4P4KB

Structural basis of chronic beryllium disease: bridging the gap between allergic hypersensitivity and auto immunity
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
212
structure length
199
Chain Sequence
QAFWIDLFETIGSPENYLFQGRQECYAFNGTQRFLERYIYNREEFVRFDSDVGEFRAVTELGRPDEEYWNSQKDILEEERAVPDRMCRHNYELGGPMTLQRRVQPRVNVSPSKKGPLQHHNLLVCHVTDFYPGSIQVRWFLNGQEETAGVVSTNLIRNGDWTFQILVMLEMTPQQGDVYTCQVEHTSLDSPVTVEWKAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of chronic beryllium disease: linking allergic hypersensitivity and autoimmunity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords HLA class II histocompatibility antigen, DP alpha 1 chain
total genus 40
structure length 199
sequence length 212
chains with identical sequence F
ec nomenclature
pdb deposition date 2014-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4p4kB02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 4p4kB01
5FYLE 1EDQA 4OLZL 3MJ9A 4RFEA 4KROC 3U79A 3SCMC 2MPAL 3K4ZA 5FCSH 1V7MH 3A67H 1WJ3A 1ZVSA 4MX7B 5EPMA 4OCMC 1DUYA 3SKOB 4MNQD 4H26B 5HYJE 4U1KB 1T3FB 3T65B 4W4OC 1M05A 1NCCH 4WUUE 4LSSH 5B38G 4Z76B 3DO7A 1HQ4B 3KXFA 3GBMH 3T0EA 1F6AB 3RTQA 4HWEH 4JGMA 4PGZA 3OKOB 3CLFH 4L8SC 2H2PC 1QRNE 3MFGB 3T0XA 4UV4H 3WO4B 3J8F7 1DBBH 2J12B 4KZDH 3MLYH 1XH3B 4JLRA 1TZIB 4M93B 4O9HH 3R8QA 4GLRI 4RMRA 2YD8A 3GSRA 2DYPA 5KSBE 1CE1L 3MCLH 4ZNEE 3X3FL 4P3DA 4EN3A 4UDTB 3S34H 5F7EL 3SDAC 5JUEH 4BFEA 4OGXL 4PJIF 1A6VL 3CSPA 1FIEA 1MLCB 2XG4A 3I75A 4MDIB 1FBIL 1S7VB 3BKJH 1SBSH 2AJUH 1LO3H 3WIHA 5D6DA 5GGTH 2EZ0C 3QDGB 4XNXH 5EIQA 4CDGC 1ZHKB 4KK8D 3DOSA 1AGDB 3MJ8A 2VDPH 3PNWA 1L0YA 3QEUB 2PO6C 2Z31D 1CLOH 4PJ7E 4YK4C 1NBZB 5DD1H 1CXEA 4JFED 4R26H 3OHXB 5E4IA 1ND0B 3HUJA 4DTGL 5EUKB 2VDKH 1JPSL 3QUXB 4L3EA 4RGNB 2UV3A 1OAUH 2W9LA 3SEPA 4Z7VA 1T5WB 1FIGH 3ARDA 1D5IH 1JNHB 3DPBA 3SDYH 4F33A 5I8OH 1CDUA 1S7RB 2BNUB 1NGWA 5DC0A 4MNGA 2D9QB 3T8XA 1U8MA 4A6YH 1U8HA 3N1PC 1T4KB 4FG6D 4JVPA 4XAWH 4IOFC 3V6OC 5HDBF 2PW2B 5DQDH 3FJTA 1X5YA 2OMBA 3L7EB 4JPKL 5IMKB 2IAMB 2HTLC 3JWDC 1VPOL 2AV7B 1LNUA 1IAOA 1VACA 5CLTA 4PGEA 1NBQA 3LSOB 4HCRH 3UTSA 5L0QC 2A9NL 4G80A 4MNQA 1UFUA 1OARH 1A4JA 1Z9LA 4KDVA 1INEL 2HFEA 3BYYA 4ZQKB 1MCRA 3HRZA 4PYHA 4P0DA 3W0WE 4V1DA 4XNQB 2F54B 1TNMA 3KLDA 5I18L 4U33A 2IG2H 1HINH 2HLAB 2W0FB 2HN7A 2P8LA 3KWWB 5EBLA 4YUEL 5F7DB 3EDJA 3T0DA 3ROOB 4LVOC 5FXCH 4LCYA 4HWEL 2H3NA 3PGCB 3KXFB 2RIKA 2Y6SC 2PTUA 5DD5L 4XCNA 1FNSH 4QGYA 3HE6B 4R7DB 4U1LA 3CFBA 4EN3D 4ZFFB 4W4NA 3QUYB 1C08B 1X5JA 2D31A 2NXYD 3MC0A 1E28B 4OUOA 3MA9L 1CS6A 1YNTB 2NNAB 4CVZA 2AJZB 5I8CB 1TTUA 4HGWA 3HI1A 1QG3A 5GISH 3EFFB 1BF2A 4RGMB 2LU3A 2BHYA 4WW2B 2YMXH 4NQCD 5MERB 4HV8B 3O6LH 1QPPA 3TJEL 1NJ9A 3M8OL 4F2MB 3BESR 3LKSB 2UVEA 5I0DA 5HD8D 2YD2A 2Y23A 1G6RH 3W9DB 4CW1A 2R0KH 1LD9B 4JPWH 5DJ2B 4MA7L 1JTTA 5C0DB 2VKXA 4MAYA 5HGGS 1RJZB 4LBEA 1LE9B 4Y88A 3GJFA 5IESL 4YFLF 5I1JL 4P49A 3ARUA 3QIUB 4LDEB 3AREB 3S8WA 2UY7A 2UYLA 4Y4FC 4E42A 4G6ML 2VISA 1M7IB 3FO1B 4F15B 4CKVX 1F4XL 3SO3B 1U3HA 1G7IA 4XCCL 2SEBA 3OKDA 1A6TA 3OR7A 4M6OL 1BVLA 2V5YA 5CSZB 3VXSA 4JPIA 2AVGA 2BNQA 3RAJH 1MLBA 4G6JH 5KSBF 5JIKA 4Y4HC 3HAEA 4FQCH 4G5ZH 3SDAD 1T1XB 1X5FA 5E6IA 4LIQL 1MUJA 4HX1A 4MD5B 1YC8A 5EC1A 3VDAA 1IT9L 3MZTA 3VDCA 2A6JA 4Q58C 2ZPKH 4B50A 2J6EH 5CAYB 1KJ2L 2VQ1B 2OL3B 1JYNA 3NCEB 2WUCL 1H15B 1FZOA 1P4IL 5FUOH 1WZ1H 3WDHA 5J1AA 3JXAA 3MBED 3KYNB 3AU1A 5E0QA 3QUXD 4OV6F 3RX8A 3B9KA 2V17L 4GMSL 2Q8AH 5FUCC 1N6QH 1KELH 3CX5K 4J3UA 2HLAA 3CDYA 4JFOA 1OY3B 1EAJA 1AQDB 2NY2B 2VIRB 2V6HA 1BIIB 3D39A 3EYUL 4N90E 4Z0XB 3TA3D 2A73B 4NQVA 1HKLL 4LASH 1XZ0B 2EYRA 5J13C 4Y4KD 5C3TA 1KJMA 1RZKH 2EEAA 1J10A 4M5YL 5JXED 1RK0B 2IPUK 4GSDL 2YD6A 5LGJA 1G1CA 4ETQB 2NR6C 3LN4B 2EDDA 2BVQB 2HT4C 5EO0B 2YD3A 5IEKA 4HGWB 1YN7A 5EBWA 2GUOB 1OAQL 4KI5D 1PY9A 5ACLA 2GITB 5JNYA 3QUMA 1KCSH 5HYIA 2E5EA 2A9NH 3FQRB 1QKZH 5C0AA 2H26A 2QLVB 5T33L 5H2BA 2DLIA 2GSIA 3RHWK 1OAZL 2IH3B 3MBEC 3MFFB 5L2KE 1ETZB 4I48A 1Z2KA 1J18A 2AABL 4PJEF 2R1YB 1LP9E 3RZWA 2A9ML 2FWOA 2Z93B 3VU2A 5GSRB 4JQVA 2EDNA 3X3GL 3UPRB 4BSVB 2YN3A 4MMZC 3F7PC 1DQLL 1QSEB 4GQPH 3BD4A 4GXVL 4YHLH 4L4VA 1U92A 4WEMB 1IGCL 2VXUL 3REWB 2ICWA 3D18A 3DVFA 3RZCA 1NAML 3WCYA 4MGXA 3SCMD 1HIML 5TF1L 5DS8A 1A3LH 4MQSB 8CGTA 4LKXA 5D1ZB 1DLFL 3SKMB 4GW5B 4Y4KC 4CVUA 3EO0B 1Z9OA 3NA9L 1MFDH 2B0SH 4JREB 4KVCL 4TVPD 3FQNB 4GRLB 1HSBB 4GUPB 3UJTL 4HJJH 5KW9H 4GS7C 5F7FA 1V5JA 5HHPB 1G7LB 1CL7I 1MJ7H 4PP1C 5EC2A 3KPPB 3ULVL 1GGBL 4EUPH 5A40E 2VLME 3V4UL 3WFHB 1WWWX 2H2SD 1M7DB 2YC1A 4G7YL 4NRYA 3DX6A 3KPLA 2AXHA 3O4OC 4J3SA 3LKRA 5K9KA 4RX4A 4JRWA 5I1JH 3DX9B 4LAQH 5SX5K 5CEYB 3MLYL 1NAKH 4WWKA 2DQHL 4PJCE 4NQDE 4DOHB 3KYKH 3UO1H 4XGZB 5EBMA 3JV6A 3U7AA 4OD2A 4FNLL 3BE1H 4D0BA 1BEYH 5DO2C 5DEGB 3WL9A 4NKOA 3U46A 4Z7UB 3P3YA 2E9WA 1RU9L 4D9LH 2CKBL 3MOAL 1EZVX 5IG7A 1KEGL 4XWOC 5GS0H 3PL6D 3L3GA 5D72H 1F4WL 3L3KA 3CDFA 1ZAGA 1I1YA 5AD0A 4AMKH 1KCUH 3IETB 1FVEB 4UBDC 4NQEE 1AO7D 1WEJH 1DQML 1ACYH 4KZEL 3LHPL 1VFBB 4WV1A 2C1OA 1NC4A 3EIFA 3ARZA 4PRIB 3KXFE 2WLZA 3OX8A 2GI7A 5E8NA 1MNUH 5L6YH 5I6XC 1P4IH 4O51A 3FB7B 2IH3A 1MOEA 2EXWD 3I3BA 4L5FL 5E56A 4P5TA 5JHDA 2DQHH 3B2UD 3RZCC 4FABL 1J7VR 3PWJB 4OZ4B 2NMSA 4PLKD 4BQCA 3QDJB 3VCLA 4Y4KB 4GG6E 5I8OL 1IEAB 5L9DH 1BQSA 1HEZA 4JFQB 5HDQL 1CFTB 5DVKA 4PRDA 1AD0A 1Q9OA 2E6PA 4P5TB 3VGFA 5JHDB 1RMFH 5C0BB 2CLRB 4GQ9H 1OVZA 3TESA 3OJDA 4X80L 1PZ5A 3TBYB 5BVJA 4PJBF 3EOTL 5GJTH 3O3EA 4PGEB 1CWVA 1MELA 4PYGA 1HN1A 3RI5F 2E27L 4G8GA 1UZ6F 2F53B 4KKLC 2BOCA 5J12C 2DBLL 4G9FD 4W4OA 4XVJH 1OLLA 1TJHL 2HJLB 2UWEB 3D0VA 3H9SA 4WTXA 3V4UH 3BQUC 3QPXH 4NQDB 4J8RA 2NY5C 3C60B 2DDQH 2BX5A 3E6HB 4RGNE 2VZ1A 4HFUL 1LEIB 4L8CB 4HXAL 3GM0A 3ZT5A 4NZTL 2GY7B 1UJ3B 1NEUA 2EC9T 1Q0XH 4FQHA 2V5TA 4NJAL 4A6YA 2D03L 4EI5D 4XWGL 5MI0B 5J57B 4PY8I 1KB9J 4UDTA 1FN4B 3GBML 2GCYA 1TENA 4NRZA 1IFHL 2VXUH 5ERWB 1TETH 4P2QB 3GMPB 3GRWH 5D70H 1MEXL 4XNUH 5DZNA 3MUGA 1VFAA 1N2RB 4OZIF 1PY4A 4K8RC 3HAEH 5CJ5A 1G9MH 4OCSL 1UWGL 4PJDF 3FB5A 4IOIA 4YXLH 3MLXH 3ZDYF 4LSTL 4ALAH 2X4TA 4GFTB 2GTWB 1T3FA 4ZDHB 4FQXC 3T0ED 2VTFA 1D6VL 3T65A 2JJTA 1CICD 5J6HA 1MRDL 2KDGA 2CXGA 4ODWA 3VXQA 3GNMH 2JCCE 1ZS8B 4PG9A 3HI5H 2B4CH 3LS4H 2AXFA 3OAYK 1T4KA 3BD3A 1GAFL 1T1WB 3EUUA 5J89A 3L7EA 4NO3A 5D7JB 5IMKA 2MCG1 2ZNXA 3G9AB 4QXUL 3UJIH 1LE5B 1H9VA 1GOGA 4NHCL 3WNLA 2WWKO 2Y4SA 3V0WL 5B39G 4YZFE 2ZOKB 3B43A 4EN3B 1YA5A 3ARRA 5D7JA 5I1GL 3DRTB 3JV6B 1K2DB 2EO9A 3DUSB 3C6SB 3O45B 1RZGA 4JFZL 4HS3A 1UB6A 2R8SH 4H8WC 4N0FA 3CPLA 4AM0A 1I8MB 3X17A 2ARJA 3O6KL 2R4RH 1NUGA 4L29A 3P77A 3VXMD 4OLXH 3O2VL 3DRTA 2CLZA 1JGDA 2R1WA 4LVEA 3IU3A 4XMKH 5ESVA 2VL4A 3D0VB 4R2GC 5F9DC 2XQYG 4G8EB 2AKRA 4MVBD 4NDMB 2GK2A 4ERSH 1YYMH 4FQXD 4XNYL 3VFUB 1UB5B 3MRDA 3WN5B 4I5BA 2CMRL 5BOPA 2QHLA 2HG5B 3BP5B 5C0GB 1D9KC 5C2UB 1YEGL 2I9LA 1EA9C 5B21A 1A6PA 3TT3L 1I8IB 1DDHA 4AEEA 1HHIB 4R4FL 5EFIB 1R3HB 4ZYKB 3QUYC 3TFKC 3VXOA 1BBJA 2ADFH 1TTFA 2YEZA 1BZ9A 4D2NA 3OF6D 1X5KA 4RISL 1P6FA 4NNXA 2P5WA 2HJKB 4P23D 5IOPB 3R0MA 4HH9A 3PQYB 5ANMB 5CGMA 4P5MA 1HH9B 4NQDD 1EJ6A 2P49B 3QIUA 4HSQA 4NWTH 3GSWA 3MNZB 1DZBA 3S35L 1G7MA 2A1WH 4Z18A 4CMHC 3JSSA 1T1YB 4JRXD 4X9HA 2NW3A 4JO2L 4CU8A 3KS0J 3IXAA 3SDXA 5ETUA 3PDGA 4S11A 4HUWB 5LG1A 3SE9L 2AI0L 3PABA 3L7FA 3MGTA 1OAKH 3UZQA 3H9YA 1L6ZA 1UWEL 4XI5C 5IB2A 5D7IA 2PTVA 3F7RA 2D31B 3QNXB 4OZHE 1AGEB 4JVUA 3VXUE 4PGDA 2Y06H 3EYOA 2DQGH 5IFAL 2Z8SA 2BHZA 3HI1B 1BOGA 2R1XB 1BD2A 4UI2A 1KB5L 4MJ6B 4OLVL 1A7PH 2VLKB 1T03L 2J8UA 2EECA 4CMMA 1XH3A 1S78D 5EO1A 5FUZH 4QF1B 2F8XC 1YEHH 4OBSA 4BA8A 1MFBL 5HVFB 1B0GB 2LABA 1IT9H 1I7ZB 4WFHD 2WW8A 5BZDA 5TDOB 3KPOA 3BPNB 4EIZC 1MJ8H 3UBXA 5HI5C 4RRPG 5CIPH 4X5WB 4MCYA 5SWZB 1N5YH 1I3UA 5CFHA 2YBRA 4DJMA 3QXDA 4YDLB 4KJQD 5LCVH 4WWID 2BNRB 4FQJH 1F45A 5GGRB 3OAZH 3H7LA 3QUZC 5CSZA 4OZGE 4KKBC 4ETQA 5DQDL 3RVWC 3WL9B 5I1CL 4R4NC 3GIVB 4XMLL 1KIUA 1Q38A 4LLWA 3OTTA 4PV9A 5M7QA 1J1PL 4Z76A 1N5AA 1RK1A 3HLAA 4K3DL 3V5DB 3RDTD 4OLVH 1MJUH 1KXVC 3CVHA 5AD0B 2JF1A 1CF8H 2HLFC 5IGXL 2QV2A 3CH1A 5AG8A 1AIFA 2X4NA 3DRQA 5I76A 1NC2B 3EYQC 3GSNB 4HIIB 2GSIB 4TQEH 4J3WA 1WIOA 4RBPK 1I9EA 4J3XA 4OCRL 1J1OL 1P6AB 4HAFA 1A3RH 3ZYOA 4LL9A 4LLQB 4DVRL 3HZVA 1BZQK 3VXSD 3FOMB 4UIKH 3R06B 4BQBA 1EVTC 4AL8H 2FRGP 3BJLA 1DBBL 4BH8A 2DQJL 3GHBH 2D9CA 3LN5A 3R1GH 4Y4KA 1L7TL 2GJ6E 4HGMA 3MRPA 3NFSH 4Y5XB 3U36B 5IM7A 3MV9A 3A6CL 1FNSL 4AENB 3ME0A 5ILTH 4PJAA 2BRRH 3MRLA 2AEQH 1DBJL 1S7WA 4IOFD 5ELIA 1G7LA 5JW4M 1DDHB 5C0BE 3I6GB 1OTTD 2CDEB 2Z9TA 3RUGE 5DGQA 4ODXA 1U3ZA 1VGEH 3NZHH 4LVNB 5JZ7C 4XNMB 32C2B 1PLGH 3VGDA 3ZHLA 1AR1C 2AQ3A 2IFGA 5JXEA 4FZ8H 3TPKA 2BFVL 5D1XA 4IRZH 1WC7B 5C0AB 1ZLSL 4QRSA 4BZ1L 5H2BB 3D39D 5F1NA 1U8LB 2I25N 4PJGF 3SDCA 5E1HB 4DGVL 3QXAA 3QHFL 3BUTA 5B3JF 4OI8A 1T2XA 2W65B 1GGBH 1OW0A 5GSRA 4ZXBD 2N4IA 1LD9A 5LXGH 3ULSA 4EQ2A 1OM3L 3S3JA 4KTDH 5E9DA 1SJHA 5AAMA 2DDQL 3BVNB 4JFDD 4BKLB 3ULUH 1W8OA 1FL5B 4NYLA 2NCMA 4NO2A 4DW2H 2XWTB 1U3YA 5GS0D 4E41A 5JW3H 1SJHB 5FOJA 1HOCB 4HF5L 4L4VD 2ID5A 3P30H 3E2HC 5D96C 3WKMH 1MH5B 3OKNB 1VEOA 3W5NA 4HLZG 1UJ3C 4YJZL 1XCQA 3VGAC 4A2MA 35C8L 3UC0H 1KSRA 4LCIL 4ONGL 5C8JA 4EOWL 3AAZA 5DYOA 3T2NH 3OXSA 4P46D 1IILE 5I1KH 3SGDH 4PJ8D 4KPHL 1O7VA 4I0CC 2O61B 1ZHBB 1JGVL 4GT7A 1NFDA 4ODTL 4JDTH 3QDJA 3SQOH 3VCLB 5C0AE 3DETC 1R24B 2ICES 3KLAA 3MA9H 5EZJA 1FZKB 3RWHB 5E5UB 2YUVA 3EHBC 4GW4A 4XNXL 3RUGB 1LP9A 3B9KB 1H5BC 3MCG1 3ZMRA 1AXSA 4QXUH 4OT1L 3I02A 5ILTL 2Y1VA 1ERNA 1U36A 3RL2B 4BZYA 3V2AR 3MBXH 4MS8C 4KU1A 1S9VA 2J3SA 5D2NE 5CD5C 1MCDA 4RA0C 2A74B 1QFWM 3GSXB 3IKKA 5CGTA 4NKDA 3QH3B 4CUCA 2MQ0A 1HWHB 3DYPA 1AC6A 4YHKH 1RK0A 5IWLA 1UWGH 5KZCB 1FGVL 5EH1A 4JHWL 5EO0A 3KPQB 1IC5H 3G6DL 4YBQD 2OQJB 3GMOB 1BVLB 5CCKH 3DWTA 4LLMB 4YHML 2BNQB 4LSSL 5F7LB 2C7UA 3OG6B 2EH7L 2XTJD 2YKLL 3NGBC 4PJDA 3BN9C 3O9WA 3NCCB 2E8ZA 4HFUH 3WIHH 5HGDB 4JZOB 3KPRA 4LLYB 3ZE2F 1XEDA 4ODSH 4DGYL 3D9AH 3JVGA 3CD4A 3D85B 3RJQB 4WI6A 4MNQE 3FFCB 1FZMB 3KYNA 4J6RL 3NZ8B 4N0UB 4OLUH 4Y1AA 3ZKMD 1IE5A 3DMMD 4HT1H 3CDGB 3V7MA 1AFVH 1PW3A 3MRNB 4HS6B 4IMLA 4E41B 3AB0B 2FHCA 4X7TA 1FV1A 1DQJA 35C8H 4M1CD 1T6WA 3NN8A 4TPRL 4UQ2A 4S1QL 1KN2L 1CYGA 1J0YA 1WBXB 5I0ZA 1KCKA 1QLRA 3GSVB 4OF3A 5CD3A 4HUUB 4ZO9A 2FIKA 5F8RC 3P9LA 4KK6C 2ICEB 4OGXH 5CILL 1ZVYA 32C2A 5TDNB 5D5MB 2VDMH 5E5RB 1FAIH 1FRGH 4GBXC 1KNOA 4XBPB 2Y7QA 4HKJA 4XNYH 5E08L 2MFNA 2E7LA 3MYJB 3MRMA 5DD6B 3O2DA 4JFDB 4LLAA 3QA3B 1M7XA 1P4BH 4Z9KB 1A14L 1JZ7A 3S4SG 1SJEB 4PGDB 1LP9B 2H1PL 4U6XB 3Q0HA 2ZCKH 3QI9D 4KQ3L 3FQRA 4XC1L 5I9QB 4OIBA 3UMTA 3HUJF 5KSBA 2FGZA 1KTRL 4QGTA 2X4SA 5JIHA 1JGDB 1ZLUH 3NCYS 3MR9B 5IF0B 5F6HJ 1MCBA 4O2CA 5HYQA 3RIAK 2J8UE 4U1JA 5FHBL 5AEAA 3MRQB 1IJ9A 1K4CA 1UM5L 4G43A 2VN7A 1WZLA 2Q8AL 3MJ8B 3HC3H 3QEUA 2JK5B 3IFNH 5D4QA 4M43H 5E2VH 4XNUL 4ODWB 2DF3A 2R69L 4U1JB 2F9BT 4PG9B 1INEH 2AXFB 5FA3A 5EUOB 4WNQB 5FGBC 5F9WC 4Z7VB 2EZ0D 3V5HA 3CFKB 1T1WA 4PGBB 1OHQA 3BQUA 1H3WM 4KXZI 4Y1AD 3U7WL 5D7IF 1H3PL 4RISH 4BK4A 4JHZA 3CFIC 1UXWB 3CMGA 1H3VA 1QR1B 2RCSL 4YGVA 1ORSA 2D7OA 2CJUL 3O81A 4X8JA 1ZTXL 1EV2E 1U8PB 2B1AL 4AEIH 3DV4A 2R23A 4Y5YB 3VXMA 4X98B 2FB4H 4LCCA 2OZ4A 1U93B 1SVCP 5F96L 2XNAA 2V2XB 3TVMA 5FV2A 5KS9B 2GTZB 3LZFH 1XGPB 3V6FA 3BW9A 1VA9A 2VE6B 4YIQA 4XPTL 4ZUSB 5ITBL 1XIWC 2YZ1A 2X7LA 1T04B 1TJHH 1UB5A 3RBSA 5I19L 5CWSA 3RWFA 5I73B 3KWWA 4P2OD 3GO1L 4JFFE 4PGCB 4B0MM 1SMAA 4PRHE 1UH3A 2YPLB 5D71L 3AMLA 3DLQR 3DXAD 1HIMH 4GKNA 5CZVL 2NY4D 4LNRA 4YFDB 1MY5A 3PWVA 3OKYA 3BEWB 1EMTH 1FYHB 1VB9A 3IDMA 3L9RB 4IRJC 4ODSL 5F1KC 3PDOB 2MCPL 2UUDH 2R56H 1B2WL 2J8UB 1S7SB 5EZLA 2BVEA 1NEZA 3GI9H 1JF1B 1PLGL 1QFHA 1BGXH 4MXQC 4YHZL 1D5XB 1RZFH 3K46A 1JFQH 3BZFA 3BRFA 3L3DA 5MEPB 1S7SA 1FCCA 5EZLB 3OBAA 1KLGA 1UA6L 1J11A 1YMHA 4WRLA 3BN9D 3SQBA 2EE6A 1CFTA 2OJZH 1CLZH 1YYLL 2OR7A 5EOCL 3WD5H 5C1MB 2OS7A 2KKQA 2ITCA 3GMMB 4MZ2A 1WAAA 1XR9B 1IL1B 4KTEH 5ETUB 4KC3B 1AKJA 5C0JA 2BERA 5DJ8A 4ZUWA 4XZUB 4NZDA 4K2UL 3IDGA 4I77L 4NO0B 5FECB 4KGLA 4OZFG 4XX1E 5ITFB 3VXME 1QA9B 2HVKB 2CO6B 3UTSE 4BKLA 4M1CC 3O8XC 2DMBA 1ZEAH 5EPMB 3OGCA 4EI5C 3QP3A 1LO4L 1AD9B 2XQYK 3VD4A 4TULH 5C0ND 1F4WH 1N59A 2HYMA 4UAOB 5J3HC 1WCBA 5E2JA 5F6IC 4XP4H 3MRGB 5CSBA 3P4NB 2P5WE 4HIJB 5JA8B 2G9HB 2Z0BA 2CRYA 3RA7H 3QDAA 4XXDA 1CCZA 4GLRH 3U30B 3HNVH 1G7HA 4K94H 3RX5A 3IDIA 2FR4A 4XVUC 5M95B 2Z4QB 3LCYA 4TQEL 4HDIA 5F7MC 4L29B 3WS6C 5L8JB 2EEDA 3JUZA 1W72H 1G0DA 1C5DA 2GEEA 3HE7D 1OGAE 2VIRA 1HK6A 5FYKH 2JTDA 1II4E 4Y4HA 5KVMC 1PG7X 4FXKA 4YHOL 1NLDH 4YHYC 2G5RA 1KFAH 4GKSA 3SY0B 4F7EA 4G6FB 2VDNH 4HIEA 3KPMB 3TEUA 3X3GH 3L1OH 1WFOA 3QFJD 5IFJB 1AE6H 2O5ZL 2B0SL 1T21A 2E7BA 4JM4H 1FZJB 3MLSL 4P3CL 3FZUC 5J3HD 4ZOAA 5C09E 5ESAB 2C3XA 3F7YA 4UZGA 4LHUD 2AEQL 3UTTB 1RZ8A 5ICXA 1A9EA 4TUJA 3BZ4A 3S34L 1FVDA 1U91A 4YH6A 4YK4B 4CL7A 1ED3A 3STZA 3SPVA 4P5MB 2C4FT 2WIMA 1TJGL 3I6LD 4N0UE 3SGJA 4PJ8C 4G80B 1T83C 1QNZL 1IQDB 1MVFA 4DVRH 2WBJD 3AMKA 3C08H 2XZCH 3T4AA 4OB5H 3C5SA 2IADB 1TETL 5I74C 4WWKC 1P7HL 4JCMA 1UCBL 5KSVA 2PXYC 5KBNC 4ZTOH 3T3MF 4X6CF 2Y9RT 1FV1B 3TA3C 1JGEB 2ZKHH 5B8CC 5C0BD 2EYSA 1WFUA 1MF2L 3VH8A 1KCUL 3CFCH 2FZ3B 2NX5A 5L7XL 1C1EH 2W9DH 3WHXB 4ZSOB 2ED8A 4JDVB 1KT2B 2CDFB 4KHTH 4GMTL 5FYJD 3HE7A 5KG9B 2ATPA 5EO1B 4NQUA 4DKEL 1S9XB 3MJ9H 5D1XD 5F88A 5KN5B 2JIXA 5JA9A 1XFPA 5CJXC 4R97C 4M61B 2KBGA 2YR3A 4ZSOA 5IVXF 2X05A 1H3XA 1F4AA 4JFDA 4NM8L 4HH9B 4FHBD 2Q7NA 3LD8B 3LKSA 2YPKA 3OKKB 3LIZL 1XCTA 4HWZB 5EU5B 4MA1B 1AO7B 3P11H 4RQQB 3RKDD 2HWZH 4CBPA 1FAIL 4H26A 4U1NA 5J8OA 2DRUA 3QIBC 1OP3K 5T1DL 3SDCD 2ADIB 4DWHA 1WQVT 5L9DL 3MR9A 4G5ZL 3OV6A 4P46A 3NIGF 1QSFE 4HD9A 3PWNA 1KB5A 4TSCH 5C71A 1WTLA 5F3HB 1N59B 4M4PA 5EA0H 3MUZ1 4R4BA 5K9QI 3BKJL 1MAKA 3K80A 2FBOJ 3JTTA 4ZOBA 4F57H 2HH0L 3Q1SL 3VXSB 4MA1C 4MA7H 3TJHC 3NPZB 5E5MA 4JY5L 5ENWA 3CVHL 5CP3A 4WHYG 4X4MA 4HK3N 3EYSL 1ULVA 1CDHA 1BOGB 2R1XA 1FLRH 5D1QD 5IESH 5JHDE 4WO4B 1RZIA 1EHAA 3HZVB 1ZTXH 5F7KC 1CGXA 2IANA 4RFOL 5FYLH 5H94B 4ZFZA 2AGJH 3DYMA 3IVKA 1YY8B 1NGZA 3FN3A 2X70B 1UKQA 1A7QL 3GJFK 1TDQA 3U9UB 2EDTA 1XF4A 3EZJB 1XF3A 4UQ2B 3TO4C 5C0CA 3S37X 4YDKH 2NY0D 1QRKA 4JM2F 4NKDB 2AW2A 4APQB 4YPJA 4PJFB 5C0AD 2EIDA 1YEEH 2VUOA 5DD0H 4ZO7A 3L6FA 3D39B 4NHUA 4OLXL 3MBEB 2HRLA 3L3IB 3IAGC 2FZ3A 3DO3A 3QHTC 3SE8H 4F7PA 1Q9WB 4JAMA 2C26A 1P5VA 1P7KB 3RX7A 1BBDL 1N5AB 3V5DA 3V8OA 1I3GH 5SX5H 4D9RD 1YEJL 2NZ9D 1LO2L 5CGYC 1JHLL 2BHUA 1B6UA 4ZD3H 3PWUB 1S3KL 2YPLA 2ZSVB 4OZIB 4YLQT 1R3IH 4XMPH 4X4XB 5FKAA 4Q6IC 5TDPB 1BLNB 4PJAE 1HXYB 3KPSE 3QWRA 2OL3H 5TE7H 1EMTL 4NBZB 5MEOB 2K1MA 4Z7WA 1IM9B 3B2UC 3QRGH 4X6CE 4JFHD 2YXFA 5FKAB 3VXRE 3BZFB 4U7MA 1IARB 5KSUA 2ADIA 1NFDF 1NBVL 4GAJL 3W11D 4HS8L 1FVCA 1E6JL 3UJTH 5ID0A 1H0DB 2RAMA 5B38B 2AJYL 2IPUG 5FGBA 1BQHA 4OZFA 5D5MA 5E7FA 1U95B 3CFKA 3RWGA 1NCWL 5J11B 3TCLB 3U4BL 1QSVA 1QSED 3WS3A 5FYKE 5EZIH 4LK4A 5DDHB 1RHHA 1RHFA 4NO3B 4NQEB 1F58L 3ARXA 1G0YR 3MLZH 1X6LA 3KPPA 4UQ3A 4JY4B 1EAPB 3S36H 2QL1A 3ZLQC 3SDCB 2LE9A 1IEBB 2DQGL 3IVKB 5F1NB 1S9KC 3PHOA 4PRAA 4CU6A 2R2CA 2ADJB 3I9GL 2EKSB 1KN4H 1S5IL 5CEYA 3BEVA 4P3DB 4ZAKC 3M8OH 3IXTA 4KQ3H 2CH8A 5F9OH 4ORGB 5DMKB 2NQCA 1KCLA 4PRPA 1ONQB 2QQQA 1IM9D 2CIIB 1PSKL 1YEJH 5E8DH 5FF6B 1E4XI 4R96A 5EC1B 2IH1A 5DJZB 1P2CB 2HA1A 3CZJA 1T1XA 5E6IB 3CSGA 1HQ4A 1OT1A 4KVNH 5HYFA 5IVOA 4E0RA 3UTSD 1BJ1H 1RJCA 5I1LB 2O61A 2DD8L 4I2XA 4FNLH 1TCRB 2FBJL 1RQ5A 3D6GA 3DV4B 4G8GD 2BVYA 5IW6B 5KANG 1CDIA 2BC4B 3TJHD 2VNCA 1JWUB 1UENA 2F74A 3VA6A 1AGCB 4LVOB 3SJVE 1XR8B 2GAZB 5E00A 4RMSA 4IRSD 1I7RB 1LO0H 3MNVA 3ULUF 4I77H 5I66B 2IANE 4WU5A 5I1EL 1WVZA 3JUYA 4WI3A 1I85C 1ZT1A 3NCYP 4P2OA 4LSPH 5ACZA 1P69B 2VDQH 4R7NA 5GGSA 4RGOH 4OD1L 5CP7B 1MJ8L 1KBGL 1NMAL 2CSPA 4ONFL 4MMXC 3O3EB 1OAXH 5DRNB 1REIA 5JHLH 3B3IB 5IQ9A 4R7NB 5GGSB 2OZ4L 3LN4A 5E1AB 4WFHE 1MCWW 3GSXA 3H3KA 2HT3C 1A21A 1K85A 5TFSL 4L4VE 4XH2A 2X1QA 5DEFB 5C0RL 1HDMB 4I0PC 2WV3A 3T77A 4F58L 2DB8A 5LWYH 3U0TA 1HXMB 3CFCL 2YD9A 4KKNA 1ZEAL 4KTDL 1HYRC 4PREB 4X6BB 3VG9B 4EZMA 1SJEA 1T0MB 1Q9KB 4WFFD 3T1FA 3V0VA 1QFWH 5EU6A 2FATL 3NAAH 1NLBH 1GC1C 3SGKC 1XR9A 2L4OA 1ZKAA 3D85A 4G8FB 1PEZA 1KBGH 1KPVA 3NFNA 4L1DA 4OFKA 5MENA 4YDVA 1OT2A 4K3GA 3IAPA 4YO0A 3MRJA 4HKBA 3WIIH 4GAGH 4V1DB 2DQJH 1BFVL 1RUPH 4RGNC 3OL2A 4LP4A 5I8EA 3VXPA 4NIKB 1WCQA 5DGRA 3HCVB 4EI5B 3GSVA 1GJIA 4S1SH 1UACL 3MRCB 3EDFA 1JE6A 4QRUA 4I13B 3Q5OA 4Y0GA 1VPOH 2W0PA 4QRRA 3V4VH 4M1DL 2C3VA 3GSQB 4FQ1H 2JCCB 2SEBB 3LKRB 1U3HC 4OSUH 7FABL 3KYMA 1X4YA 5C09D 1WFNA 4IM8A 3BP4A 5DRWB 4MDJA 4I3RH 4O2FB 2WBJC 4MA3B 5FFLA 1HNFA 2PYFB 1JWSA 2VSCA 3CDCA 4K9EH 2Y5TA 4K7PX 4Y4FD 4ZODA 5FKPA 2X40A 1IEBA 5CIPA 3MV9E 1OB1B 4QYOA 1UGNA 5F7YC 4X6EA 4JFPB 4G6AC 3RNQA 3V52L 1VESA 4NO5B 1I7RA 5TF0A 2FNBA 1X44A 4ZFGL 4PG2C 1YY9D 4HULB 4LLDA 3QCTH 4LU5H 1D5MA 4RDQG 4D3CH 4WY7L 1OLZA 1ZLWH 4R0LB 2X4SB 5C6WH 3ARFD 5ID1B 2GTZA 3G6AB 2D2OA 1W2KT 5HHXH 4CNIA 5D7JD 3GSRB 5F72S 3U9PL 3U4EA 2CUIA 1IKFH 1J0ZA 1CXFA 3BSZH 4OFDA 2W92A 1A4KB 4NQSB 5HD8C 3QHZH 1T0NB 1U8IA 5C07A 3VMOA 3MX0A 3QDMB 3H3PL 3BKML 4GO6B 3IJYA 4H88H 1BIIA 1SHMA 1V7NL 4YHLL 1R3LA 2B1HH 1ZXQA 1MAMH 2Y5EA 4KJWD 1DBMH 1S7TB 2DJUA 1X9QA 2P5EA 1W0VA 3PWLA 5FOBA 2XZQH 3NACH 1KFAL 4PREA 4X6BA 3WUZA 1AJ7L 1EFQA 3L5IA 4YE4L 4ZTOL 1RZKL 2Y25A 1HCFX 4LRNL 2D0HA 5AYQA 3QUKA 3P40A 2YA1A 4ZUVB 5D7LD 4EVNB 1A7RH 2YUZA 5JNYB 2OLDA 5I66A 2Y07H 1YMHB 2HFFB 3QFJA 3V95A 4Q9QL 2VN4A 4XPGH 5BO1H 3FFDB 5JPMB 4GMTH 1BVKA 4X83A 5GGUA 2VRAA 2YPLE 5F97E 2IADA 4PJGA 4PJHA 1B88A 2HFFA 4I0PD 2V7HB 2Z35B 4J2XA 2EXYC 3DX8B 2Q3AA 2R2BA 2HMID 2GSGA 5IQ9B 1MCKA 1NUNB 3ZDXF 5GHWH 1J8HB 3K3QA 3BP6B 1K3IA 3DVNA 4I0KA 2P44B 4OF7A 2Z35A 3VRIA 1WAAF 2UZIH 4NJAH 3BP4B 5DRWA 1HDMA 3T77B 4OIAA 2Y5TB 4KRNA 2VLJD 1V3JA 1YDPA 3MV01 4NZTH 3REVA 3ORJA 3L5WA 2J6EL 4QHNB 5JORB 1DN0A 2PETA 3OKEA 2ENYA 4OLEA 4U31A 3LB6C 1AR1D 5DR5L 2GJJA 5GGVL 5JORA 1RPQA 2NNAA 1MFNA 3LV3A 3H6JA 4QF1A 1KIPA 3LPGA 3OXRA 5DC9B 1QLEH 5KOVC 2VDPL 1WTGT 1C8PA 4BSVA 1FP5A 3IDXH 3INUL 4MNGE 3D3VB 5T1KD 3IDYC 3MV8A 4YFLI 1QFPA 5DJ8B 4HT1L 5F1IB 2HKFL 1DBML 4U2ZA 4NHUB 3I6LE 2EYTA 5K59E 1K3ZA 1C5CL 5SWSE 2X9WA 1YEKH 3QUZB 4HWNA 1T5WA 2J88H 5LWYL 1AI1H 3HG1E 5CUSL 5F93C 4F3FB 3B5HA 1HNGA 1Y18A 3PWPB 4ORZC 1KENL 4U1KA 3TZVB 4EXKA 1EO8H 4ZS6C 3ARFB 4XMKL 2AK4A 1GPOH 3ARTA 1SYVB 1RSFA 1M6OA 1JZ3A 1YYML 4Q6IA 3DMMB 4HQQH 1FPTH 4MD0A 2X9YA 1FNEA 5TQ0H 2VSDA 3KPLB 1E4KA 5GRYA 3NH7H 4L8DA 3HAEB 3HPLA 1IC4L 3MCKA 1IGJB 3MRKA 4JFDE 1YY8A 3FMGH 2XN9A 3NMEA 3ARBA 2P7TB 4NQED 5JW3L 5DHXB 4HPOH 3PGFL 1J87A 1SY6H 1DVFD 1YY9C 5EBLB 5F7DA 4M02A 1WGOA 2CO7B 2I26N 4L3CA 5DF0A 3ARFC 2CXKA 3QNZA 3M17B 4P59H 2Q8BH 4BSWA 3FAXA 4X7SH 3OKLB 3LZFL 4GH7B 1KC5L 4HIHA 4POUB 5CEZL 1Q9WA 2VXSH 3L5HA 1XGUA 5SWSB 3BKCH 5IV2A 1NEZG 3MROA 3VMPA 4X4YB 4K71B 5I15L 4HMCA 1JPSH 4WFGD 3HI6L 1UH4A 4ZAKD 4TVPE 1DJSA 3EO9L 5F89B 4NQXB 3OPZH 1QYGH 2E9IA 1BLNA 1FVDB 4XPFH 1OGTA 3E1F1 2PW2A 2AEIT 3S36X 1QOKA 4FFYL 4B53A 1CFSB 3G08B 2YPLD 1YN6B 4TUJB 1FIGL 1PFCA 3QIWA 4KKLD 2NY4B 4DN4H 1GRWA 3V5KB 4FRWA 4GJTB 4JO2H 4PRBA 3TN0B 5A3IC 4MD4A 1V3LA 4HMEA 5FK9A 4D0DA 4D94A 5I1GH 1GOHA 4PJ5B 5D7IB 2NTSP 3CSYA 1IVLA 1S7QB 1QPXA 1CLZL 1YYLH 1RJLB 4IRSB 1QFWL 4XPTH 4AY0A 2CK0L 3UYPA 4S10A 4WHDA 1N3NA 1CLYH 4XPAH 2FL5B 1BZ7B 3ABZA 2HH0H 3Q1SH 1FO0A 3DHJA 1N0LA 3EGSB 3WS3B 1TQCB 3VDBA 1OTSC 2WWKT 3ZYZA 2DQDL 1G1YA 1RAMA 4ZFFA 3B4NA 1JJUA 3ISWA 3QEQD 5B39B 4H1LB 3NFPB 4YDIL 3SE3C 1D6VH 1ZS8A 3BPNC 2VWEE 1FC2D 4NUJA 2VQ1A 4NO0D 2OSLA 4RMTA 3UPAA 4UTAH 2VDLH 4LIQE 4XNZC 2EIEA 2ZUXA 3ROLB 3EFDH 4WW2A 5J13B 1FAKT 5KVGH 2ARWA 3LQMA 3RPIA 2W60A 4PD4K 1IBGL 3SOBL 1IZKA 1U58A 4PBVC 4UIMB 4X5WA 2VDRL 2FBJH 3MV7A 3ZL4H 5H37H 1BFOA 4PJ9B 2ZG1A 1RJYA 2H8PA 1ZHNB 3NPSB 3VFTA 4N0FB 4EI6B 3GI8L 3TWCL 1JWMA 7FABH 4HBCL 5DRNA 2HFGH 3X14B 2DQIH 4HJGB 1IGYB 5T1MA 1A7OL 4OFYA 4RAVB 5ID1A 5BQ7B 4WUKH 5GJTL 5HVHC 3X11B 2ZCLH 1S3KH 1YQVH 2VISB 3LEXB 3N1MC 5MP6L 3HC0A 1I4FB 2X5PA 2ED9A 2W91A 1P7KA 5D6CA 4G7YH 1UM6L 3QBTB 4N9OB 5F9JA 4WTZA 3QRFM 2FEDD 3OF6A 2X42A 4V2BA 1IFHH 4Y2DA 4PTUA 1BOYA 4HIIA 1JYXA 1CVSC 3D69B 2F58H 3ARGB 4TULL 5DD3H 1N64L 1CFSA 3G08A 4M1DH 1JZ2A 43C9A 3MRKB 1MIML 1KTDA 3G5XB 4M6OH 4U6HA 4HG4J 1RUQL 4L8SA 3PIQB 2G5BA 2JJSA 5FO7A 4G9FB 1FGNH 2VZ3A 3MLXL 4FTVA 4OZHF 1OOAA 1R5IA 5FDWA 1J0HA 3PXHA 4AH2B 3PQYA 4X6FA 4FFWD 1MQKL 2BZDA 4ZUUA 3TGXA 3ARVA 5GRXG 1TVBA 2NY3D 4LLVB 2FX8L 1OSZA 2VDOL 4KY1L 4W6YB 4K8RD 5KW9L 4P5KA 4HKZB 5AZEH 5GSVA 3WIFB 3DBXB 4KUCF 4KHXH 5LXGL 5CBAB 4ZOCA 1NCAL 4XP1L 4ZMAT 4KJYB 4QTIL 4PJXF 3NFPA 5K9OB 1RZ7L 1T66C 4XVTL 5FGCE 5IW1A 5KAQF 4BK5A 1MSPA 1F11B 4LF3A 4DN3L 4B41A 2WBJB 3QNXA 4UINH 1U8LA 3NIFE 4O4YH 3IU4H 3HPJA 4R3SA 3GMRA 3EYOB 2VXVH 3VH8G 3TBWB 4HIXH 3W81A 3FO9B 4FN0A 4GG6B 4HKXA 4HZAA 5DI8B 1BD2B 4MA8H 3UTPD 2ZSWB 5DSCB 3L5WB 1VKXA 2AXGB 2IFFH 1KN2H 5T33H 4FXGB 3FOLB 3O11A 3FB6A 5GRWA 5I19H 4CNIB 1IAOB 4P4RA 4NKOB 1BECA 3Q5TA 5BS0A 3KAAA 1J88A 5KSBB 5FUCE 1CG9A 3VXPB 4MCZB 3C8DA 3SKOA 3F8UB 5FDYA 3VMNA 3KR3L 4LVNC 3BKCL 5HGHA 1HOCA 3SDXB 3LEXA 3TIDB 3QG6A 4TUKL 1ITBB 3MUJA 4PY7B 4S0TD 4C55A 3MRQA 4LARL 3CAFA 3PG2A 4NT6A 5A2LH 2K7QA 3AS1A 1MRFH 4M1GL 4Y5YC 5F9JB 1U8KA 5IFHH 4MB5A 3O4LD 5IB3A 3VXUA 3T2NL 4Z95H 1N64H 3C9NB 4LGPB 4ZTPL 3ROOA 1HSBA 2IG2L 4JO4H 1VFOA 3HC4L 4OZFH 3VWKA 3KJ6H 1XT5A 1PGRB 1GGIL 5HYJB 1F3DJ 2H6PB 2X89A 4LAJH 4KXZH 1CI5A 5HHOB 1I3VA 3O8XD 5BCAA 1T6VN 5HYEA 2PO6A 1B4JL 3VXQB 5D1ZD 5FCUL 3CU7A 5DXWA 5DMIL 1FG2B 3TNMA 5B8CA 4Y4FA 3GUTB 3DYOA 4WGWB 4KTEL 4WCYH 1UT9A 5CEZE 1J05B 5TE6L 2R23B 3ZTNL 4NZRH 4XTRC 5BW7A 3C6LA 3RGVC 3UYOD 3HR5A 5DK3A 4QHKJ 5KAQG 1UQSA 3LVEA 1ZLWK 4Z77B 4P5KB 3GIZL 3V6OA 2H41A 2BVPA 3PGDB 5C07B 3C6SA 5HYSG 1ND0A 4M8QB 2R8SL 1A64A 5D1QB 4AM0B 1I8MA 3QPQC 5I9QC 4OM0H 3ZE0F 2XWBB 2R0WH 5TQ0L 1D9KA 1ZGLA 2A83A 4OGYH 4K7PL 1FFOB 4WHTB 5CJQH 4MAYD 3V9FA 1F5WA 5E70A 5KVEH 4JRYB 5D7LA 3IDNB 5B4MD 1Y6NR 5DK2B 1TZHB 2XFXA 2OR9L 3KPSB 4YXHH 2BJMH 1VKXB 4M9OA 3EO1B 2DLEA 3PE9A 5D7KD 1AC0A 4JKLA 5EZOH 1GGCH 3IT8D 5T5FH 1T22A 4U0RC 4FZ8L 4LQ1A 1UADC 3QJHB 4QOKA 3RVVD 2ENSA 3PP3K 3SDCC 2OL3A 4FFYH 1VFAB 3WDIA 2F74B 4TTGA 5CS7A 5KTEH 3AU1B 3FB5B 1JI2A 1MCJA 2CKBA 3VFVA 1JN6B 4HKBB 4I9WE 3AB0C 5FUOL 2ICEA 1PKQB 3DURB 1BJ1J 1RMFL 5C9JB 3D39E 5H35B 1OM3H 3ZKQD 2NW2B 4PB9L 3SGEI 2BDNH 2DQCL 4CGTA 1JNNH 5CHNA 5I1IL 4K23H 3EYVA 2I24N 1F3DH 1E27A 1AGFA 3GHEL 4TUOB 4RZCA 2GJ6D 1MLBB 4XPFL 1GGTA 5E1AA 4HGKC 1F11A 4LF3B 2D3VA 4F9PA 1Q0YH 3ETBF 1R6VA 3NGBB 1X5LA 1EH9A 3R8BB 3C6LD 2X4RB 5TQ2H 2VZSA 1JHKH 1H8NA 2E7HA 1Q9LB 5CIPB 1DE4A 5E2VL 3TBTA 4Z7UF 5JQHC 2GT9B 1EPFA 4NFBA 2A0LD 1UZ6E 4IDJH 1F6AA 4MAYB 5FHAL 3RTQB 4JM2B 2FX7H 3DTXA 3C09B 1W72L 4P4RB 5EZIL 5T1KA 2OI9B 4JN1L 1KACB 4AIZB 4L9LB 4ODTH 12E8H 4P46C 2G75A 2BSTA 1I3RA 4RMWA 1HI6A 5INDA 1R5WA 3I3EA 2X1OA 4G43B 4Y19D 2GKIA 3BT2L 4WJ5A 3U6RA 3I50L 1IQWH 1M71B 2ICCA 2MJWA 1RUKL 4JEGB 4EIGB 1D9KB 2F54E 2Q20A 1V7NH 4FFVC 1SY6A 4NM4L 2VAJA 4HS8H 1R5WB 1IAMA 3PWPA 2ICWI 2EKJA 3TN0D 4EI6A 1YECH 3HUJB 3SDYL 4MD5A 2DM4A 1MI5E 5J6HB 4LLUB 4M9PA 5E9DD 3RNKA 3PWLB 1B3JA 1JNHA 3MLRL 4F33B 3KYMB 2VAAA 4LPTA 1OAXL 1YUHB 3FFCE 4PUBH 4U2YA 1GZPA 1JTPA 4NUGL 3KLSA 4PJBB 4KI1A 3ZKND 3RWDB 1NGXB 4M3JA 1MVUB 1QSFA 4S1RL 3MREA 3QEGH 1XGPA 3V6FB 4P9ML 4DGIL 2XG5A 4ZSOE 1IGML 3QFJB 4AG4H 3RUGA 2AV7A 1NAMH 1U6AH 4HH8A 2ZUTA 5F6HI 2B1AH 4TYUA 2H32A 5C7XL 5I1HL 1OAKL 1A4JB 1U2HA 5L2KD 2R1WB 3QDME 5CKAA 5BRZA 4LU5L 4N1EA 5ESVB 1FE8L 2XWBA 1Q0YL 1DVFA 2VJXA 4G8EA 3U46B 2OI9C 5F9AC 3PWVB 1EEYA 1HZHL 3VFMB 2X4OB 1KG0B 3GMLA 2GUOA 2YRZA 3RIAF 2J8OA 3PDOA 5FEBA 3IYLW 1DSFL 4QXGL 4QY8B 1E4WL 4UU9B 5CD5D 2X4OA 3EO1A 4M43L 4DK3A 1U9KA 3B2VL 3O6FB 2EH8H 1OGTB 4NGHL 2C7UB 3P0YH 4TTDD 2PTTB 5EFIA 4DN3H 2NX5B 3B9AA 6CGTA 4JG0L 3ZDXE 1EAPA 2VLJE 4IIQC 1RUML 4LCUB 3PL6C 2NLJA 2ZOLB 2JE8A 4OFIA 1D6EB 3EJJX 2NXZD 5TF1H 1KTLA 3K1DA 3BKYH 2XN9E 2MOVA 1LNUB 2WMPA 3CDGA 4JFHE 4R4FH 2XTJC 5F7HA 3GSWB 3MNZA 4JR9H 4Y5XC 1K5NA 2JIXD 3WFDL 1QZ1A 3SGDI 2VZVA 4XC1H 2W59A 1B4RA 2X1XR 3WNPA 5J7CC 1KPRB 2OJZL 4XPGL 1SM3H 4NWUL 5BVJB 3KPRD 4K3EL 3RTQD 1I9RL 1AHWC 4U0RB 1QO3A 1KCRH 3RIFK 5DWUH 1VFBA 4WV1B 4YX2L 4PB0L 2UWEE 1FL3A 2WINB 3P4LA 3QHZL 4OM1H 5J12B 2QQKL 2IAND 1J0KA 4ESKA 1EXUB 1AGEA 4UT9L 1YC7A 3BPOC 3V7AG 1KNOB 2NY6C 4BFIA 2DIBA 1NCDH 4KRPB 2R69H 5FA3B 5ACMA 1HWGB 4ZPTA 4LEXH 3LQAL 3O2DL 2MTPA 4U6HB 1LEIA 1OAUL 3PWJA 3RAJL 4P4KA 3CU1A 4G9FA 1HYSC 3BIAX 3VFOB 4OTXL 1KCVL 5CZKA 1EVUA 4L9LA 4I3SH 5DMGC 4FQHB 5DUPL 2E7MA 1L7IH 5TGBA 5DD3L 3O3UN 4WHCA 4OCXL 2JJTC 4FXKB 1TZIA 1KB5H 1CU4H 2XWJA 2VZTA 2P1YA 1MCCA 1AQDA 2FD6H 4R2GD 3RWHA 3IETA 3ARYA 4MAUL 3W9EB 4X7SL 1LK3H 4EEEA 3S7GA 5GGQL 2I60L 3MLUH 3OAYH 1CK0H 2AJVH 3E8UL 4RWYH 4XPBL 5C0CB 3JBG7 2JK5A 5D6DC 3EO9H 5E99L 5J56B 1N7ML 1CXIA 1DL7L 3RVTC 1PG7L 3OZ9L 3VRJA 4APQA 3WNNA 5F71A 3BOVA 4YHYB 5I15H 3IKCA 1UM4H 1Y18B 3LEYL 4KJPC 4S1DD 1NSNH 5F44A 1RZJH 4NQCB 5IK3B 4IJ3B 4L4TD 4MA8L 1E4XL 3FRPG 4F3FA 4X9FA 4B7LA 2RBLA 3ZKSD 3JWOL 1T2QH 3D25B 1T66D 1ZGLB 2CQVA 2ZUYA 1GC1H 1JIBA 3TO2B 4PJHE 5IJKC 5IQ7H 3SE3A 1HYSD 4X8JB 3QNYA 3WEXB 3JWOC 1JRHI 1EERB 1U8PA 4V1DD 1OD9A 1WZKA 2FYYB 4ODHH 1BAFH 4PR5A 4WFGE 4NZJA 1FO0L 1MWAH 3ARDD 3CNKA 1A3LL 2H32B 2JELL 1F8TH 3GSUB 4MB3A 2P5EE 1WAAE 3O6FC 2D4FA 2W38A 4CJ0A 5ADOH 2FYYA 5DJAB 2P7TA 5D5MF 1SYSA 3RWEB 2DMKA 4WU7A 2KQMA 2VLMD 2ORBH 4JHBA 4NKMB 2A9MH 2QQKH 1JHTB 2F15A 5DS8B 1AKJB 5C0JB 2HFEB 4ZQKA 3VFGH 3QXVA 4PRHA 1A1OB 2FJHB 4KUZH 5L2JB 3WO3B 4S1DC 2VLLB 2YXMA 1YNTA 1TIUA 5C9JA 2P8MA 1XZ0A 3S9DB 4LNRB 4ZFOL 4PJEA 4KKAD 3D2UD 4JDVA 1KPUB 3TBWA 4JCLA 3G5YA 1LDPH 5JQ6H 5FKPB 5HDBE 4JDZB 4OLUL 5DJ0A 5DDHA 4J12A 4HUMB 1E4JA 1CXLA 5ADPL 5ALCL 3QUMB 4GAYA 3DX6B 1A22B 5K9JH 4ODVL 4LRIC 4APQC 1A6ZA 1K9TA 2HJKA 3MJ9L 5JXAH 1U8OA 3HFMH 4EUPB 2C3GA 1UM6H 1OWRM 5IHZA 3RDTB 2IC2A 1P5UA 3T08A 1GHFL 4HPOL 3FTGB 4QKXB 3ZHDA 4RFNB 2HG5A 5DMKA 3C9NA 4C83B 5IJKA 1T5XA 4BM7A 1QNZH 2Y6SD 5C0IA 4N68A 2E8YA 2EH7H 2YD5A 3P4MB 1CD0A 4Q0XL 4TOYH 1WISA 1YNLL 3KYOB 2OR8A 4ZXBA 1W0VB 2YD1A 2DTSA 5CJOL 3JTSA 4NFDA 3V4PH 4ODUA 1UCBH 3GHEH 3PF2A 1BAFL 4Y2OA 4TSAH 3CFDA 4PUBL 1KLUA 1ACYL 4PR5B 4KZEH 1G9NL 4A2LA 4LNVA 2MKLC 4Z7VF 1HH6B 4X5XB 5BXFB 1Q8MA 4NFCA 4OAWB 1TTGA 3QEGL 1CN4A 2YK1H 1T0PB 4UTAL 5CEXA 3WE6A 1UM5H 3QFJE 4QHUB 3BWAB 1CIDA 4AH2A 1X4ZA 1UA6H 2CUHA 1SEBA 3LKQB 1HEZB 4NKMA 4NQVB 1FLTX 3NN8B 1DL7H 4LVHC 4PJXB 5EWIH 1C5DB 2MMXA 1WWBX 2PR4L 4MXWH 3MLWL 3P0VH 2NXYC 2J8UF 5E8OA 3PWPE 1MJUL 3B5TA 1A0QH 5C0RH 4GXVH 1IKNA 5KVDH 3B9KD 2BOCB 4FP8L 4KJYA 3UEZA 3SBWC 5ICYB 3OAUH 1DQDH 3BRDA 3QEHB 4UV4L 1P4BL 3BDYL 1I7UB 1RUKH 2R0LH 1PKQE 4L3EE 3GBNH 3RWJB 1DVFB 4GAJH 3S3PA 2XIDA 3TH4T 4OCRH 1D9KD 3RU8H 4ZFGH 3BIBX 3QNYB 3MJGX 3CC5B 4I48B 1NMBH 1WT5A 1Q72L 4JJ5A 5TDPA 4LIQH 5IHUH 3C5ZB 1S7UB 5I75B 2DM2A 3WIHL 1U92B 3LV3B 4KHTL 1QYGL 4NCDA 1U8QB 3S5LB 3LDBB 1OCWL 1ZSDB 4OZ4A 5EU6B 2CKBB 3VFVB 4BFBD 1V3MA 3MRBA 4X6CA 4X6FB 3GJEB 4HCRA 4DFHA 4J7RA 3BMWA 4U6VH 4PP2B 5HY9A 4C83A 3S96B 4N0YL 4NKIH 1U6AL 5HGBB 4JRXA 4MWFA 2DKSA 5D2NC 3DX7A 2X6MA 3ECBB 3G6JB 3U36A 1EIBA 2XV6B 5HPOA 4DAGH 4JR9L 2ITDA 3LS4L 3S88H 4MJ6A 1AHWB 4XRCB 1FYTE 3U0PB 2CGRL 2X4RA 3BP7A 4LEOA 2GTWA 4ZDHA 3ILPA 4JRXB 5HYJA 1U8JA 3I2CL 3ARFA 1UWXK 2GJ6A 3O6LL 4HC1H 3WHE1 5ALCH 2GT9A 5DJXA 3TBVA 1SYVA 4ACPA 3CVIL 4MSWB 1DR9A 3UTZB 1OAYH 4P99A 5C07D 5HTSA 1YMME 4HK3J 4MCYB 2E3VA 3AROA 4QHUA 4UINL 1CFVL 5BJTB 1CFNA 1OP5K 3WFHA 1A6AB 1LWRA 2F5BH 3DSFL 5JZ7D 1TVDA 1JPFA 3ZSSA 3EAKA 3QAZC 5KVFL 2BCKB 3FO2B 1IC1A 3RWCB 3DECA 2B1HL 3H7BB 4Y8DC 4CVXB 4QHKI 3UC0L 2WANA 3MUGB 3UCRA 4BH7A 3MRLB 5K93A 2R0ZL 1NL0H 4B7IA 5DTFB 4NQSA 4KI5C 4U3XA 1P84J 4M62L 3OX8B 5MHSE 4HUVA 3KYOA 5C7XH 5I1HH 4E0RB 4OCWL 3WNOA 1P2CA 3LMJH 3O41A 4LKCB 1LO5A 1MI5D 3O4OB 3L3GB 1Y0LA 2LU7A 4GAFB 5E7BA 3VXUB 3VRLF 2BP3A 3ARBC 3DVIA 4LLQA 4BFGA 1CXHA 4OQTL 3GGWB 3FOMA 3QB7C 1L6XA 1QR1A 4P2QD 3GZKA 1ORSB 3TA3B 2MHAA 3KNBB 2P8PB 3E0GA 1LO2H 4WW1B 5FYJU 3UAJD 1GIGL 3MNVB 3CMOL 1I8KB 1VADB 3D25A 3HB3D 2YOCA 5ANMA 3WUWB 5L2KA 3MRPB 4HZLA 1IL1A 4NKIL 1DFBH 5HDLA 4R26L 2EO1A 3MV9B 4PTTA 4OKVA 3RP1A 1QVOA 2NR6D 4XP6H 2P8PA 4WW1A 5JPMA 1S5HA 2AEPL 1HH9A 5TJWK 2CJUH 3CPLB 1IGMH 5FM5M 2AK1L 1IGIH 2LAAA 3T2QA 5GRVK 2A6DA 2HFTA 1NLBL 4A6YL 3BP7B 2KH2B 5BRZD 3T0AA 3B8YA 3E2HB 1FFQA 4I9WD 4XT1C 4HWUA 4JPVH 1FFOA 4WHTA 5IBLD 4NQCE 4IRZL 1BFVH 1IAIM 3CXHJ 3TYFA 1MRDH 4V1DE 3P4NA 2PCPA 3FRUA 4IS6B 3FMGL 4WUKL 2EXWC 4QRTB 1F6FB 5IB5B 1ZLVH 1BIHA 4RCAA 1GAFH 3LRSA 1UC6A 4JM2A 3QDJE 5EN2B 1U42A 5HSFA 5MENB 3UAJC 4X4ME 5ICZB 1SY6L 4PLJC 1Q1JH 2G60L 1N2RA 1CL7L 5GRZA 3IRZA 1VDGA 5MEOA 2C5DC 4L3ED 3RRQA 2EDRA 4XCEB 3CFJA 5LAXB 1CICA 1BPVA 1YEKL 5ECJE 1ZHKA 5BZDB 4HFWA 1T7XA 1TVHB 2NY1C 3DURA 4MHHI 3VFWA 1QO3B 2E7LC 4AIOA 2YBRB 1MREL 4PJ5E 4HWZA 5IMOA 4HK0B 5CBEB 5FGCB 1T21B 1U8JB 4U1NB 4BZ2H 3AREA 5FO8B 4N8VG 4MDJB 4H25A 4O2FA 1GSMA 1CGUA 2WM0A 5IQ7L 3TBVB 3BFOA 5D6CB 2VQUA 1CFBA 4Y1AE 3K4AA 3QXTA 4LLWB 4NRYB 3ZE0E 3CH1B 3O9WB 4I3GA 4PJ9C 1ACZA 4ZUTA 5CGYD 4LLYA 4QWWC 4XVJL 3VFOA 2VDKL 3MV8E 4PIRF 1KOAA 5F9WB 3KJ6L 4OSUL 1HHJA 4ZD3L 5IWLC 4I2XB 3IDJA 3PJSB 4U49A 5EU7E 1RIHL 3RJDA 1JHKL 3MRHA 1G7HB 5D70L 3VFRA 5DEGA 1GC1L 1A7PL 3I75B 4MDIA 1ORQB 1T03H 2DQTL 4JKPH 3AXLA 1SQ2N 5TE7L 3JWNC 2YWYA 3NIGE 1RZIB 5L88H 3O2WH 3RKPA 1CGWA 2WQ8A 4LLVA 3DNKA 4Y5XA 3U6RB 3T04D 4IEFB 4HUUA 1JNJA 4FQLL 4P2OC 3LN5B 2O93L 4CADB 3KPNB 2V5MA 2IAMD 1X6NA 4PRIE 2EDFA 3W2DH 3IU3B 2C1OB 3D1MC 3SE4C 4WEUD 3NZHL 5AZ2H 3G6DH 5FM8A 5GGQH 2ZG3A 1BFSA 1GHFH 3FRUB 3G04B 4IS6A 5GS1A 1DEEB 2VAAB 4D9QD 2XRAH 5T1LD 4JZOA 1GGCL 5IV2B 3HTLX 4HJ0C 5GHWL 4PJFF 5GRJL 4P5TC 3LPWA 2HRPL 3VGHA 2JIXB 3VI4E 1GGUA 3DVGB 4Z7UE 4OIIL 2F54D 5T5NG 3MREB 5EU4A 1NMBL 4WI8A 2H45A 2PR4H 4KH2A 5JDSA 3VI3E 4LSRH 3C5ZC 2OR9H 2NW3B 4ETYA 5EU5A 5FHBH 1DP0A 3N50A 1PZ5B 3TBYA 3N1QC 4UB0H 4X0KB 2BNQD 1XIWB 1CD1B 3QI9C 1JRHH 4O02L 4NZRL 3TBSA 4ZAKB 3BX7C 4KUCD 2P4AB 1ETZA 1O7SA 2X4PA 1XGYH 4QT5A 1WWAX 4XHQA 3T4AB 1DQTA 5FK9B 2DQDH 4QRPA 3VFSB 1F8TL 1X5IA 1CD1A 1YEDB 2RFXA 1QBMH 4E5XB 4X9GA 4BJLA 4R4BB 1G7JA 5EUOA 1NGQH 3GK8L 2GHWB 3ZKXB 1PG7W 2X4PB 3P2TA 3H3BC 4PGCA 1R3IL 1UG9A 4O58H 3MO1A 1BD2E 1ZT7B 2Q6WB 4J23A 4AIXA 2DYPD 1MCPH 2A6JB 3OKEB 3KDMA 4DK6A 1ZHBA 4Z7OF 3FB8A 4PY8J 2Z31A 4GRLA 5D71H 4XNMA 3BDYH 4KMTL 1JPGB 4OFYD 5F3BB 3A0OA 3UBXB 4QRSB 1G6RA 9CGTA 1U93A 2VB5A 4JO1L 5C08D 5IROC 2CK2A 2YUXA 3QXDB 1KXTB 3P4OA 1IGIL 3D3VA 4FQLH 2LVCA 1A7OH 3NA9H 4HUNB 1CDBA 1UYWL 1LO3L 1NAKL 3QQNA 4JFEA 1P4LB 1GVIA 2IBZX 1NCAH 3IDYB 4JHWH 2W9EH 3K8MA 1R3JA 3M07A 5KVFH 4DCQA 5D7KE 1H5BB 3MOBH 3Q3GA 3EDEA 5E2TH 4N0CD 4NO2B 4X7FC 2Q86A 1T0NA 1U8IB 2BVQA 1E4XH 3DHMA 4OBRA 5D9SB 5CEZD 4OGZA 4RMVA 1IAKA 1R3KB 3UJIL 3EFDL 3RY6A 1JPTL 5DMGD 4AYFA 1N0XH 3TV3L 1LE5A 2BRRL 1DANT 3AY4C 5JO5A 2WBWB 5D9SA 2P47B 1J1XL 4JJHA 2IPTL 3RZCD 4H20H 5FYJH 2C4XA 3WN5C 5I75C 5EG6C 2FWOB 2DYPB 3CFEB 1KEGH 2CLVB 2R0ZH 1YEIH 1NC2A 3GSNA 3WKNA 3BXNA 4X6CB 5CSGA 5C09A 4JQXA 4YBQC 2AV1B 3VD5A 3OJMB 2AXJA 5HHQA 1KJ2H 3UZVB 2AKRB 2APWA 3CFEA 1H0DA 4XNQA 2RJMA 5C0FB 3Q6FA 1L9MA 4QHLB 1TQBC 4JFYA 3QDGE 2UY6A 3K2UH 5IIEB 1ADQL 4PJFA 4LSPL 5F7WC 4HWBA 5SWSA 1PDKA 3WIFA 5CP3H 4I8DA 4OD1H 5DHYB 3BDBA 5C0FA 1CGSL 5TDNA 1N5YL 3TCXA 1OAYL 2GFBA 1J0JA 4JG0H 3RWIA 3PHQA 5JQ6L 2A6DB 4PG2A 3OPZL 5JHLL 2XTLA 5DWUL 1C12A 4LP5A 1U8HB 5EU3A 3T2PA 5K9KB 3PWUA 5D1XC 4Z5RA 3G5VB 4PP1D 3T4YB 3DX9A 5C0NC 2XI9A 2DLFH 5JMOC 4AK1A 4Q2ZA 5JIPA 1A9EB 5HBBA 3O2VH 4HBQA 3O2WL 3IFOA 1BM3H 1A6VH 3QIBB 1PD6A 1CTNA 4FFVD 1FL5A 4NYLB 4XCCH 4XNZB 1JHLH 4ZS7L 2HTKC 1NCTA 5B22A 3WYRA 1RJLA 1TZGL 1U2CA 1WICA 1C16B 4I2XE 1BZ7A 3ILQD 3J7HA 3DX8A 3QDHA 5D1ZA 3SKMA 2F19H 4GKSB 4F7EB 1ZWIA 5DURD 1KTKE 3Q2CA 4JN2A 3C08L 4WO4D 3EZ8A 3LB6D 3T3PF 3QWRD 4JB9L 4P59L 3R1GL 4OI7A 1KYOJ 2W60B 1M7DA 4PB0H 1OPGL 3JV4B 2H9GB 5CJ8A 2XZQL 4MZ3A 4UIMA 3TN0C 2C9AA 4E9LA 4Q9QH 4D8PA 1VHPA 2XXCB 3ZYJA 3TPUA 4POZC 5E08H 4C56B 4XBGB 3U4BH 3JV4A 4QXGH 4PRAB 3IFLH 4ZUTB 1OP3H 4ZS6D 1A5FL 3MLUL 5FA4B 5D93C 3ULVD 1VEMA 4LBEB 5AUMB 3TH3T 3K2MC 4NZUL 2O5ZH 4HJGA 1A6ZB 3T1WA 2XKNB 4WFEE 5K59F 5DQJA 3TT1H 4XC3L 2XTJE 3FO0H 3FT4A 4U3HA 1RULL 3X13B 3OR6A 4U0QB 3IAQA 4Y2DB 3HG1A 3KPQA 3WJJA 1IAKB 4F58H 3PHQB 1F3JA 1BQUA 4NOBA 2CLZB 1MCHA 3ZHKA 3MXWH 3D69A 5CZXC 2XOTA 1EJOH 4PJCF 1NKOA 3VFNA 3P30L 5E94B 5LBSL 1DCLA 4X6DA 2A83B 1PBYA 3JTSB 2ZWLT 4S2SA 2A74A 4P9HH 4WDIB 3T3PE 3RY4A 1CLOL 5DD1L 2J5LC 4M62H 5L8LB 4Z5RB 3G5VA 1Q1JL 4J4PD 3ZE1E 2BOBB 4LCIH 4ONGH 2GITA 3MRIA 1DBKH 2CDGB 3CUPB 3KPRE 4Q0XH 4TOYL 12E8L 3ES6A 2B4CC 3NABL 4NQXA 2Z91A 1J8HD 3OQ3B 4KMLB 4Z78B 2APTA 2QHRH 4NJ9H 2BDNL 1JMXA 4JZJB 2WWMD 4U6VL 5AYUH 2FH8A 2NPLX 1F3RB 5KSVB 4OB5L 2DQFB 2J5LB 5H94A 4ZFZB 5CD3B 1P84K 1RULH 1GIGH 2DMCA 3T0BA 4IOIB 4CMHB 4Z78A 4PP2A 4KDTC 2DQUH 3B6SB 1INDL 2OTUB 1E6OL 4UT6H 2M8XA 1JN6A 4F7TB 1CBVH 5FECA 2FLBT 1J86A 3BN3B 3BAEH 1D5ZA 3EOBB 1T04A 4NO0A 5IT2L 3PHSA 1GPOL 2NY2D 4LHQB 4YHKL 3SKNB 4Z7WF 1S7XB 5GJSL 3NH7L 4WGVB 2QR0A 1KELL 4HUXB 5F89A 3UTZA 4WI7A 4Y8AA 3E6FA 5DD5H 2R0LL 1UWEH 1WSST 5J0BA 4LPVA 4HWBL 2A6KB 5BS0B 1XCTB 4JREC 4NCC2 4DZBA 4F37K 3FOLA 3O11B 3S3SA 1DN0B 1OTSD 2IQ9H 3UYRL 4WWKB 1P9MC 3E6FB 1A1NA 1MCOH 1FH5L 1CICB 2VXVL 3P77B 3VGBA 1RURH 5DJYB 2V5SA 5BMFL 4M6ML 2NXZC 1TPXC 5EA0L 2BSTB 4PJ8B 2DI7A 1NBYB 3WSQH 3BPOB 3IB4A 3TIDA 1A1NB 4PD4J 2AJSH 4MQXD 2WK2A 4PRNB 2W0KA 3PXJA 5B3NA 5GS1C 5HY9B 4AEHL 4CAGA 1IGYA 5T1MB 4ELME 4JO3H 1ODAA 5FYKL 4P23A 2D7NA 5DA4A 1G9NH 3CXHK 5J1TC 3UZEA 1FG2A 3TNMB 2AABH 2BVOB 4RIRB 4ZFOA 3GUTA 4YR6A 3SKUD 3TCLA 3P73A 3QUKB 3GK8H 4DAGL 2VXTH 1BQHG 3VXMB 5IBUG 5J06A 1YPZB 1RZ8B 3ZKMC 3KLAB 3TPUB 1YNLH 3PJSA 4CDHA 3HC4H 3EOTH 1LO4H 2NZ9C 1U3JA 2NYYD 3P73B 3V4VL 1K6QH 3HN3A 1NGXA 3C09C 3SKJH 5DC4B 1JZ4A 1UXSA 4IIQB 4FQJL 1FORH 3SPVB 1YQ2A 1L0XA 2V9RA 3C5JB 1VCAA 3N85H 3SJVB 1WZMA 3HPLB 4QRRD 3QQ4B 2EKSA 1FG9C 2GSGB 5HGAB 5KSAD 1I1FB 1S8DB 5TPWH 3VFSA 4QRPB 4KRLB 2XN9B 4WI4A 4GG8B 5EIVA 1MIEL 2YPVL 4JFZH 2BVUA 3BXNB 5T5FL 1XMWA 3ARDC 4R9HA 5BV7B 5IG7B 4WIQA 2D7QA 3BHBA 1G6RL 1L7TH 4ODVH 3QQ3B 1MFCL 3VJ6B 3IDNA 2EDJA 3VD9A 1VGKB 2XFXB 2ZUWA 3G04A 5JDJA 4RFNC 4ZUSA 5IUSA 1JGEA 4JRYA 2QSTA 4N0YH 3VH8B 4H8WL 4OZGB 1NDGB 3QQ3A 3VJ6A 1LHZA 1LO5B 3HNSH 1IC4H 3T2OA 3W2DL 2WUCH 5B3JE 2CGRH 2DIJA 3SHSA 2GIYA 4ODXB 3SOBH 1WBZB 3LKOB 5F88B 5KN5A 2DWEA 3UDWC 3QZWB 4ZXBC 3P4OB 1LEGB 2FECL 3MODL 3QQ9C 4B5EA 1EFXA 3RU8L 5DVOA 3HE7B 5KG9A 5CJBA 1PKQA 3WUWA 1CFQB 2HTKD 3EJYD 1SM3L 4HIXL 3JV5A 3KJ4C 5BS0E 1LQSR 3B9VA 3GMPA 4MLIA 2GAZA 1WBZA 1S9WA 2ADFL 5T1LA 3AUVA 4TSCL 3MPCA 3VD3A 1X4XA 2KZWA 3N9GH 4LAQL 1UCTA 3QEQB 1MFDL 4KVCH 1H8SA 2OXGA 3CIQA 1C5BL 2F54A 3K0WA 1E27B 4RQQA 1K8DA 2VDML 3P9LB 2ZCHL 4LSUH 5E2WL 1EHLL 4M5ZH 2M26A 5D5ME 4U4BA 4K8RL 2VMFA 4KKCD 4RFEB 1IM3B 4GBXA 3CSYB 3VRIB 2Q6WA 3GSOB 1AQKH 2JJSC 3RKDC 1YDPB 3F62A 5A1AA 4QCIA 1NMCC 2C3WA 3MLVH 2VLKA 4JZNB 3VWKB 3BZEA 4H0HB 5DRXA 4E41E 1ZT4A 4J6RH 4CVZB 1G84A 4FQXA 2ILLA 2FHFA 4I0PA 1ZHLB 3ULUL 5HDQH 3C5JA 4YBLB 5L7XH 1T20A 2D0GA 5JW4Q 1ZT4B 5J1AB 4NRZB 1URLA 3SGEH 1CT8B 3FB6B 5HI3D 1MPAH 4Z0BL 4JHAH 4LPXA 1FYTA 1NGZB 1X7QA 3HC3L 1N8ZA 4L4TA 1BQLL 4WUUB 5JIIA 3U9UA 4WI5A 2BNRA 2OCFD 3BHBB 2XA3A 1FDLL 3V6ZB 3WS6A 4IRJA 2E6JA 4AQ1B 3L3JA 4X7CC 4EDWL 1WLHA 4U7KA 5ESQA 3HRPA 4I18A 1RJYB 5HPMB 2DTML 2HJFB 5IVXB 4HUKB 5T3XD 4CU7A 2B2XL 3CCHA 3VFWB 3I6GA 2P24A 5B4MC 4OZHA 2VR9A 4JFXA 1I8LC 4Y2DC 1RU9H 2VWEC 4Y5VB 1I1RA 1DTUA 1OSPH 3LS5L 3IS0X 2H6PA 4FFZH 1U91B 4BUGA 3C8KB 3QCUL 5FO8A 4F7PB 3NCFB 2FJFA 4OZHB 1MVUA 4ZYKA 4JANA 1JUFA 4YDJB 5IVZB 1MEXH 5D93B 3ILQC 3MV8D 5EORL 1JWSB 4LQFL 3VWJC 2YEZB 1BREA 2FD6L 5CUSH 4UV7L 1OL0A 2XXMB 1LEKB 3R06A 4YXLL 3G6JF 4M93C 5E6ID 3O45A 3VWKD 1FL6A 1U8NA 4FQCL 2F19L 5KOMC 5I74B 5CINL 1XIWA 5D7SH 4UUJB 1GXEA 2YRPA 4L8SB 2AP2A 1CD8A 4MNQB 6FABH 4IRSA 2PNDA 4GRWF 3FKUS 1MCQA 3UO1L 1FGNL 1ORQA 1RIHH 1XF1A 1DN2A 3LIZH 3FCTB 3RWEA 3O3DA 1MH5A 1FJ1A 3OKNA 1VENA 2RFXB 1MFAH 4KK9D 4UU9A 4Z7OE 5LKNA 4POYA 4JQIL 1JHTA 5HHXL 3QULA 3JWOH 4NZUH 3MLPA 4UDUA 4S1QH 1F6LL 4XBEH 2IALB 3MBEA 5C08B 3P0YL 3ARBD 2DKUA 4LDOB 1SBBA 1HILB 2ESVD 4M7KH 1IEHA 3ET9F 3L3HB 3VI3F 2XT1B 2CRMA 4PJAF 3RY6C 3EOAB 3VXRA 4JQVC 5FUZL 1E28A 1OGAA 3H9HB 2NLJB 2EDYA 1QP1A 2OJEB 4IRJD 5EU4B 5I8CA 5MEQB 3MV7B 3HZYA 4LCWA 3SDXF 5IR1B 1QKZL 3IJHA 3HPJB 4RMQA 4R3SB 3PL6B 3QIWB 1ZHNA 1K8IB 4FABH 3HE6D 2HKHH 1P1ZA 5BV7C 4YX2H 5SWZA 1N4XL 3PWPD 1I8LA 2XZCL 4JFEB 4W68A 2NX5E 3OKMB 1S9VB 1MI5B 3MTRA 1BFTA 1R3JB 1JPTH 4NKQB 3IF1A 4K7FA 2P46B 3CCHB 1CDGA 4M7LT 2QEJA 3OKMA 2MKWA 3WFDH 2MWCA 5D2LB 5HHNB 1TZGH 1ONQA 2VYRE 1VSCA 4LOUC 3GKWH 1O0VA 3FQNA 3ULUE 4PJIA 3I6KA 2Z92B 3EGSA 2RR3A 4KK5D 5SWZE 1NGYA 4X4ZA 4EXPX 3EKCA 4NP4L 5L8KB 2RB8A 3BAEL 1J9CT 5HYSB 4JPVL 5B39A 1U8KB 3ESVF 4GKOA 1IC7L 2A2QT 3FB8B 4DOHE 3GHBL 3MV9D 2CK0H 2G5BB 1DEDA 1MPAL 2EDOA 2R39A 2XQBH 2DI9A 2X70A 3FFDA 2J2ZA 3C6LC 4JY4A 1I8KA 1N4XH 2BRQA 3ULVF 1IEAA 3IGAA 1JGVH 3ULUD 2PXYA 1EO7A 5C6TH 2GY5A 4K55A 2FEEL 4PBWD 1JK8B 4O2EB 3ULVE 1SMOA 2A0LC 1QVOB 4N1HB 4P9MH 1UEMA 5IMMB 2OL3L 3FT4B 3IGAB 4DCQB 1UWXH 1AE6L 4JE4B 4PJ7A 4HPYL 1F3JB 5IVNA 1AQKL 2DLTA 1KJ3L 4RAVA 5DLMH 5BQ7A 3QQ4A 4OD3H 3DUUB 4JY6A 3HE7C 4J4PA 2IMMA 2FX7L 2QQLH 4XBPA 3HMWH 5DFVC 3TF7C 1ZGLM 5HI4C 1QFUH 3MRMB 4FZEH 1GZQB 2A77H 3QZWG 2NY7H 2VABB 1BWMA 3O3AA 3TLRA 3TZVA 4HW6A 3FO9A 2ZUVA 3ES6B 4QWWD 3EW3B 4E41D 4XP5L 1A47A 1MCOL 5FGRA 4OM1L 2FO1A 4R4ND 4MQXC 2L7JA 5DT1L 1EUTA 4OLWL 5CCKL 1KYOK 1CE6A 1KIPB 1NAMA 5EWIL 4URTB 4YHIA 3EJYC 1J8KA 3WLWC 4OZIA 3MCKB 2Q87A 3MODH 4I4WA 1F90H 2M2DA 4JN1H 2ORBL 1J8HA 3ARBB 3U83A 1CR9L 1U8QA 2QQNH 4CN1A 5AAWA 2C4FU 3SDXE 4TSBH 3QG7H 4PLJD 4EDXA 3OSKA 3GMQA 4X7DC 4JZJC 3QJFB 4PRHB 3LQZB 2EXYD 3HZKB 1LMKA 4NWTL 4EQ3A 4F7MA 2ATKB 4IMKC 4UOW1 4PJBE 4CN4A 4JB9H 2IALA 2MSPA 1EEUA 3Q5YA 2EDQA 4NQEA 1HILA 2AJZA 3G6JA 3S4SB 4L4TE 4XP9H 3WNMA 4LGRB 4F37F 3C2AL 3VW3L 1HQRB 3DI3B 3ZT7A 1RZJL 2B8OT 2DS4A 1C12B 1AD9A 4AG4L 5SX4I 1LE9A 2X4QB 3BYTA 4Q2ZB 5IHBA 4UIKL 4OV5B 3UBXG 4N5UA 4MB4A 3VRLE 4R97B 1BVZA 1MCPL 5DFWH 1EO5A 1LGVA 2E6QA 3H3PH 5CLWA 3IDXL 1MI5A 2NY6D 4OUUA 5E9DB 3AXLB 5KJRH 5CMAB 1YNKL 2H1PH 5E8EA 1W72B 1A2YB 3BMVA 3GDBA 2D03H 5A16A 4HCRL 3H9ZA 5D2LA 5HHNA 3MXWL 1J1PH 1DQQB 3MRJB 4WENB 5E8EB 3PP4L 3ULVH 4BUHA 5JOPD 2CD0A 3N9GL 1JGLH 2W9DL 2ZPKL 2VZUA 4WJ5B 3WXWH 3DMMA 1FL3B 2WINA 3GRWA 1H3UA 1XCQB 4XVSH 4FG6C 5C8JB 2XQBL 5A3ID 3IFPB 4Q9RH 1S7TA 2I9TB 1T7YA 3O0RH 4MJID 2Y36H 3DSFH 4YPGB 3SCMA 2NY4C 2Y06L 3GMNA 3D48R 1F4YH 5F7NC 1MHPL 4M7LH 1FZJA 5SWQB 4F8QA 1ZT1B 3MLSH 4P3CH 1RUMH 4OF5A 4P2RD 2RCSH 4YDLC 4M6NL 5FA4A 5F8QC 2YMXL 3OG4B 1O5DT 3VXUD 5GGUB 1DBAH 4NSKB 3O9WC 4XCFL 1TJIL 2ATKA 2VR4A 2FHBA 2PN5A 5C2BH 2DLGA 3L3OA 2I27N 4JPWL 4RZCB 3CZFA 3ELAT 3NA4A 5GS2D 3DIFA 4EN3C 5GXBB 3IJSB 3OGCB 1I7UA 4NBYB 1IQDA 4HWBH 4GKNB 3CC5A 1PX4A 4JRYE 5DR5H 3IKCB 2APFA 4QXTA 1HINL 5FIEA 2ARJQ 1QLFA 3REVB 3GEWB 2FJGB 4OGYL 1KJVB 4Q6YA 3BJ91 5BRZE 2P5EB 3NTCH 3QA3A 3QR2A 3B9DA 4GXUM 2EICA 3D0LA 1OTUD 1S7UA 4Y16A 5CZVH 4N9GB 1QRNB 1P7QA 1CF8L 5IGXH 3V4PL 4OUUB 3CUPA 1FYTB 2JB5L 3BO8B 5ISZD 4JRYD 5INDB 3C60D 4WI2A 5MENE 1A2YA 3H9SE 3I84A 4DEPC 1E6JH 1FE8H 1R5VA 4PFEA 2DBLH 4FQPA 4TNVF 2BNQE 1T0MA 4YXHL 4S0SD 3SGKA 4J3TA 1K4DA 3LQZA 3RIFF 3FT2B 4CJ1A 1AHWA 4XRCA 4LHUA 4TNVK 4ZUUB 4MJIA 3GB7B 3IRPX 5T3XL 2DQEL 3MYZA 1AY1L 2HVJB 3BSZL 4Q9RL 3RNKB 1QHPA 3EYQD 4KAQL 2PYFA 3VXSE 2P8MB 3VFPA 4MXWL 3LY6A 4F9LA 1T5XB 5F1SA 5JLZA 1FPTL 1JL8A 4Z7VE 2G60H 3RY5A 3SJVD 5C86A 1T2JA 5D2LE 4FFWC 4PJ7F 2WBJA 1W8NA 4KK6D 1EO8L 1MCEA 1I1CA 1S7XA 5GGTA 3LMJL 7CGTA 4C56E 2Z8VC 1WEJL 3GMRB 5HDOA 1CGYA 5KJRL 2LVEA 5DRZA 4HKXB 2F53D 2DKMA 3MACL 4KROB 1BMGA 3F5WB 4UT7H 4KUZL 4N1CA 1IC7H 3OGOE 1FO0H 2PW1A 5TDOA 1MRFL 4M1GH 1OAZH 3O4LE 1I4FA 1RVFL 1BHGA 4BH7B 1R3LB 1GOFA 3ALPA 3GNML 3QNZB 3S6CA 2HJFA 2F5BL 4JO4L 1FFRA 1WBYA 1QLEL 2P24B 3FTGA 1NBYA 4C56D 4U1HA 3SN6N 3U2SA 1A6UH 4OFVA 4XP6L 5DHYA 2Q7YA 4QHMA 4ZOEA 3WN5A 5ESAA 3G5XA 4OJFH 1YEFH 4ELKA 2IAMA 1N7MH 1D7FA 1OGAB 5C0GA 1TLKA 4ISVB 2LQRA 2OJEA 2FSEA 1W0YT 1UXWA 5GRUH 3QAZB 1S9XA 3W0WA 3WJLC 4DQOL 1RV6X 3S97C 5L88L 4Y19A 3LKOA 1Y6MR 4OKVB 2YN5A 1D3CA 3S35H 1MCSA 3FONA 2GJZA 4WU5B 4U1MB 1U8MB 4U1SA 5J1SC 1W0WB 2ADGB 4NQTA 4NSKA 4HMDA 2PYEE 5LQBL 3LH2H 5IOPA 5J9PA 4X6DE 5C9KA 4FA8A 4QTIH 1C5BH 2E27H 3HMWL 3GB7A 2X1PA 2FGWH 5DT1H 4XZUA 5ABDE 2EEBA 4QTHA 5KVEL 1EGJL 4P57A 3DROA 3LKPB 5CINH 5FYKD 4M8QA 3TT3H 3REWA 3HRZB 3QPXL 2ESVA 3MUHL 5CZXD 4HUWA 2DM3A 3FN0H 3V7AE 1D5IL 3BISA 5DHVA 3GMQB 1KJVA 4XMPL 5BOZG 4G6AD 1QD0A 4FTVE 43CAB 4TPRH 1XIWD 1FNLA 4M7ZB 2NY3B 2FCBA 1KCVH 4M7JH 2BXZA 1FCGA 2VLRB 4Y16B 5H37G 1NEZB 1QBBA 4WVRA 4AEIL 5B8CB 4H1LA 3V0VB 2Z8WC 3OJ2C 4PJHF 3WFEL 4RGND 2YK1L 3RPIB 1FC1A 1RJZA 3QZWA 2OSLB 4YDIH 1WF5A 3DXAB 2PXYB 5DHVH 3BGFC 2YC1B 5GJSH 5D1ZC 3G5YB 2PW1B 4YXKL 4MCZA 1G7PB 1D6EA 2YPKB 3C2AH 3OKKA 1FNHA 1CFQA 4DGVH 2QADD 4Z7QF 4NN6C 5D1QC 2X4UB 5E4EC 4L5FH 4WUUA 2ITCB 3GMMA 3KPTA 1KN4L 3BKYL 4QO1A 2MPAH 4Q74A 2IF7A 3V0WH 4H1LH 3LS5H 3ULUC