIA 4AVCA 4OMEA 2F8HA 3KHZA 3IWEA 2P0WA 2VQYA 5G22A 3DR6A 2JBJA 4JZ0A 1L0CA 2FVGA 2JLMA 3SI0A 2EZCA 4P4EA 4B10A 2XPPA 2Q43A 3SJFA 4CZ1A 4INJA 4R87A 3RAMA 2D0PA 1LANA 2EK8A 4A31A 5J3XA 4C9RA 1CG2A 2EO8A 4UIAA 2H5MA 5G20A 7CPAA 4JXQA 4MXUA 4C8PA 4CDJA 3TT2A 4B6ZA 4E2AA 3BUWB 4NCZA 1CS0B 3KGQA 4ZY0A 4ZX9A 3PT1A 3OAKA 2C6GA 2PDOA 2QYVA 2J8MA 1HDUA 4QUSA 1Z8LA 2PJ9A 3R1KA 2I00A 1BAVA 2O28A 3T5MA 2ZOFA 3EZBA 4MHPA 1PUAA 4U5YA 3WT4A 3T07A 2G9DA 2YJVA 4MI4A 2EBJA 3WABA 4A38A 1RTQA 1J4JA 5IR2A 3KHXA 4LQGA 5A28A 4RN7A 1XF1A 5F9MA 3TLBA 2BCOA 1R3NA 2DXQA 3G3SA 1ELMP 2I79A 4CGMA 2C1CA 2OH1A 4R8FA 4UCPA 2YNCA 2GLJA 2J9AA 2EWBA 1M4LA 2VZZA 2WPWA 4UWIA 4UEZA 4M6HA 3TO6A 3UY5A 4MJ8A 4H89A 5LYFA 3G23A 5HKZA 2B4JC 3LODA 4PV6A 4XPLA 1Z9EA 2KCWA 4YWYA 1R61A 3FF3A 1BO4A 3PFOA 5C82A 3DLJA 4AG9A 4IUSA 2AUMA 1ZG8A 2JBKA 2PJ2A 4JXRA 1LRZA 2B4DA 4MCSA 4F0XA 3PB9X 5F46A 1DIKA 3RO0A 4MCRA 1CX8A 2PVVA 2B4DB 2PJ6A 4B13A 4OADA 3P2HA 3PB4X 4FD5A 4KSAA 1FNOA 4KOWA 3E0KA 4KVME 1YMEA 2VKZG 1IGBA 8CPAA 1ZRSA 4OIDA 4YFJA 4C9EA 5H84A 1V0CA 2Q4YA 4P4BA 2R1IA 4ORFA 5F1YA 2V8HA 1QSOA 2Z11A 2AFWA 3SI1A 1ZO0A 4HKFA 1ON0A 3MN8A 1ZG7A 2JDDA 2FIWA 1GHEA 4A39A 1S7KA 4KNGE 3BUXB 3TLYA 3HLPA 1LOKA 3PEIA 4EVYA 3B3SA 3WC6A 2PQ8A 4UEFA 3PB8X 3R96A 5KTDA 3QNVA 1KWMA 4TWEA 4CGPA 4AG7A 1C30B 5HXDA 3S6FA 3T0TA 2MP0A 1PCAA 4R3LA 1BPMA 2VBQA 3F8KA 3GIUA 4R3KA 1S60A 2B3UA 4H2KA 4LX9A 4MFZA 2ZEPA 4MFLA 3WR7A 4DUKA 3VATA 4II9A 4KLWA 2EZBA 2OOTA 4CRYB 6CPAA 5KTAA 3BXMA 3IU2A 2PJCA 4HNYB 4KUAA 1ELLP 4E94A 4CO9A 4CAWA 1CP7A 2OU2A 4B5PB 2BOAA 3D3SA 3N5FA 4KSFA 3TX8A 4AXVA 4FBEA 4B5OA 4KVXA 4P45A 1CJWA 4HNWB 2DEAA 3D4UA 4C2ZA 2Y0MA 1XEBA 2P6FA 4OC5A 4C8UA 2PJ1A 2ZW5A 3TLEA 2AFXA 4RUHA 1Z4RA 1DTDA 3D67A 1NXJA 2PR8A 1P0HA 5AG7A 4B11A 3FVLA 3I6SA 2OB0A 1OZPA 1TIQA 1YLEA 2FXFA 4IIXA 2XEJA 3S6GA 2VEZA 3P2FA 4PXEA 5F5XA 1OBRA 4UBRA 3I9SA 4CAVA 1XMTA 4PSWA 2BEIA 2ZOGA 4UF4A 3PB7X 2XEIA 4W9YA 4AB7A 3EO4A 2ZEOA 5IV0A 3TLGB 3B3CA 1QSMA 4ONWA 4BPWB 2IQ6A 2D0OA 4A2ZA 4C2YA 4MFJA 3GY9A 3QAHA 4ZX8A 3F0AA 1XMBA 3JTKA 4PSXA 3FB3A 4XNHC 3B3TA 4P4IA 1BOBA 4A37A 3SI2A 1CE8B 2CTBA 2FIAA 1IIDA 4I49A 4E8OA 1S7NA 5ISVA 2YNEA 5LRKA 4JVOA 1S5KA 4XNHB 5IB9A 2CTCA 5EBVA 1NMTA 1VHOA 2FCKA 2R82A 4FWUA 3IO1A 3R9FA 2AFZA 5J1QA 2EVNA 3VRQA 4PXCA 4Q36A 4B5PA 4C9UA 3S9NA 4UFVA 2AFOA 3TYXA 1Q2YA 2AE6A 3ISXA 4NJRA 1ZYMA 2R8VA 2RC4A 1XBUA 3C26A 2ZEHA 2HC9A 4UWJA 3VROA 3ISZA 4A32A 3K4IA 1Z8XA 4FAIA 1M4DA 1HDQA 3IJ3A 4OAEA 1WVMA 4ZI6A 1T36B 3EZAA 2XPNA 2V8VA 3FX6A 1WK4A 4J3GA 4KOXA 4NFRA 2B5GA 2PJ3A 3B8GA 3CXQA 1XJOA 1YVHA 1Y7RA 2GP4A 3A9LA 3K2KA 4OC0A 3FEDA 3IWGA 2X0SA 1NBWA 1VGYA 2PIZA 1YW4A 1ZLHA 1TF8A 3PFEA 3D8PA 4R76A 1IY7A 2Q0YA 4H6ZA 4NSQA 3IEHA 1NE9A 4C84A 5JH9A 5GCNA 1FY7A 2ZW6A 4UCNA 2Y1MA 4NGMA 4UIBA 4E5SA 5JYBA 5K8PA 1KEEB 3G8WA 1YW6A 3MRUA 5HH1A 1F2OA 2HI6A 1Q7LA 2PJ4A 3DDDA 4B14A 4YRHA 2YJTA 2QMLA 3NH5A 3PFVA 5HVGA 3PBEA 2VI7A 3BHXA 2IL4A 4P6YA 5DWMA 2OZUA 3V7ZA 4C8AA 3EY5A 2GU2A 4CYOA 4Q7AA 1YX0A 4P4DA 2BL1A 3KQXA 4M6GA 4C8FA 2EZAA 1HEEA 3FH4A 4RI1A 1R57A 1GYTA 5LYDA 2FL4A 3TO7A 3U1BA 3NE7A 1VBGA 2PSWA 4QVTA 1VHSA 2EK9A 2QVPA 5G1ZA 4C7IA 4QBJA 4ONUA 3B3WA 4H6UA 3VWDA 4IIYA 4TJVA 4OLLA 2Z3MA 2AJ6A 2CBLA 2DIKA 3BJ7A 3R9EA 3PZJA 3B35A 2CNMA 4P4JA 3KL9A 4K3NA 3TCVA 3BI1A 5THWA 2Q44A 2Y1NA 3VARA 4BBHA 3FEEA 4FUUA 4MY3A 3LWUA 5KTCA 4XPDB 3RZAA 2AUNA 2Z3KA 3CXPA 2HWGA 4E0AA 4DNCA 3BUMB 1UFHA 4OKOA 3IC1A 2ZW7A 2FSRA 3MGDA 4PXDA 3RBUA 3DNSA 4CPAA 1A9XB 3JUWA 4PQAA 4KOUA 4TNUA 4EFDA 4R7MA 3CT9A 1LAMA 3FRMA 4ZY2A 3KRVA 1Z5RA 1ZLIA 4A30A 5LYIA 4C8TA 4X5KA 1Y7EA 1I12A 1YK3A 2I3CA 5BWAB 1MJBA 5EMIA 2PC1A 2ZEFA 4ZYQA
chains in the Genus database with same CATH topology
5ELYA 4MHYA 2ZEGA 2RB7A 4MRIA 3TC8A 2WYRA 3D7GA 2HB6A 3S9LA 2POKA 3VTAA 3D68A 1Y0RA 4NGSA 1EE3P 2ZENA 5JM6A 3FECA 3B2YA 2O4HA 4MHNA 2NSMA 3EIFA 2ZELA 1QMUA 4MCQA 3IWWA 4JYWA 4NGTA 2AFUA 3KR4A 1LCPA 2GLFA 1YSJA 3L2NA 5K8MA 4R6TA 3B3VA 3D7HA 1TKFA 4OP4A 2C6PA 2PCUA 4P44A 1JQGA 1TXRA 1PYTB 5HVFA 1H8LA 4OIWA 1TKJA 1F2PA 3JRUA 2BO9A 1TF9A 2Q4ZA 2V77A 4NGPA 1LFWA 3NH8A 4G1PA 2O53A 4IHMA 2ZEMA 1ARMA 2RFHA 2PJ0A 3H8EA 5CPAA 3GUXA 3T8WA 3I74A 3PRTA 3KASA 5F09A 4DJLA 1AYEA 1R43A 1FT7A 5DS0A 4YU9A 2V8GA 2VL1A 4NGRA 2CIJA 1XRYA 3GLJA 3D7DA 2PE3A 3GB0A 2ANPA 1CBXA 3WC5A 2V8DA 5LRGA 3FMCA 4MCPA 3I1UA 2PRQA 3DGVA 3PB6X 2JEWA 3WC7A 4IAVA 2AFSA 5LYLA 4OC3A 4OC4A 1ARLA 4YN3A 3ICUA 4NGNA 3V38A 4C85A 4X8IA 5LRKA 3HUVA 4A94A 3KR5A 2PJBA 3NFZA 4PXBA 2PJAA 4EWTA 1TKHA 4WJBA 1Z2LA 2PJ8A 1AMPA 5JGFA 3KI9A 3NA6A 3IIBA 1F57A 2IMOA 2NYQA 4ZY1A 1NSAA 2ZEEA 4X3RA 1YLOA 3S9MA 2IJZA 4PPZA 3KZWA 1BPNA 1QQ9A 4IK2A 1CPXA 3CPXA 4OC1A 2GREA 4P4FA 3IFEA 4OC2A 2XEGA 3KQZA 3D7FA 4P10A 5I4MA 4NGQA 5K8NA 3CDXA 4C9AA 2PJ7A 2QJ8A 4BD9A 3SJXA 1CPSA 2ZEDA 2ABZA 2Q51A 3FJUA 5D8NA 1ZG9A 2PIYA 4C9VA 3D66A 4MHZA 1LAPA 3LMSA 4TJXA 4UEEA 3K9TA 1CP6A 1VHEA 1UWYA 4DYOA 3VH9A 1BLLE 3SJGA 4NJQA 2PJ5A 4CDKA 1Y9ZA 3H8FA 2WZNA 2XEFA 2PVWA 4C8CA 2F7VA 1V6CA 4Z65A 3NH4A 4GM5A 1Y0YA 5CBMA 3SJEA 4C86A 1VIXA 4X2TA 3PBBA 2CF4A 5HVHA 1XFOA 5LRJA 4MMOA 4F8ZA 3BI0A 2C6CA 4O23A 4F9VA 4EMEA 4F9UA 5K8OA 1DE4C 2AFMA 3H8GA 5D29A 3B7IA 3CPAA 4WWVA 2OR4A 4KSIA 4OMEA 2F8HA 3KHZA 2JBJA 4JZ0A 2FVGA 3SI0A 4P4EA 2Q43A 3SJFA 3RAMA 1LANA 2EK8A 1CG2A 4UIAA 7CPAA 4C8PA 4MXUA 4CDJA 4B6ZA 3KGQA 4ZY0A 4ZX9A 2C6GA 2QYVA 1HDUA 1Z8LA 2PJ9A 1BAVA 2ZOFA 4MHPA 3WT4A 2G9DA 3WABA 4A38A 1RTQA 5IR2A 3KHXA 4LQGA 1XF1A 2BCOA 1R3NA 1ELMP 2C1CA 4R8FA 2GLJA 2J9AA 2EWBA 1M4LA 5HXDA 5LYFA 4C9RA 4UEZA 4YWYA 3FF3A 3PFOA 3DLJA 1ZG8A 2JBKA 2PJ2A 4MCSA 3PB9X 4MCRA 1CX8A 2PVVA 2PJ6A 3PB4X 1FNOA 1YMEA 1IGBA 8CPAA 4OIDA 4C9EA 4P4BA 2V8HA 3SI1A 2AFWA 3MN8A 1ZG7A 4A39A 4KNGE 3HLPA 1LOKA 3PEIA 3B3SA 3WC6A 4UEFA 3PB8X 3QNVA 1KWMA 4TWEA 1PCAA 1BPMA 4H2KA 2ZEPA 4DUKA 3VATA 2OOTA 6CPAA 3BXMA 2PJCA 1ELLP 1CP7A 2BOAA 3N5FA 3TX8A 4AXVA 4FBEA 4P45A 2DEAA 3D4UA 4OC5A 4C8UA 2PJ1A 2AFXA 4RUHA 3D67A 1DTDA 3I6SA 3FVLA 2XEJA 4PXEA 1OBRA 2ZOGA 4UF4A 3PB7X 2XEIA 4W9YA 2ZEOA 3B3CA 4ONWA 2IQ6A 4ZX8A 2C5QA 1XMBA 4A37A 3B3TA 4P4IA 3SI2A 2CTBA 5IB9A 2CTCA 1VHOA 4FWUA 3IO1A 2AFZA 5J1QA 4PXCA 4C9UA 3S9NA 2AFOA 3ISXA 4NJRA 1XBUA 2ZEHA 2HC9A 3ISZA 4C99A 4FAIA 3IJ3A 1HDQA 1WVMA 4ZI6A 3FX6A 2V8VA 4NFRA 2PJ3A 1XJOA 2GP4A 3K2KA 4OC0A 3FEDA 1VGYA 2PIZA 1YW4A 1ZLHA 1TF8A 3PFEA 4R76A 1IY7A 4C84A 3IEHA 5JH9A 4UIBA 4NGMA 5K8PA 1YW6A 3MRUA 1F2OA 1Q7LA 2PJ4A 3NH5A 5HVGA 3PBEA 3BHXA 4P6YA 3V7ZA 4C8AA 2GU2A 4Q7AA 4P4DA 3KQXA 4C8FA 1HEEA 3FH4A 1GYTA 5LYDA 2EK9A 2QVPA 3B3WA 4TJVA 3B35A 4P4JA 3KL9A 4K3NA 3BI1A 5THWA 3VARA 3FEEA 4FUUA 3LWUA 3RZAA 4OKOA 3IC1A 4PXDA 3RBUA 4CPAA 4PQAA 4TNUA 4EFDA 4R7MA 3CT9A 1LAMA 4ZY2A 1Z5RA 1ZLIA 5LYIA 4C8TA 1Y7EA 2I3CA 2ZEFA 4ZYQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ELY A;  4MHY A;  2ZEG A;  2RB7 A;  4MRI A;  3TC8 A;  2WYR A;  3D7G A;  2HB6 A;  3S9L A;  2POK A;  3VTA A;  3D68 A;  1Y0R A;  4NGS A;  1EE3 P;  2ZEN A;  5JM6 A;  3FEC A;  3B2Y A;  2O4H A;  4MHN A;  2NSM A;  3EIF A;  2ZEL A;  1QMU A;  4MCQ A;  3IWW A;  4JYW A;  4NGT A;  2AFU A;  3KR4 A;  1LCP A;  2GLF A;  1YSJ A;  3L2N A;  5K8M A;  4R6T A;  3B3V A;  3D7H A;  1TKF A;  4OP4 A;  2C6P A;  2PCU A;  4P44 A;  1JQG A;  1TXR A;  1PYT B;  5HVF A;  1H8L A;  4OIW A;  1TKJ A;  1F2P A;  3JRU A;  2BO9 A;  1TF9 A;  2Q4Z A;  2V77 A;  4NGP A;  1LFW A;  3NH8 A;  4G1P A;  2O53 A;  4IHM A;  2ZEM A;  1ARM A;  2RFH A;  2PJ0 A;  3H8E A;  5CPA A;  3GUX A;  3T8W A;  3I74 A;  3PRT A;  3KAS A;  5F09 A;  4DJL A;  1AYE A;  1R43 A;  1FT7 A;  5DS0 A;  4YU9 A;  2V8G A;  2VL1 A;  4NGR A;  2CIJ A;  1XRY A;  3GLJ A;  3D7D A;  2PE3 A;  3GB0 A;  2ANP A;  1CBX A;  3WC5 A;  2V8D A;  5LRG A;  3FMC A;  4MCP A;  3I1U A;  2PRQ A;  3DGV A;  3PB6 X;  2JEW A;  3WC7 A;  4IAV A;  2AFS A;  5LYL A;  4OC3 A;  4OC4 A;  1ARL A;  4YN3 A;  3ICU A;  4NGN A;  3V38 A;  4C85 A;  4X8I A;  5LRK A;  3HUV A;  4A94 A;  3KR5 A;  2PJB A;  3NFZ A;  4PXB A;  2PJA A;  4EWT A;  1TKH A;  4WJB A;  1Z2L A;  2PJ8 A;  1AMP A;  5JGF A;  3KI9 A;  3NA6 A;  3IIB A;  1F57 A;  2IMO A;  2NYQ A;  4ZY1 A;  1NSA A;  2ZEE A;  4X3R A;  1YLO A;  3S9M A;  2IJZ A;  4PPZ A;  3KZW A;  1BPN A;  1QQ9 A;  4IK2 A;  1CPX A;  3CPX A;  4OC1 A;  2GRE A;  4P4F A;  3IFE A;  4OC2 A;  2XEG A;  3KQZ A;  3D7F A;  4P10 A;  5I4M A;  4NGQ A;  5K8N A;  3CDX A;  4C9A A;  2PJ7 A;  2QJ8 A;  4BD9 A;  3SJX A;  1CPS A;  2ZED A;  2ABZ A;  2Q51 A;  3FJU A;  5D8N A;  1ZG9 A;  2PIY A;  4C9V A;  3D66 A;  4MHZ A;  1LAP A;  3LMS A;  4TJX A;  4UEE A;  3K9T A;  1CP6 A;  1VHE A;  1UWY A;  4DYO A;  3VH9 A;  1BLL E;  3SJG A;  4NJQ A;  2PJ5 A;  4CDK A;  1Y9Z A;  3H8F A;  2WZN A;  2XEF A;  2PVW A;  4C8C A;  2F7V A;  1V6C A;  4Z65 A;  3NH4 A;  4GM5 A;  1Y0Y A;  5CBM A;  3SJE A;  4C86 A;  1VIX A;  4X2T A;  3PBB A;  2CF4 A;  5HVH A;  1XFO A;  5LRJ A;  4MMO A;  4F8Z A;  3BI0 A;  2C6C A;  4O23 A;  4F9V A;  4EME A;  4F9U A;  5K8O A;  1DE4 C;  2AFM A;  3H8G A;  5D29 A;  3B7I A;  3CPA A;  4WWV A;  2OR4 A;  4KSI A;  4OME A;  2F8H A;  3KHZ A;  2JBJ A;  4JZ0 A;  2FVG A;  3SI0 A;  4P4E A;  2Q43 A;  3SJF A;  3RAM A;  1LAN A;  2EK8 A;  1CG2 A;  4UIA A;  7CPA A;  4C8P A;  4MXU A;  4CDJ A;  4B6Z A;  3KGQ A;  4ZY0 A;  4ZX9 A;  2C6G A;  2QYV A;  1HDU A;  1Z8L A;  2PJ9 A;  1BAV A;  2ZOF A;  4MHP A;  3WT4 A;  2G9D A;  3WAB A;  4A38 A;  1RTQ A;  3KHX A;  4LQG A;  1XF1 A;  2BCO A;  1R3N A;  1ELM P;  2C1C A;  4R8F A;  2GLJ A;  2J9A A;  2EWB A;  1M4L A;  5HXD A;  5LYF A;  4C9R A;  4UEZ A;  4YWY A;  3FF3 A;  3PFO A;  3DLJ A;  1ZG8 A;  2JBK A;  2PJ2 A;  4MCS A;  3PB9 X;  4MCR A;  1CX8 A;  2PVV A;  2PJ6 A;  3PB4 X;  1FNO A;  1YME A;  1IGB A;  8CPA A;  4OID A;  4C9E A;  4P4B A;  2V8H A;  3SI1 A;  2AFW A;  3MN8 A;  1ZG7 A;  4A39 A;  4KNG E;  3HLP A;  1LOK A;  3PEI A;  3B3S A;  3WC6 A;  4UEF A;  3PB8 X;  3QNV A;  1KWM A;  4TWE A;  1PCA A;  1BPM A;  4H2K A;  2ZEP A;  4DUK A;  3VAT A;  2OOT A;  6CPA A;  3BXM A;  2PJC A;  1ELL P;  1CP7 A;  2BOA A;  3N5F A;  3TX8 A;  4AXV A;  4FBE A;  4P45 A;  2DEA A;  3D4U A;  4OC5 A;  4C8U A;  2PJ1 A;  2AFX A;  4RUH A;  3D67 A;  1DTD A;  3I6S A;  3FVL A;  2XEJ A;  4PXE A;  1OBR A;  2ZOG A;  4UF4 A;  3PB7 X;  2XEI A;  4W9Y A;  2ZEO A;  3B3C A;  4ONW A;  2IQ6 A;  4ZX8 A;  1XMB A;  4A37 A;  3B3T A;  4P4I A;  3SI2 A;  2CTB A;  5IB9 A;  2CTC A;  1VHO A;  4FWU A;  3IO1 A;  2AFZ A;  5J1Q A;  4PXC A;  4C9U A;  3S9N A;  2AFO A;  3ISX A;  4NJR A;  1XBU A;  2ZEH A;  2HC9 A;  3ISZ A;  4C99 A;  4FAI A;  3IJ3 A;  1HDQ A;  1WVM A;  4ZI6 A;  3FX6 A;  2V8V A;  4NFR A;  2PJ3 A;  1XJO A;  3K2K A;  4OC0 A;  3FED A;  1VGY A;  2PIZ A;  1YW4 A;  1ZLH A;  1TF8 A;  3PFE A;  4R76 A;  1IY7 A;  4C84 A;  3IEH A;  5JH9 A;  4UIB A;  4NGM A;  5K8P A;  1YW6 A;  3MRU A;  1F2O A;  1Q7L A;  2PJ4 A;  3NH5 A;  5HVG A;  3PBE A;  3BHX A;  4P6Y A;  3V7Z A;  4C8A A;  2GU2 A;  4Q7A A;  4P4D A;  3KQX A;  4C8F A;  1HEE A;  3FH4 A;  1GYT A;  5LYD A;  2EK9 A;  2QVP A;  3B3W A;  4TJV A;  3B35 A;  4P4J A;  3KL9 A;  4K3N A;  3BI1 A;  5THW A;  3VAR A;  3FEE A;  4FUU A;  3LWU A;  3RZA A;  4OKO A;  3IC1 A;  4PXD A;  3RBU A;  4CPA A;  4PQA A;  4TNU A;  4EFD A;  4R7M A;  3CT9 A;  1LAM A;  4ZY2 A;  1Z5R A;  1ZLI A;  5LYI A;  4C8T A;  1Y7E A;  2I3C A;  2ZEF A;  4ZYQ A; 
#chains in the Genus database with same CATH topology
 2B3V A;  5ELY A;  4MHY A;  2ZEG A;  4KOS A;  2RB7 A;  2YND A;  3NE8 A;  4A4B A;  4MRI A;  5G21 A;  3TC8 A;  2WPX A;  2WYR A;  3D7G A;  3N7Z A;  2HB6 A;  4R57 A;  3S9L A;  3TLA A;  2JEV A;  5EC4 A;  2POK A;  3VTA A;  4M6I A;  4M3S A;  4ZGY B;  2GIV A;  4LUA A;  4UA3 A;  2CNT A;  3D68 A;  1Y0R A;  4FD7 A;  2B4B A;  3F5B A;  4NGS A;  1EE3 P;  2ZEN A;  3TLC A;  2E28 A;  1AUG A;  2Z3O A;  3FEC A;  3B2Y A;  5JM6 A;  3U88 C;  2O4H A;  1XE4 A;  1GGO A;  4MHN A;  4C7H A;  2NSM A;  2HRO A;  3SXN A;  4MJX A;  2REF A;  5AG6 A;  3EIF A;  3PGP A;  3NOJ A;  3NFQ A;  5AGE A;  5HKW A;  1Z8T A;  2HUZ A;  2ZEL A;  1PU9 A;  1QMU A;  4HPS A;  4NXY A;  4BMH A;  3FXT A;  4MCQ A;  3IWW A;  1IYK A;  4JYW A;  1WJT A;  4NGT A;  4MFQ A;  2XPO A;  2AFU A;  4CAF A;  2Z10 A;  2ZXV A;  3KR4 A;  3VRR A;  4CYN A;  5J8F A;  1LCP A;  2GLF A;  1YSJ A;  3L2N A;  5K8M A;  4R6T A;  2DPS A;  3B3V A;  4U9Y A;  3D7H A;  1YR0 A;  1TKF A;  2GE3 A;  4OP4 A;  1I1D A;  2C6P A;  2PCU A;  4P44 A;  3TOB A;  1JQG A;  3VWE A;  1TXR A;  1PYT B;  5DWN A;  5HVF A;  5C88 A;  1YVO A;  3R95 A;  5JPH A;  3OP0 A;  5K99 A;  3CZX A;  2B58 A;  3IU1 A;  4CGL A;  1H8L A;  4OIW A;  2ARH A;  1TKJ A;  1F2P A;  3JRU A;  2BO9 A;  1B87 A;  1TF9 A;  2OZH A;  2Q4Z A;  2Q4V A;  4PK3 A;  2V77 A;  4NGP A;  1LFW A;  3NH8 A;  2O53 A;  4FD6 A;  1XF8 A;  4G1P A;  4IHM A;  1Q5X A;  2ZEM A;  1S3Z A;  1ARM A;  4Q38 A;  2RFH A;  2PJ0 A;  3VRP A;  4A4C A;  3OWC A;  3H8E A;  4MHD A;  5CPA A;  4KVO E;  3GUX A;  3T8W A;  3EXN A;  4K30 A;  3EZE A;  3SR3 A;  4XPD C;  1B47 A;  1IIC A;  5A27 A;  3D2M A;  4KOV A;  3I74 A;  2Z3L A;  5AG5 A;  1P4N A;  4Y49 C;  1XIX A;  2HV2 A;  3PRT A;  3KAS A;  1WWZ A;  3T9Y A;  3ZJ0 A;  2VZY A;  4MI1 A;  4EYS A;  1XOV A;  1KUX A;  3DR8 A;  4MBU A;  5F09 A;  2B5G B;  2J8R A;  4DJL A;  5E96 A;  1AYE A;  1N71 A;  1R43 A;  2GFQ A;  1FT7 A;  5DS0 A;  4YU9 A;  2V8G A;  2VL1 A;  4NGR A;  3HPG G;  1BXR B;  2CIJ A;  1XRY A;  3ZZI A;  3GLJ A;  5FD8 A;  3D7D A;  1MJ9 A;  3FYN A;  2G3T A;  4R9M A;  2REE A;  1KBL A;  3TTH A;  3OB2 B;  2FM4 A;  2PE3 A;  2HQY A;  2G0B A;  3GB0 A;  2ANP A;  4CGO A;  1CBX A;  2PCN A;  1RXT A;  2D4O A;  4KUB A;  3R9G A;  3WC5 A;  1M6V B;  2V8D A;  2CNS A;  3TE4 A;  2ATR A;  1CM0 A;  4L8A A;  3VGO A;  1Z9U A;  2GAN A;  5LRG A;  2CY2 A;  5CNP A;  1X10 A;  4C68 A;  1A2Z A;  3FMC A;  5AG4 A;  4MCP A;  2C27 A;  5F48 A;  1J3L A;  4J0N A;  3FIX A;  3I1U A;  3TLG A;  2PRQ A;  3DGV A;  3PB6 X;  4GS4 A;  1YGH A;  2JEW A;  3WC7 A;  4CAE A;  4IAV A;  4RS2 A;  4C99 A;  5I0C A;  2AFS A;  5LYL A;  4OC3 A;  4OC4 A;  1YVK A;  1ARL A;  2Z3P A;  5HKY A;  3F9K C;  3BJ8 A;  3LAC A;  1YQE A;  4FD4 A;  3ICU A;  4NGN A;  4YN3 A;  2FT0 A;  3V38 A;  4C85 A;  4MFP A;  1QSR A;  1Y9K A;  3HMJ G;  1EO0 A;  3HUV A;  4X8I A;  1MK4 A;  1VKC A;  2YGW A;  2Z0Z A;  1M44 A;  4A33 A;  4BIN A;  4BPU B;  2CXA A;  3GJZ A;  4A94 A;  2X7B A;  3KR5 A;  4QC6 A;  2PJB A;  3NFZ A;  4PXB A;  2A4N A;  2PJA A;  4COG A;  3SHP A;  4EWT A;  3EFA A;  3K9U A;  2N3A B;  1TKH A;  1Z2L A;  4BPX B;  2F5I A;  1AMP A;  2PJ8 A;  4WJB A;  5JGF A;  2DPT A;  3KI9 A;  2BSW A;  3NA6 A;  3IIB A;  1F57 A;  3OB1 B;  2FS5 A;  2Q7B A;  4QB9 A;  5IX3 A;  2VXK A;  4B12 A;  1IOF A;  3GKR A;  3QB8 A;  2IMO A;  2D4P A;  2NYQ A;  4ZY1 A;  4KOY A;  3BUN B;  1NSA A;  2ZEE A;  4X3R A;  1YLO A;  5JQ4 A;  2G3A A;  3S9M A;  3LD2 A;  2IJZ A;  3PP9 A;  4HNX B;  2DLA A;  2OZG A;  1B6B A;  2PRB A;  3PLF B;  1X12 A;  2FE7 A;  3SXO A;  1U6M A;  2P6G A;  4PPZ A;  3O8Z A;  3RNZ A;  3S6H A;  3BLN A;  3KZW A;  1QST A;  1BPN A;  1QQ9 A;  4UFX A;  5F47 A;  1S7F A;  4IK2 A;  3V8I A;  1CPX A;  3CPX A;  2YNC C;  4LQ6 A;  4YGO A;  5JVL A;  1M4I A;  2ODF A;  4OC1 A;  5AXI A;  2GRE A;  4P4F A;  2PR1 A;  2OLS A;  3IFE A;  3KKW A;  4OC2 A;  4JWP A;  1M4G A;  2XEG A;  3TO9 A;  2J8N A;  3KQZ A;  3FNC A;  3D7F A;  1JDB C;  3H5Z A;  4P10 A;  5BY0 A;  4CAX A;  5FVJ A;  5I4M A;  4NGQ A;  4PK2 A;  5F13 A;  3JVN A;  5K8N A;  2BUE A;  2R7H A;  3CDX A;  4Y49 B;  4C9A A;  1I21 A;  2PJ7 A;  2QJ8 A;  4BD9 A;  3FBU A;  1KC7 A;  3TFY A;  3SJX A;  1CPS A;  2ZED A;  5IB0 A;  2ABZ A;  2Q51 A;  3FJU A;  3RYO A;  2QEC A;  1Z4E A;  1RO5 A;  2Q7S A;  5D8N A;  4AVB A;  4CGN A;  1SQH A;  4C2X A;  4IF5 A;  1ZG9 A;  3HPH E;  4MY0 A;  2PIY A;  4XPK A;  1QSN A;  4CYP A;  3BUO B;  4KOR A;  4BTF A;  2UV8 G;  3D66 A;  4ZBG A;  3TOA A;  1C3O B;  4C9V A;  4MHZ A;  1Q2D A;  3T05 A;  3ZNI A;  1LAP A;  1YRE A;  1JDE A;  4KOT A;  3S6K A;  1K4J A;  3LMS A;  4TJX A;  1Z8W A;  4CS0 B;  4UEE A;  3K9T A;  5F49 A;  4F0Y A;  1MJA A;  1EZA A;  1VBH A;  1CP6 A;  3W6S A;  1IB1 E;  4U9Z A;  3GYA A;  1VHE A;  1UWY A;  1KUY A;  3VH9 A;  1BLL E;  4DYO A;  3TLZ A;  3SJG A;  4NJQ A;  2JDC A;  1KUV A;  2NMT A;  2PJ5 A;  4CDK A;  4MFK A;  1ZL0 A;  1Y9Z A;  4GPL B;  4CRZ B;  2Z3N A;  3H8F A;  2WSA A;  2WZN A;  2Q04 A;  1IYL A;  4NEX A;  2XEF A;  3T90 A;  2P6E A;  4JLY A;  3H4Q A;  4UFW A;  4JJX A;  3VRN A;  2PVW A;  4C8C A;  2K5T A;  2F7V A;  3EC4 A;  4NF1 A;  1FBV A;  4RR2 B;  1V6C A;  3W6X A;  4Z65 A;  1IOI A;  3NH4 A;  2EUI A;  4GM5 A;  1Y0Y A;  5CBM A;  3CXS A;  4KZT A;  3SJE A;  3DSB A;  4C86 A;  1VIX A;  2WUU A;  3W91 A;  4L89 A;  4F6A A;  4KS9 A;  4X2T A;  5H86 A;  1M1D A;  4UCM A;  2DF5 A;  3C8O A;  4H1H A;  3PBB A;  1NSL A;  4M85 A;  2CF4 A;  5HVH A;  1XFO A;  5LRJ A;  4MMO A;  5HMN A;  1EZB A;  2C5Q A;  1Q2C A;  4F8Z A;  3BI0 A;  1JWQ A;  1IU8 A;  2XPL A;  4JD6 A;  3IGR A;  3QAY A;  2C6C A;  1KZF A;  2ZPA A;  4O23 A;  3I3G A;  4KLV A;  4A95 A;  3D2P A;  4EME A;  4F9V A;  1VI4 A;  4F9U A;  5K8O A;  1Y9W A;  1S7L A;  4M8D A;  4AVA A;  1DE4 C;  2AFM A;  3H8G A;  4GXH A;  5J8C A;  2QIR A;  2R98 A;  4COB A;  2B0A A;  5D29 A;  3B7I A;  3CPA A;  4CYQ A;  2ZW4 A;  4WWV A;  2OR4 A;  4KSI A;  4AVC A;  4OME A;  2F8H A;  3KHZ A;  3IWE A;  2P0W A;  2VQY A;  5G22 A;  3DR6 A;  2JBJ A;  4JZ0 A;  1L0C A;  2FVG A;  2JLM A;  3SI0 A;  2EZC A;  4P4E A;  4B10 A;  2XPP A;  2Q43 A;  3SJF A;  4CZ1 A;  4INJ A;  4R87 A;  3RAM A;  2D0P A;  1LAN A;  2EK8 A;  4A31 A;  5J3X A;  4C9R A;  1CG2 A;  2EO8 A;  4UIA A;  2H5M A;  5G20 A;  7CPA A;  4JXQ A;  4MXU A;  4C8P A;  4CDJ A;  3TT2 A;  4B6Z A;  4E2A A;  3BUW B;  4NCZ A;  1CS0 B;  3KGQ A;  4ZY0 A;  4ZX9 A;  3PT1 A;  3OAK A;  2C6G A;  2PDO A;  2QYV A;  2J8M A;  1HDU A;  4QUS A;  1Z8L A;  2PJ9 A;  3R1K A;  2I00 A;  1BAV A;  2O28 A;  3T5M A;  2ZOF A;  3EZB A;  4MHP A;  1PUA A;  4U5Y A;  3WT4 A;  3T07 A;  2G9D A;  2YJV A;  4MI4 A;  2EBJ A;  3WAB A;  4A38 A;  1RTQ A;  1J4J A;  5IR2 A;  3KHX A;  4LQG A;  5A28 A;  4RN7 A;  1XF1 A;  5F9M A;  3TLB A;  2BCO A;  1R3N A;  2DXQ A;  3G3S A;  1ELM P;  2I79 A;  4CGM A;  2C1C A;  2OH1 A;  4R8F A;  4UCP A;  2YNC A;  2GLJ A;  2J9A A;  2EWB A;  1M4L A;  2VZZ A;  2WPW A;  4UWI A;  4UEZ A;  4M6H A;  3TO6 A;  3UY5 A;  4MJ8 A;  4H89 A;  5LYF A;  3G23 A;  5HKZ A;  2B4J C;  3LOD A;  4PV6 A;  4XPL A;  1Z9E A;  2KCW A;  4YWY A;  1R61 A;  3FF3 A;  1BO4 A;  3PFO A;  5C82 A;  3DLJ A;  4AG9 A;  4IUS A;  2AUM A;  1ZG8 A;  2JBK A;  2PJ2 A;  4JXR A;  1LRZ A;  2B4D A;  4MCS A;  4F0X A;  3PB9 X;  5F46 A;  1DIK A;  3RO0 A;  4MCR A;  1CX8 A;  2PVV A;  2B4D B;  2PJ6 A;  4B13 A;  4OAD A;  3P2H A;  3PB4 X;  4FD5 A;  4KSA A;  1FNO A;  4KOW A;  3E0K A;  4KVM E;  1YME A;  2VKZ G;  1IGB A;  8CPA A;  1ZRS A;  4OID A;  4YFJ A;  4C9E A;  5H84 A;  1V0C A;  2Q4Y A;  4P4B A;  2R1I A;  4ORF A;  5F1Y A;  2V8H A;  1QSO A;  2Z11 A;  2AFW A;  3SI1 A;  1ZO0 A;  4HKF A;  1ON0 A;  3MN8 A;  1ZG7 A;  2JDD A;  2FIW A;  1GHE A;  4A39 A;  1S7K A;  4KNG E;  3BUX B;  3TLY A;  3HLP A;  1LOK A;  3PEI A;  4EVY A;  3B3S A;  3WC6 A;  2PQ8 A;  4UEF A;  3PB8 X;  3R96 A;  5KTD A;  3QNV A;  1KWM A;  4TWE A;  4CGP A;  4AG7 A;  1C30 B;  5HXD A;  3S6F A;  3T0T A;  2MP0 A;  1PCA A;  4R3L A;  1BPM A;  2VBQ A;  3F8K A;  3GIU A;  4R3K A;  1S60 A;  2B3U A;  4H2K A;  4LX9 A;  4MFZ A;  2ZEP A;  4MFL A;  3WR7 A;  4DUK A;  3VAT A;  4II9 A;  4KLW A;  2EZB A;  2OOT A;  4CRY B;  6CPA A;  5KTA A;  3BXM A;  3IU2 A;  2PJC A;  4HNY B;  4KUA A;  1ELL P;  4E94 A;  4CO9 A;  4CAW A;  1CP7 A;  2OU2 A;  4B5P B;  2BOA A;  3D3S A;  3N5F A;  4KSF A;  3TX8 A;  4AXV A;  4FBE A;  4B5O A;  4KVX A;  4P45 A;  1CJW A;  4HNW B;  2DEA A;  3D4U A;  4C2Z A;  2Y0M A;  1XEB A;  2P6F A;  4OC5 A;  4C8U A;  2PJ1 A;  2ZW5 A;  3TLE A;  2AFX A;  4RUH A;  1Z4R A;  1DTD A;  3D67 A;  1NXJ A;  2PR8 A;  1P0H A;  5AG7 A;  4B11 A;  3FVL A;  3I6S A;  2OB0 A;  1OZP A;  1TIQ A;  1YLE A;  2FXF A;  4IIX A;  2XEJ A;  3S6G A;  2VEZ A;  3P2F A;  4PXE A;  5F5X A;  1OBR A;  4UBR A;  3I9S A;  4CAV A;  1XMT A;  4PSW A;  2BEI A;  2ZOG A;  4UF4 A;  3PB7 X;  2XEI A;  4W9Y A;  4AB7 A;  3EO4 A;  2ZEO A;  5IV0 A;  3TLG B;  3B3C A;  1QSM A;  4ONW A;  4BPW B;  2IQ6 A;  2D0O A;  4A2Z A;  4C2Y A;  4MFJ A;  3GY9 A;  3QAH A;  4ZX8 A;  3F0A A;  1XMB A;  3JTK A;  4PSX A;  3FB3 A;  4XNH C;  3B3T A;  4P4I A;  1BOB A;  4A37 A;  3SI2 A;  1CE8 B;  2CTB A;  2FIA A;  1IID A;  4I49 A;  4E8O A;  1S7N A;  5ISV A;  2YNE A;  5LRK A;  4JVO A;  1S5K A;  4XNH B;  5IB9 A;  2CTC A;  5EBV A;  1NMT A;  1VHO A;  2FCK A;  2R82 A;  4FWU A;  3IO1 A;  3R9F A;  2AFZ A;  5J1Q A;  2EVN A;  3VRQ A;  4PXC A;  4Q36 A;  4B5P A;  4C9U A;  3S9N A;  4UFV A;  2AFO A;  3TYX A;  1Q2Y A;  2AE6 A;  3ISX A;  4NJR A;  1ZYM A;  2R8V A;  2RC4 A;  1XBU A;  3C26 A;  2ZEH A;  2HC9 A;  4UWJ A;  3VRO A;  3ISZ A;  4A32 A;  3K4I A;  1Z8X A;  4FAI A;  1M4D A;  1HDQ A;  3IJ3 A;  4OAE A;  1WVM A;  4ZI6 A;  1T36 B;  3EZA A;  2XPN A;  2V8V A;  3FX6 A;  1WK4 A;  4J3G A;  4KOX A;  4NFR A;  2B5G A;  2PJ3 A;  3B8G A;  3CXQ A;  1XJO A;  1YVH A;  1Y7R A;  2GP4 A;  3A9L A;  3K2K A;  4OC0 A;  3FED A;  3IWG A;  2X0S A;  1NBW A;  1VGY A;  2PIZ A;  1YW4 A;  1ZLH A;  1TF8 A;  3PFE A;  3D8P A;  4R76 A;  1IY7 A;  2Q0Y A;  4H6Z A;  4NSQ A;  3IEH A;  1NE9 A;  4C84 A;  5JH9 A;  5GCN A;  1FY7 A;  2ZW6 A;  4UCN A;  2Y1M A;  4NGM A;  4UIB A;  4E5S A;  5JYB A;  5K8P A;  1KEE B;  3G8W A;  1YW6 A;  3MRU A;  5HH1 A;  1F2O A;  2HI6 A;  1Q7L A;  2PJ4 A;  3DDD A;  4B14 A;  4YRH A;  2YJT A;  2QML A;  3NH5 A;  3PFV A;  5HVG A;  3PBE A;  2VI7 A;  3BHX A;  2IL4 A;  4P6Y A;  5DWM A;  2OZU A;  3V7Z A;  4C8A A;  3EY5 A;  2GU2 A;  4CYO A;  4Q7A A;  1YX0 A;  4P4D A;  2BL1 A;  3KQX A;  4M6G A;  4C8F A;  2EZA A;  1HEE A;  3FH4 A;  4RI1 A;  1R57 A;  1GYT A;  5LYD A;  2FL4 A;  3TO7 A;  3U1B A;  3NE7 A;  1VBG A;  2PSW A;  4QVT A;  1VHS A;  2EK9 A;  2QVP A;  5G1Z A;  4C7I A;  4QBJ A;  4ONU A;  3B3W A;  4H6U A;  3VWD A;  4IIY A;  4TJV A;  4OLL A;  2Z3M A;  2AJ6 A;  2CBL A;  2DIK A;  3BJ7 A;  3R9E A;  3PZJ A;  3B35 A;  2CNM A;  4P4J A;  3KL9 A;  4K3N A;  3TCV A;  3BI1 A;  5THW A;  2Q44 A;  2Y1N A;  3VAR A;  4BBH A;  3FEE A;  4FUU A;  4MY3 A;  3LWU A;  5KTC A;  4XPD B;  3RZA A;  2AUN A;  2Z3K A;  3CXP A;  2HWG A;  4E0A A;  4DNC A;  3BUM B;  1UFH A;  4OKO A;  3IC1 A;  2ZW7 A;  2FSR A;  3MGD A;  4PXD A;  3RBU A;  3DNS A;  4CPA A;  1A9X B;  3JUW A;  4PQA A;  4KOU A;  4TNU A;  4EFD A;  4R7M A;  3CT9 A;  1LAM A;  3FRM A;  4ZY2 A;  3KRV A;  1Z5R A;  1ZLI A;  4A30 A;  5LYI A;  4C8T A;  4X5K A;  1Y7E A;  1I12 A;  1YK3 A;  2I3C A;  5BWA B;  1MJB A;  5EMI A;  2PC1 A;  2ZEF A;  4ZYQ A; 
#chains in the Genus database with same CATH homology
 5ELY A;  4MHY A;  2ZEG A;  2RB7 A;  4MRI A;  3TC8 A;  2WYR A;  3D7G A;  2HB6 A;  3S9L A;  2POK A;  3VTA A;  3D68 A;  1Y0R A;  4NGS A;  1EE3 P;  2ZEN A;  5JM6 A;  3FEC A;  3B2Y A;  2O4H A;  4MHN A;  2NSM A;  3EIF A;  2ZEL A;  1QMU A;  4MCQ A;  3IWW A;  4JYW A;  4NGT A;  2AFU A;  3KR4 A;  1LCP A;  2GLF A;  1YSJ A;  3L2N A;  5K8M A;  4R6T A;  3B3V A;  3D7H A;  1TKF A;  4OP4 A;  2C6P A;  2PCU A;  4P44 A;  1JQG A;  1TXR A;  1PYT B;  5HVF A;  1H8L A;  4OIW A;  1TKJ A;  1F2P A;  3JRU A;  2BO9 A;  1TF9 A;  2Q4Z A;  2V77 A;  4NGP A;  1LFW A;  3NH8 A;  4G1P A;  2O53 A;  4IHM A;  2ZEM A;  1ARM A;  2RFH A;  2PJ0 A;  3H8E A;  5CPA A;  3GUX A;  3T8W A;  3I74 A;  3PRT A;  3KAS A;  5F09 A;  4DJL A;  1AYE A;  1R43 A;  1FT7 A;  5DS0 A;  4YU9 A;  2V8G A;  2VL1 A;  4NGR A;  2CIJ A;  1XRY A;  3GLJ A;  3D7D A;  2PE3 A;  3GB0 A;  2ANP A;  1CBX A;  3WC5 A;  2V8D A;  5LRG A;  3FMC A;  4MCP A;  3I1U A;  2PRQ A;  3DGV A;  3PB6 X;  2JEW A;  3WC7 A;  4IAV A;  2AFS A;  5LYL A;  4OC3 A;  4OC4 A;  1ARL A;  4YN3 A;  3ICU A;  4NGN A;  3V38 A;  4C85 A;  4X8I A;  5LRK A;  3HUV A;  4A94 A;  3KR5 A;  2PJB A;  3NFZ A;  4PXB A;  2PJA A;  4EWT A;  1TKH A;  4WJB A;  1Z2L A;  2PJ8 A;  1AMP A;  5JGF A;  3KI9 A;  3NA6 A;  3IIB A;  1F57 A;  2IMO A;  2NYQ A;  4ZY1 A;  1NSA A;  2ZEE A;  4X3R A;  1YLO A;  3S9M A;  2IJZ A;  4PPZ A;  3KZW A;  1BPN A;  1QQ9 A;  4IK2 A;  1CPX A;  3CPX A;  4OC1 A;  2GRE A;  4P4F A;  3IFE A;  4OC2 A;  2XEG A;  3KQZ A;  3D7F A;  4P10 A;  5I4M A;  4NGQ A;  5K8N A;  3CDX A;  4C9A A;  2PJ7 A;  2QJ8 A;  4BD9 A;  3SJX A;  1CPS A;  2ZED A;  2ABZ A;  2Q51 A;  3FJU A;  5D8N A;  1ZG9 A;  2PIY A;  4C9V A;  3D66 A;  4MHZ A;  1LAP A;  3LMS A;  4TJX A;  4UEE A;  3K9T A;  1CP6 A;  1VHE A;  1UWY A;  4DYO A;  3VH9 A;  1BLL E;  3SJG A;  4NJQ A;  2PJ5 A;  4CDK A;  1Y9Z A;  3H8F A;  2WZN A;  2XEF A;  2PVW A;  4C8C A;  2F7V A;  1V6C A;  4Z65 A;  3NH4 A;  4GM5 A;  1Y0Y A;  5CBM A;  3SJE A;  4C86 A;  1VIX A;  4X2T A;  3PBB A;  2CF4 A;  5HVH A;  1XFO A;  5LRJ A;  4MMO A;  4F8Z A;  3BI0 A;  2C6C A;  4O23 A;  4F9V A;  4EME A;  4F9U A;  5K8O A;  1DE4 C;  2AFM A;  3H8G A;  5D29 A;  3B7I A;  3CPA A;  4WWV A;  2OR4 A;  4KSI A;  4OME A;  2F8H A;  3KHZ A;  2JBJ A;  4JZ0 A;  2FVG A;  3SI0 A;  4P4E A;  2Q43 A;  3SJF A;  3RAM A;  1LAN A;  2EK8 A;  1CG2 A;  4UIA A;  7CPA A;  4C8P A;  4MXU A;  4CDJ A;  4B6Z A;  3KGQ A;  4ZY0 A;  4ZX9 A;  2C6G A;  2QYV A;  1HDU A;  1Z8L A;  2PJ9 A;  1BAV A;  2ZOF A;  4MHP A;  3WT4 A;  2G9D A;  3WAB A;  4A38 A;  1RTQ A;  5IR2 A;  3KHX A;  4LQG A;  1XF1 A;  2BCO A;  1R3N A;  1ELM P;  2C1C A;  4R8F A;  2GLJ A;  2J9A A;  2EWB A;  1M4L A;  5HXD A;  5LYF A;  4C9R A;  4UEZ A;  4YWY A;  3FF3 A;  3PFO A;  3DLJ A;  1ZG8 A;  2JBK A;  2PJ2 A;  4MCS A;  3PB9 X;  4MCR A;  1CX8 A;  2PVV A;  2PJ6 A;  3PB4 X;  1FNO A;  1YME A;  1IGB A;  8CPA A;  4OID A;  4C9E A;  4P4B A;  2V8H A;  3SI1 A;  2AFW A;  3MN8 A;  1ZG7 A;  4A39 A;  4KNG E;  3HLP A;  1LOK A;  3PEI A;  3B3S A;  3WC6 A;  4UEF A;  3PB8 X;  3QNV A;  1KWM A;  4TWE A;  1PCA A;  1BPM A;  4H2K A;  2ZEP A;  4DUK A;  3VAT A;  2OOT A;  6CPA A;  3BXM A;  2PJC A;  1ELL P;  1CP7 A;  2BOA A;  3N5F A;  3TX8 A;  4AXV A;  4FBE A;  4P45 A;  2DEA A;  3D4U A;  4OC5 A;  4C8U A;  2PJ1 A;  2AFX A;  4RUH A;  3D67 A;  1DTD A;  3I6S A;  3FVL A;  2XEJ A;  4PXE A;  1OBR A;  2ZOG A;  4UF4 A;  3PB7 X;  2XEI A;  4W9Y A;  2ZEO A;  3B3C A;  4ONW A;  2IQ6 A;  4ZX8 A;  2C5Q A;  1XMB A;  4A37 A;  3B3T A;  4P4I A;  3SI2 A;  2CTB A;  5IB9 A;  2CTC A;  1VHO A;  4FWU A;  3IO1 A;  2AFZ A;  5J1Q A;  4PXC A;  4C9U A;  3S9N A;  2AFO A;  3ISX A;  4NJR A;  1XBU A;  2ZEH A;  2HC9 A;  3ISZ A;  4C99 A;  4FAI A;  3IJ3 A;  1HDQ A;  1WVM A;  4ZI6 A;  3FX6 A;  2V8V A;  4NFR A;  2PJ3 A;  1XJO A;  2GP4 A;  3K2K A;  4OC0 A;  3FED A;  1VGY A;  2PIZ A;  1YW4 A;  1ZLH A;  1TF8 A;  3PFE A;  4R76 A;  1IY7 A;  4C84 A;  3IEH A;  5JH9 A;  4UIB A;  4NGM A;  5K8P A;  1YW6 A;  3MRU A;  1F2O A;  1Q7L A;  2PJ4 A;  3NH5 A;  5HVG A;  3PBE A;  3BHX A;  4P6Y A;  3V7Z A;  4C8A A;  2GU2 A;  4Q7A A;  4P4D A;  3KQX A;  4C8F A;  1HEE A;  3FH4 A;  1GYT A;  5LYD A;  2EK9 A;  2QVP A;  3B3W A;  4TJV A;  3B35 A;  4P4J A;  3KL9 A;  4K3N A;  3BI1 A;  5THW A;  3VAR A;  3FEE A;  4FUU A;  3LWU A;  3RZA A;  4OKO A;  3IC1 A;  4PXD A;  3RBU A;  4CPA A;  4PQA A;  4TNU A;  4EFD A;  4R7M A;  3CT9 A;  1LAM A;  4ZY2 A;  1Z5R A;  1ZLI A;  5LYI A;  4C8T A;  1Y7E A;  2I3C A;  2ZEF A;  4ZYQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...