4P4KC

Structural basis of chronic beryllium disease: bridging the gap between allergic hypersensitivity and auto immunity
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
204
structure length
204
Chain Sequence
NSVTQMEGPVTLSEEAFLTINCTYTATGYPSLFWYVQYPGEGLQLLLKATKADDKGSNKGFEATYRKETTSFHLEKGSVQVSDSAVYFCALSLYSGAGSYQLTFGKGTKLSVIPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class II histocompatibility antigen, DP alpha 1 chain
publication title Structural basis of chronic beryllium disease: linking allergic hypersensitivity and autoimmunity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 35
structure length 204
sequence length 204
chains with identical sequence G
ec nomenclature
pdb deposition date 2014-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF09291 DUF1968 Domain of unknown function (DUF1968)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4p4kC02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4p4kC01
2AJVL 2YMXH 1ZLSH 3TC9A 2H1PH 2EYSB 3WE6A 3RKPA 4PV8A 3ROLA 4JN1L 3P73A 4FQHA 3S3JA 4HG4J 1A6UH 4V1DD 3SHSA 4NZUL 4DK3A 5B4MC 1PKOA 1BOGB 1T04B 1GPOL 2CKBH 2EKSA 2FR4A 2H45A 2HTLC 3W39A 2VDKH 2CKNA 1UADC 3B83A 4WO4B 2ADGA 4Y5XC 2Y6SC 1EAJA 4LOUD 1NBVL 4NC2B 3A0OA 5FO7A 1GZPA 5JHDD 1XCQA 3KPOB 3CH1B 3ILQC 1EXUA 5ELIA 3EOBA 3P4MA 1CFQB 1HILB 3BKCH 3O6FC 2C4FU 5T1LB 4PR5A 3DROB 2NTFB 3LKQB 4QTHA 1LHZA 2IALB 2A1WH 3QEQA 1ES0B 4UAOC 1KXQE 1NAKL 4KK5D 1RAMA 4DZBB 4GXVH 1OGAB 4M9PA 3GSUB 1JV5A 3QUXB 3PWUA 4ODBD 4OZIB 2XFXA 3MV9E 4J1UB 3BMVA 1YMHB 3G6JA 3UJJH 1FAIL 1HH9B 1QA9A 4JZJA 4P46B 2NX5D 2YXFA 5GHWH 2GI7A 1MJJB 1BP3B 3VWJB 5E94B 1EFQA 4N0CC 1NANH 3QG6A 3AS3A 5DUPH 4WW2F 3I75B 4MQ7A 3OKDA 4JPWH 1QO3B 4Y8AA 2A6DB 2AK1H 4NDMB 5FUCE 4JFDE 5CD3B 1ADQH 5H35A 4YH6A 2AJXH 2X7LA 3FQUB 3GIZH 3D18B 3IRZA 4LGSB 5I71C 5KSAD 1U93B 4L3EA 3QPXH 4X6CB 4F7EB 3HZYB 1VPOL 2IJ0C 2AJYH 1S9KC 1UKSA 2EYSA 4GRMA 1YEFL 1SJHA 2BNQD 4X6FA 5IB2B 4KZEH 1WT5C 3DO7B 1CGWA 3HE7B 2DL9A 4PGDB 5EZOL 3RPKA 4G6FD 2W9LA 1X4ZA 3HC3L 4F8TA 5DMKB 3CX2A 1ROWA 3MTRA 1S7VB 4H20L 4HWZB 3BD4A 3WNLA 4OI7A 3X11B 2YPLA 2WIMA 3GSVB 1WBZA 5C9JA 2AABH 3D39B 1QBMH 4P2YA 2EE2A 4Z18A 5DTFB 5F7EL 3JV0A 4BELD 3VFUB 1XF3A 3MBED 3SKUD 1E4KA 3OXRB 2CDEB 3GIVA 4KRPD 4ENEC 2HH0H 2ARJQ 3LKQA 1RJLA 2R2EB 4ELKB 2EIEA 2Y7QB 5IHZA 3MLSL 1N6QL 4ZFFB 2YD8A 1JHKL 2UVEA 1ZLWH 1MCSA 3MLTA 4PFEA 4G6JL 1JPGB 1JTOA 3KLAA 2LTQB 3OGOE 3ROOB 1J1OH 2CMRL 1YMME 3IETA 3RNKB 4X4YB 2VDQH 4E41B 4QXGL 5B8CB 1XH3A 3ZHDA 4P46A 5D1QB 2VISB 4UTBL 3GHBL 4JM2C 1YZZA 1ULVA 5E2TL 3S96B 3FQNA 4R26H 1OD9A 2NYYD 1A7PH 3KJ4B 4S2SB 5IHUL 3ULUE 1QO3A 2OJEB 4LHUB 3KPPB 3QJFB 1CFVL 4NDMA 5FYKE 2PYEA 4TUOA 1JBJA 4RFEB 3GSRA 3Q6GH 1T1XA 3LSOA 5LBSL 2JB5H 4XPHH 2X4QB 4F7EA 4GKOA 2DTSA 3V8CA 1GOFA 4Y19B 1I9IL 5EU5A 1FJ1A 2R23B 1HXMB 4AL8H 2YPVL 4I0PB 5DMKA 2YWYA 2HG5A 3HNTH 4NRXB 4PUBH 4J3WA 1BQSA 5EUOB 4NRZA 4XMLH 1GHFH 2QADB 5CMAB 3RJDA 4FQIL 4CMMA 4TSCH 3OXSB 4PJDB 4FQXA 4UNTA 5FM4A 2ITCB 1ZWIA 5JTWA 2WSKA 5IMKB 2CK0H 2V7HB 5KN5A 2O5ZL 4IS6B 3OKNB 4OFYD 3C09B 4M1DL 4HGMA 4NHCH 4O51A 1Y6NR 3KWWA 2CLRA 1FZMB 4MAYB 1C12B 3DYPA 2R2EA 1P7QD 5E2WH 3QAZC 2BVPB 1CD0A 3D87B 2QSCL 5CZVH 2C4XA 3JWDH 3C9NB 2RBLA 3BW9B 1JL8A 4FZ8H 2BY3A 2XOTA 1DSFL 3LZFL 2O93L 2AJVH 4X4YA 1A22B 1NGQL 4IOSD 4S1RL 4GXUN 3DV6A 4FQLL 4R8WH 4BYHA 5M94B 3WNOA 3M45A 5KBNC 1D5BB 2X2YA 3DO3A 4MB4A 1BIIB 5J6HB 1FYTD 3ULUF 3RX7A 1AXTL 1KV3A 3ZSSA 5BVPL 3FAWA 4Y5YA 1R5WB 3CVHA 3TBSA 3QJFA 1MCPH 5IG7B 2G5RA 1HK6A 4L8SA 3VMNA 4WIQA 1EHNA 4OFKA 1Z0MA 3SJVD 3P0VL 4LSSH 1CQKA 1ZVSB 1SEBA 3S37H 4AG4H 5CEZD 5A16B 3HZVB 3TJEL 1VEPA 4LCCA 3C08H 1A6ZB 2Q3AA 3VWKC 5CMAA 2Q76A 4OZGE 1H3PL 1VHPA 1OP3K 5TPWL 1HINH 1HHGB 2GFBA 3BQUA 5ANMA 4X6DA 3UTZA 3CFCL 1G6RL 3NFPA 2K7PA 4OCRH 3QH3B 5DURD 1T2JA 1JRHH 4I9WE 4ONHB 2OTPA 5LWYH 4BSWA 1QRND 1DBML 4XXDB 3LKOA 5CZXC 4E5XA 5E00B 3QG7L 3NCJL 3B9KA 2VMFA 5H94A 2ESVA 3LKNA 1VGEL 5DQ9B 1C5DB 4KY1H 1BQLL 4X5XB 4UIMB 1FZMA 1RUKL 2EDRA 2W60B 4MAYA 2J4WL 1BJ8A 4PTUB 1NGYA 1FLRH 3U9UB 1IC7H 2AEPH 3VFWA 5KOVC 1FP5A 3KLSA 3U46B 3TPUA 3RZCC 1E4XI 1S3KL 4F9PA 4QRPD 3V5DB 1P6FA 3KPRD 1MREL 1IGJA 4WO4C 3NGBB 4XAKD 2I07A 4LLYB 1FQ9C 4Y7MA 4JKPL 1I8IB 5J6HA 1GOGA 5KJRL 5JMOC 4HPYH 1E27B 4MNGB 3ALWA 5CIPB 3O2VL 1AD9B 2VWEE 2KUTA 3P9LB 4JVUA 4JQXC 4ZUWA 5CSZB 3V5KB 1EFXA 1FPTL 2DLGA 4CU8A 4P2QB 3QDJA 4HIXH 2NR6D 3RWFB 4EXPX 3NCEB 2DQHL 1Q9WB 1IC4H 4XC3L 4FS0A 5JLZB 3SKMA 4KKCC 1UGNA 5ID0A 5HYQB 5ID1A 4NUGL 3HG1A 3GI9L 4DKFL 4OZGF 1JF1A 4HAFA 2DLEA 1UEMA 5EU6B 2CLZA 2AXGB 5JDJA 1IC5H 3MNWA 5TF1H 4PJCB 3OHXB 4PP1C 1NMAH 4TQEL 3VWJC 4G6JH 4X7SH 4KI1A 2DQUH 1G7JB 3QFJA 2CMRH 1H8NA 1T5XA 2WINA 3NTCL 4JRWA 4HW6A 4NOBA 3TVMA 3INUL 3UPAA 5DRXA 5HPMB 5K9JH 1QHPA 1HYSC 1I9RH 4JCMA 5DQ9A 1C5DA 3UPRA 5IV2B 4RGMC 3I6LD 1EEZA 2IPUG 2DQDH 1O7VA 3S35H 2V2TA 4HWBL 2APBA 2DQIL 1OPGH 4H5SA 3P9MB 5FO9B 3G5VB 3U9UA 3ULVE 4C83B 4PJGB 3U46A 3F7YA 2NY1C 3IDIA 4N5ED 5D7SL 5BO1L 4FG6D 3TNMB 3BISA 3D2UA 4XP6L 5F97E 4ALAL 3V6OE 3MRFA 5JNYA 1F4AA 3VJ6A 4PJEE 5CGTA 2AGJL 4NFBA 4X0KA 5INDB 2VQTA 3DECA 3FN3A 1ND0A 2EDNA 4GAFB 1IFHL 3U7WL 1S9YB 1ZKAA 4TYUA 3UAJC 3MJ8B 4J3TA 4HK0A 1J0KA 4GG6E 3QISA 3FOLB 1F42A 2Y5TB 3O6KH 2XRAH 2YBRB 2YC1B 1MJ7H 3GO1L 4X5LA 3LQZA 3T0WA 3JVGC 3LEYH 4HIIB 2AS5M 1G84A 3T2QA 4BK5A 1TJGL 3N9GH 5FA4A 4M1DH 1A7QL 2PCPB 1I9JL 2XZZA 3QO0A 4JZOB 5HYQA 3GNML 1B0RA 1Z3GH 1UACL 2ARWA 1XF2A 1BD2D 4KK6C 4KJPD 4HF5L 3RBSA 5IK3A 3D85A 2CGRH 4U1IB 4MX7A 4YJZL 5FB8B 1MCWW 4WWKD 1Q0XH 4MJ5A 5J3HD 5FM5O 1OAXL 5HVFB 1OY3B 1ZT7B 2OL3H 3QDGE 3BOVA 3N1MC 4D8PB 5FYJD 2XICA 3ESUF 3I6KA 3WO4B 2O5YL 4XMPL 3P0YH 2VZTA 2RFXA 3VFVB 3MMEA 1K4DA 1V05A 4ZSOE 3SCMA 1UM6L 3BWUC 5DFVD 5H8DA 3S3SA 1X9QA 2F54A 4L9LA 4HJ0D 3V7AG 3ULVF 3KVQA 1IEAA 4U1SB 4HAGA 3ES6B 3P2TA 4PG9B 3QPQC 4NKDB 4UOW0 2F53B 1QSEE 2Y23A 3GMPB 4S1DC 3QCTL 5T5NF 4PJEF 5BXFB 1KCKA 1OWRM 3JXAA 3WXWH 5A3IC 5ESAA 3EYOB 3WS6C 2H3NA 5MENE 3GK8H 3UP1A 1ZHNA 3BRFA 1FG2B 1J05B 1Y6MR 4U1LA 1MFBH 1D5ZA 4YFDB 5DJ8B 1NH6A 1PKQE 2R1XA 1QR1A 3CC5B 1PJ9A 4GG6F 1L7IH 4QRSB 1ITBB 3C09C 3FOLA 2Y5TA 3QWRA 4DGIH 4OAWB 1FGNL 2R39A 3QEHB 4R90H 15C8H 2EH8H 3NCYP 1DBKH 1NFDF 1ONQB 5EPMA 8FABA 1R5IB 4OT1L 5JA9A 3OMZA 2I9TB 5DJZA 3X14A 5HHOE 1RFDH 3X17A 4M6MH 4X80L 4NM8H 1DVFA 2VOTA 2NXYD 5JOPD 5C0GB 3S4SA 3B8YA 3FO0L 4PREB 5CBAB 12E8L 1CFBA 4PJFB 4UV4H 3VXSB 1CVSC 1I8LC 1ZSDB 1QYGL 3BP7A 3QEQD 4OJFH 4A6YL 3C5ZA 5HVWA 1HZHL 1G9NC 4X4ZA 4XPGL 3U30C 2P42B 1VFMA 3TJHC 4OCSH 2DWEA 4PRAA 3GM8A 2P5WB 4IMKC 2XTJC 5DZNA 1MLCB 3SKOA 3DI3B 4QRTB 4O2FB 4OTXL 1QSFA 4R4ND 3UTTA 5H37G 4K55A 1DUYB 2Z8VC 1HSAB 3UTPD 3VW3H 1WISA 3GDBA 5GGQL 2OTWB 2VUYA 3D48R 1MHCB 3RL1A 3RUGE 5I1HL 1FPTH 3A6CL 1N0XH 3NH7H 4WFFE 1KT2B 3MLRH 3MRGA 4FP8L 5BXFA 3ULUH 3FOMB 4RDQG 2PNDA 4YQXH 5TE7H 3V4VL 1CGUA 4NNXB 5CJQL 5ENWB 2DQTL 4XC3H 4PJ5A 4M00A 1FZOB 3P9WB 4M7LL 3ZYZA 4YFLF 4RZCA 2G5BB 1JZ2A 5T3ZL 1ODAA 2QQLH 3QUYB 1J8HB 2CR3A 3OPZL 2NY2B 2R0KH 3WFCL 4PGCB 3QBTB 3T2NH 2CDGB 4DOHB 2VAAB 4L8CB 2FZ3A 1YQVH 1CU4L 3JV6B 1TLKA 4LASH 4FOMA 5GGVL 1A1NA 5C1MB 1JPTH 2NZ9C 3RKDC 3T1WA 3BPLB 4UV7H 5ICZA 4OCYH 5T33L 3WNMA 4H26A 3INUH 2EECA 1UXSA 2CPCA 2GUOA 2YD2A 1T4KA 2HKHH 2VDML 1GGUA 2ZJSH 5T1LD 3I50L 2CKBB 3GSOA 3IDYB 3V8OA 3EJZC 3HMXA 3VXSA 1WF5A 2BVEA 1FO0B 1KTDA 1FNEB 3ARDA 1KEML 2Q6WB 3V2AR 3QRGH 2LU3A 3A6OA 3VH8B 3ARFA 1QBAA 2P8MB 4G9FB 4XP6H 5HJ3A 5C0CE 3RDTB 1GRWA 4K3EH 2C3GA 4XWOC 2VJXA 4P46D 4WI7A 3VFMB 4QRTA 3QXDB 4JHWL 2W65A 1BFVH 2MJWA 5IOPA 1KGCD 4MA1C 4XNQA 2XN9E 3WL9A 3L5WB 1YEGH 2V9TA 3RUGF 3NABL 3QDHA 4OB5H 3G6DL 3KPQA 3MR9A 4QRRA 3LQAL 1VCAA 2WAHA 5FCUH 1UCBH 4YXHH 1RK0A 2EXWC 5BOPA 2H6PB 1QKZL 3PHSA 3P40A 4Z7UA 5HHXH 3WSQL 4DW2H 3ECBB 1AGFA 4KAQL 2E7LA 1RJYB 5DRNB 1F8TL 4PJ9C 4Y88A 1INDH 3SQOL 2CUHA 3QP3A 5CZKA 1R3LB 5I1KL 3HZKB 2EDEA 3FTGA 3HE7D 4DGYH 1JFQL 3ARBB 4X83A 2NY5H 2VDNL 4M93C 3PXJA 1E0OB 2J6EA 3I02B 5J57B 3FB6A 5T3XD 2HLFC 2ID5A 4PGCA 4FXLA 4O02H 4DK6A 1AXSA 2EXYC 2D0GA 4WUUB 1IGTB 1S5IH 4FXKB 2Q86A 1MRFL 4HPOL 3SE4C 2I26N 4I2XE 3R8QA 4U49A 3IFLL 3O6LL 3ARSA 3UBXG 4MJ2A 2CKBA 2H2SC 4IOIA 3MOAL 1OM3L 4NN6C 4JPIB 1DBJH 2ZUWA 4KPHL 1FNEA 5ALBL 5EN2B 4GRLC 1AGCA 2X1WL 1XIWA 2R1WB 4IHOB 2GIYA 2P8MA 5C09E 2DMBA 3VXMB 1KUMA 2H2PD 3T4YB 4OLYH 4E41D 1JHLH 1DN0B 4EDWL 3V4PL 1VERA 4R7DA 3C5SB 3WO3B 1S7RB 1DQQA 4XTRD 1K8IB 3JWNC 3HNVH 2AK4B 2R2HA 4OKDA 3QUKB 3MODH 5HYJB 4LHUD 1PZ5B 5IM7B 1U3HA 2DB8A 1EVTC 3GJFB 2BK8A 4YHZH 1LO2L 5AYQA 3MLVH 5FDWA 2R69H 5DRNA 3FO1A 1KXTB 2M8XA 3IFNL 5EO1A 4QXTA 3TV3L 1E4XH 4Y19D 4WDIB 2DBJA 1RPQA 1R3LA 4OI9A 3HZKA 3PP4L 3B2VL 4XBPB 4I0PD 1JGLH 1I4FA 1NBZB 1SM3L 1DFBL 1V3LA 3C5JA 5DEGB 3HNSH 1ADQA 4K8RC 2QADD 4NKIL 4NZJA 4O9HH 5E9DB 3HAEG 4K7PH 4GUPA 3SPVB 2LFGA 3CK0H 4OSUH 4XVTH 3K7UA 3QQ4B 5DWUL 5IFHH 5F7DA 4RAHA 3RZWA 5D7KE 3QHFH 4OFVA 4DKEL 1QFWM 1FN4B 3RNQA 5L7XH 3MLYH 3MFFA 3STZA 4MAYD 5BZWA 4U6YB 5IGXL 3UO1H 5HYSB 5F89B 5I1JL 3BDXA 3OAYK 4PGBA 3MCLL 2AJSL 2BSTB 2BC4A 4Y1AA 4BFEA 2VR5A 1BVKA 4TUKL 4X98B 5HGAA 5MHSE 1P2CB 2BFVL 1CFTA 1U8HB 2D9QB 3Q0HA 1HIML 3H7BA 4RGNE 1T89A 3RVTD 4G8FA 1D9KB 3C5SA 3KPMB 5D93B 2EDXA 4JY4A 4KJQC 4QOKA 3TA3A 3GMRB 1CLOH 4KQ3H 3WFCH 4DZ8B 4MGXA 5CD5C 1MIML 5DXWA 1BLNB 1M05A 4P4KA 1EFXD 5FUOH 1ZVHA 1NBYA 2GT9A 4DVRL 4EEEA 1AGBA 3PJSA 3VFGL 1MF2H 2OTUA 5EWIL 2NQCA 1FFQA 5INCB 5IBTL 3PL6B 4XPTH 2DLFL 4QNPE 3MA7B 5TFSH 3QUMB 4JY6A 1FFNB 3OAZH 4L5FH 4LLMB 5E9DA 3SDXB 3KGRA 4YNYA 4DFIA 4OV6F 1PLGH 2BJMH 3HI6H 4QWWD 3O11B 1S7TB 3QFJD 2Z4QA 1IAOA 3FFCB 5FECA 3QI9B 5I76A 5HD8C 1T83C 4HFUL 5HVGB 2HVJB 1IE5A 4QHNA 2A6IA 4MQXD 4S1QH 1CZ8L 1ZA3B 4YBLC 5D72L 3GMNB 2EIZA 2AJZA 4XCNB 1WEJL 4U6YA 3I84A 3B9AA 3HB3C 3I9GH 2GAZB 4EUPH 2EIDA 1OAQH 1ORQB 1X5HA 4HKXB 1QFWI 3CFKB 3PHQB 2FJHA 1S5HB 4X98A 3D2UD 4LVNB 2NY2C 1IAIM 1RZKL 3KS0H 3TZVB 3RA7L 4TTDC 4P5MA 5AAWA 1MHEB 4L9DA 3RVVC 3WFEH 2DDQL 3CSGA 5LGJA 4PP2A 3A6BL 4LCWA 3G5ZB 4XP1L 4HKZA 5GGRB 4FABL 4XAWL 5IB5B 2VDNH 5F1KC 5GSRB 1AY1H 5F7WC 4R96B 1CYGA 3CXDH 3M1BA 2OI9B 4DZ8A 1JI1A 2R29L 4Y16A 4Z77A 1M7IB 3K8LA 4P2QD 1CN4A 3EGSA 1WWWX 4J6RH 4MA3A 4O58H 4WFGD 5IR1A 1MFNA 1A7RL 5KW9L 4NCC1 4AEIH 3T0VA 2ORBL 3V52L 5FKAB 3WDIA 1KG0A 3MRDB 4F7MA 3ZDXE 1H3GA 4H0GA 1FH5L 4QNPF 1CXFA 4M6OL 4BM7A 1GGCH 1IT9L 3T4AA 4EOWL 3MA7A 3RY5A 3D3VE 5EU6D 3D85D 4MNHA 1FFNA 2UWEA 4Q6IA 1NCBL 5E6YA 4HS8H 3SDXA 2R8SL 2JJSC 3KYAA 5C0BB 4G6ML 1ACZA 5HYFA 3RVUC 2I5YH 3KYNB 4KVNL 3U0PA 3FHQA 1OSZB 3U0WL 4QHMB 5SWSB 1SY6H 1WBXB 3WFBH 3TEUA 3BRDA 5LAXA 3O2DH 2PW2B 4XCEB 2PYFB 2ZCKL 1T1WA 1N8ZB 3KPLA 1G9ML 5EB9A 4GH7B 2B5IC 2HRLA 4GW5A 4GQ9L 4MJ4A 5GS0D 2GHWB 4BQ9A 1DEDA 3W9DB 4M8VA 4OKVB 4Z6AT 2BNUB 2DQEH 3MO1B 1OSPH 1SYVB 1HXYA 4OF3A 1DBBL 5GGRA 4OGXH 3AAZB 1BZQK 2XNAA 1NFKA 4HH8A 1L6ZA 2VLJE 3BDYH 2B4CH 4NKIH 4KZDL 3L1OH 4YZFE 4WW2B 1D5MA 4DQOH 1H8OA 1H0DB 1M7IA 2NY7H 3D0LA 3IU3A 3QWRD 1MEXL 1QZ1A 3IDJA 2VB5A 5EZIL 3QWOA 4M5ZL 5I30L 3ARGC 3CLFH 43CAB 4L1DA 4WEBL 1OB1A 5EO9B 4TPRL 2HRPH 3ARRA 3N85L 3TFKC 4G6AC 4XPFH 3ZDXF 3DGGA 1DQML 1ZT1B 3MRDA 3SN6N 4MJIE 2GJJA 5LGHL 4Z95L 5GSVB 1M7DB 5IFAL 2ATPA 1Z2KA 5HGHB 4MNQA 3C5ZD 1J86A 1F00I 2X10A 1F3DH 5JW3L 2QR0B 2AJSH 5C0JA 2LABA 1D5XB 5CHNB 1MFCH 4YDJB 4PGZA 1T0NB 2ADJA 5B22A 3T0AA 1HIMH 1VEOA 1JGDA 2JB6B 1WZMA 3CCHA 2ZG3A 4XHJD 1QSFD 4HMCA 3UTTD 1AO7E 2A6KA 3PGFL 1PG7H 4TULH 2PW2A 4XCEA 2BMKA 3AC0A 2OL3B 4YGAB 4EVNA 1OGTB 1W72L 2VE6B 4QTIL 3HPLA 5BJTB 3OX8A 3MV9B 4B41A 4UINL 2DM3A 4TUJA 1MRCL 4P5KB 1LQSR 5EUKB 3BEVA 4LCIL 4PJ5D 1OAUH 5DEFB 4CW1A 5EWIH 4UBDD 4K94H 2DQGL 2QSTA 3BGFB 4JAMA 3B5TA 1KFAL 1KCUL 3AAZA 3CPLB 5SWQB 2WBWB 5HHMB 4U6XA 3B9EA 5IHLB 2FX8L 2NZIA 3QQ9D 3LH2L 5DD5H 1XF5B 3WCYA 4B7IA 4OLXH 1FRGL 1U8MB 5CGYD 1RUQL 2NR6C 4NCC2 1FFPB 5DD3L 4JFDB 5IQ7L 2ZNWA 3VFSA 1OTUC 3Q3GA 4OD2B 5AG8A 3BN9C 4YDLB 2Z9TA 3KHQA 3ZTNH 2F58H 4KUCD 2YEZB 1QFWL 1GH7A 3OG6B 1UYWH 1MQKL 2VXTL 2VXQL 2ENSA 1NDGA 2HJKA 2IH3A 1X6NA 5EU4A 1WEJH 4D3CH 3VXSD 2IG2H 2QLVB 1YY8B 4H8WL 5E8EA 3DUSA 3O8XC 3QRFM 4GBXB 2LQRA 5DRWB 1D9KC 5SV4A 5D93C 2QR0A 5H2BA 4B50A 2HJFB 3ARFD 1ETZA 4X8JB 5CCKH 4YGVB 4Q6YA 3KNBB 4W6WB 4HX1A 2GW5A 1L4IA 1YYML 4YHKL 4LARH 3MYJA 1DTUA 1T7VA 1I3RB 3LPFA 4I3RH 5I1DA 1VGKA 5FFLA 4CJ0A 2FEDD 1LD9A 3ILPB 3WLWD 3VXQB 4QRRD 2PTVA 4FG6C 5HI5C 4AY0A 3PL6C 4RISL 3MLZL 5EC2A 1RZJL 2YPKB 1G7PA 5D7IE 3MV9A 1LK2B 3AXLA 1YMMB 1KULA 2R1YB 5KW9H 3NACL 1FL3A 3RX5A 3V52H 1AD0B 2FO4A 5D2NE 2DKMA 3W9EB 1KJMB 1C7SA 4ONOA 1FH5H 2ARJB 2F8VA 5E8DL 3KXFE 2FGZA 2QTEA 1QLRB 3MLWL 1CTNA 2YZ1A 3QI9C 2FECI 3QUYD 1R0AH 2PO6C 4F7TB 1NCBH 3HS0B 5FHBL 3QUZB 1FFPA 2IQ9L 5BZDA 5AWNL 2QHRH 2UUDK 3TBYB 1GC1C 2ILLA 3DUUB 1P53A 4PG2A 5IEKB 2RCSL 1P4BH 4NCDA 4LHJB 1LNUB 4TVSa 3LN4A 4IM8A 4WWID 4KJPC 2XQYK 5EOTB 3SE9L 1AI1L 2FEEI 4KU1A 3TZVC 2DWDB 5IROA 4JFHD 5J3HC 5DQJA 4P23B 3PGDA 4CL7A 1RD6A 3GMQB 4WHTA 2FD6H 3LEVL 2CJUL 1U8QB 4JQIL 3WFHA 4F57L 2HJFA 2QV2A 3X3FH 3EYSH 4G9FD 4V2CB 1MNUL 4BJLA 1IAIL 3RDTD 1YEEH 1D7FA 1H15A 4YGVA 1IQWL 1KLFA 5C0RL 3KNBA 4N9OB 3BPNC 3FQTB 4YR6B 5KVMC 4TVPL 3MYZA 5K9KA 3O6ML 3OKMB 1AHWC 2J8UA 3HCVB 5TH2A 3UX9B 4DN3L 4MMXC 4XP9L 5GS3A 2CR6A 1LEGB 5JPMB 1FSKB 4U6TA 1J9CT 2ERJC 3VXQA 5DC0A 1J0IA 3VXNA 3WFDL 1H3VA 2A6JB 4KDTA 5D7IF 1JGEB 2C1OA 4HDIA 1U3HD 2XZCL 3L3OA 1LK2A 1KIRB 2R1YA 1NMCB 3FT4B 1HEZA 2HWZL 2YA2A 2A77L 3FFDB 4HG4K 1U8NB 1KJMA 1Q1JL 3VRJA 3RWIB 1J7VR 4OIAA 4KDWA 5D8JL 5LGHH 4WGWB 3OQ3B 3ARBD 2DTML 4J2XA 4XCCH 1JNJA 5TDPA 1MCOL 3KPNA 5D1XC 1RHHB 3TCLB 3EO9H 1KF9B 5HYSG 5JW3H 3H3KA 5EBMB 4DAGH 3MRMB 2FIKA 1I7UA 3SDAC 5IEKA 1K3ZA 2OZ4H 4OLVH 5J06A 3K46A 1P4LB 4Y4HA 3ZKSD 1U92A 2NY6D 4LDLB 1MFAL 1MJ8L 5ITFB 3FB7A 2DWDA 3PUCA 2YSSB 2W0FA 3WMSA 4OZGB 3TWCL 1TDQA 3QULB 5CP7A 3RVWD 4ODUB 1AR1C 3LEXA 4M7KL 5E4EC 3VXMD 5GGSB 1N5YL 2V17L 3KPSB 1FVEB 3VRIB 5BS0E 1J1PH 2G9HA 4HWBA 3EJJX 5HHPB 1BBJA 4EI6B 3U7YH 2X9XA 4MCZA 4S0TD 3ZKND 1QNZL 2VERN 2R4SH 4ZFZB 2W1NA 4XCFL 5I1LB 1LEGA 1NLDL 1A4KA 4PJIE 5MP6L 2Z8SA 1RUQH 4K2UL 5HYJD 1QACA 4P4KD 9CGTA 5C0DB 5JR1H 4FQQB 1BMGA 2K1MA 1LO0L 4HT1H 4TOYH 2Q8AL 1KIRA 3FZUC 5E24E 4EBQH 1F97A 5IWLA 1I8MB 3QXUA 1H8SA 4KH2A 1UT9A 1XGYL 1K6QH 4G6KL 5DA4A 5ISZA 3MLXL 1D6VL 1J1XH 4DVBB 4NN7B 1IVLA 1HOCB 3WIIH 4Y2DB 3TCLA 2P43B 5F6HI 2ZCLH 1I1AA 1HI6B 5GJTH 5E9DD 5KSBA 3JUZA 4MD5B 3K4DA 5CINH 1ZHKB 1F4YL 3HRZA 1OCWH 1ORSB 4HLJA 1Q0YH 1A6VL 1E4KC 4RAUA 2HVKA 1WBYB 4KHTL 3DVIA 2JELH 2XV6B 3ABZA 4KI5D 4R0LB 5DJCB 5EZJA 5ITFA 1FNSH 5F6IB 4ZTOH 1LEIB 3VXUE 4PRBB 2ZPKH 3B6SA 3BGFC 5IFJB 2EDQA 1LE5A 1N6QH 4RISH 4KK9D 3DGCR 1TTUA 1HQRB 1T1ZB 1F58H 4L4VA 1ZEAH 4HUNB 5HHNB 4Z76A 3ZZ1A 4YX2H 3JTTB 4Y4KA 3CZFA 4N1HB 3VGHA 2LU4A 2IPKB 1UH2A 3S36H 2M1KA 4LLUB 4LCWD 3GMOA 4F8QA 1N0LA 5DUML 1AGEB 3WJLA 3CLEH 4PJIF 5SWZA 4WI4A 3VXTB 3ARWA 2OX5A 2VN7A 3HR5A 4TRPL 4CU7A 3L3HA 1F6AB 1IEBA 1A1OB 1CE6B 2Z31A 3PHOB 4R7NA 5A2FA 4I3SH 3K4ZA 3S88H 4YO0A 3PXHA 5DGRA 1NDMB 4GBXC 2OMBA 4PJEB 1I8MA 4ERSH 2JCCA 1LO3H 1CDYA 1R6VA 1NCTA 3FO2B 3CSYA 4P2OA 5L2KB 5F7FA 4DVBA 4FQCL 1DQDL 4NO3B 4PJ8C 5IIEB 5IMLB 2P49B 3H9SA 4FQXC 3JZ7A 4YDVA 4JN2A 5EO0A 3TO4B 4KJYB 1OAKH 4ZPVA 1UA6H 2AEQL 1EAPB 1TXKA 4D0BB 3OR6B 2E27H 5GZOC 3OKEB 2Y07L 1O7SA 1ORSA 2FHFA 3SY0B 3U0TB 5KG9B 3TN0B 1XGQB 2OR9L 1C16A 2E5EA 4TVPH 4IRSA 35C8L 4PTTB 1EZVY 3AVEA 2AI0L 2A2QT 3H0TB 4GLRI 4QXUL 1XZ0B 1GGIH 1A64A 3BD3A 1MHPH 4PRBA 5FYLE 4TSAL 4EDXB 3EOTH 2D03L 1A21A 5CEZL 1YC7A 2KZWA 4E0RA 4JJ5A 5CKAA 5A40E 3SO3B 1T1ZA 3WXVH 5C3TA 4W4NA 5L0QC 3CXHJ 5JMRA 3VGEA 4WHYH 3HPJA 4L8DA 3ALPA 4ZTPH 3IDNB 3AU1A 2IPKA 3BGMB 3DXAA 4CVXB 2Y36H 4ZSOB 4TN9A 3SKJH 4OLWH 3U48A 5JXEA 1CBVL 1AGEA 2W9DH 1KCRL 4XCYB 5DGQA 3S5LA 4PJXA 3SDCC 3UTQB 3GGWB 4Y5YC 2FH8A 5JUEH 3D0VB 4LSUL 1OAYH 1DL7L 4BK4A 3OR7B 1T0MA 3MUY1 4G3YL 4L8SC 5DS8B 3HZMB 3L3IA 4AQOA 1QUNA 1QSEB 3QIBC 5J7CC 1UJ3A 1PEWA 4JR9H 4ELMA 3O45B 4WTXA 5GPRA 4NKOB 1MVUB 5MENB 1CE1H 2IPUK 3FMGH 1X7QA 4I4WB 1QR4A 3IKCB 2DIAA 3S34L 4YDKL 2Z91B 2YRZA 4GT7A 4OGZA 4NQCB 1G0XA 1ZTXL 3TCXA 4JO1H 3OV6A 4IRJB 1NCAL 2RIKA 5I1EH 4QT5A 3TIEA 4M8QA 5DMJB 1HHKA 1NEZB 3BQUC 4MNQD 1IKFL 5IMLA 4GG6A 4MMZC 1B2WL 1SEQH 1WLHA 4JM2F 2QQQA 2FYYA 4D0BA 1T3FA 2OJZL 5ETUA 3V6FB 1UZ8B 1NFDA 3U0TA 3B9KC 2P1YA 4OF0A 4WU5B 1IGML 5HHOB 5T1DL 4PTTA 4PLKD 4P5TB 5D6DA 5SWSD 3WIFA 3M17B 5HI3C 1N4XH 2IAMB 3MV01 2UY7A 1I7TB 4Y4FB 4OGAD 3SGJA 5EOCJ 3DMMA 3PNWB 4EDXA 3REVB 2C3VB 1WZ1L 4QGYA 2J88L 3DV4B 2WK2A 4K2UH 5D2LA 3KLHC 1IILE 2OR8A 3N1QC 5ADPH 4ETQA 3TYFB 5I6XC 3QDGA 4HUWA 2D0HA 3FT2B 1RZIB 1UKQA 4GKNB 2IANE 5K9QG 4HHAA 1NAMB 2J2ZA 3EFDH 4G6KH 1G7IA 1N59A 4FFWC 1H3UA 4FTVA 4JM4H 3K1DA 4GMSL 4OLZH 1DP0A 1WIUA 3RGVA 4EUPA 3Q1SH 3F7QA 3K74B 4JQVA 4TNVK 1X4XA 4R2GB 4LLAA 2D31B 1G7MA 5MEPB 1QLEH 2PR4H 4ZODA 1FVCA 2VQUA 3OR7A 3RUGB 2EZ0C 3HZMA 4LSTL 5GGUA 2X4TB 3OJVC 4AMKL 4WCYL 5HGGS 3Q48A 1EHAA 1ZHLA 2GQHA 4HZLB 4IOFD 2W07A 3EO0B 5CP3H 4KHTH 5HY9B 5MENA 4HD9A 2J3SA 2EEAA 4P3DB 2C1PB 4WJ5A 5DJ2A 1IGYB 4NWTL 4OD1L 3QIWB 2UUDH 3BP4B 1RUML 1ZANL 1PKQA 5F7YC 3V7AE 4RMTA 4HWNA 2FH6A 2P48B 4XT1C 5AZEL 3U1SL 1JYVA 1RU9H 4R3SA 1NEZA 2FX9L 3UDWA 3NA9L 5IB3B 2MPAL 5F3HB 2RR3A 3TVMC 1GYAA 3V6FA 1UZ8A 3MRQB 2IMMA 4ZD3H 4ONGL 4W6YB 3IKKA 3I6GA 1V5JA 2G2RB 1EBAA 1CLCA 4G8GE 4MZ2A 3GKWH 3C6LB 1BWMA 1N64H 3WJJC 2V5TA 2CSPA 1I7TA 4ZDHB 4NZTL 4KTEL 4GRWE 3O3AB 1L0XA 3MGTA 4EQ2A 5HYIA 3X3GH 2XY2A 1JYWA 4XPAH 5E8NA 1OGAE 1JVKA 5FGRA 1YUHB 4MXWH 2GSGB 4Y2DC 5DR5H 1JGVL 3MV9D 3U4BH 4Z8FH 5TF0A 5C0CB 4GKNA 4PRIA 3RGHA 1A3RH 4CN1A 5GRXG 1BGXL 5DJXB 1JZ5A 3EYUL 1KPVB 1ED3A 3DPBA 3O2DA 4ZAKB 5FYJL 4BZ1H 3LHPL 2XY1A 1KJ2L 8CGTA 3N50A 2XN9B 2HFGH 4FFVD 3PDGA 4MLSA 1T6VN 4LQ1A 1TENA 4OM1L 4ZFGH 4U1NB 5BQ7B 2EYTB 5DJ6B 2HTKC 4JFDD 4F7PB 3Q5TA 2MSPA 3FO9B 3MCKA 4IIQA 2BRQA 2VXSH 4NQSA 3DETD 3EO0A 1KIPA 3HLAA 4HS6B 1I1YA 1IBGH 2VXUL 4WU7B 1XEDA 2AI0H 4HV8B 1HQ4A 3M07A 4C56A 4U1GB 2XQBL 3RX8A 1FNGB 4XP5H 4JFXA 4LRNL 3RFZC 2DYPA 4HLZG 2F5BL 1A6AB 5EOQH 2HT2D 2C4FT 1V7ML 2D7TL 4WFEE 3MA9L 4PJBE 5DLML 2EDKA 3H9HB 4ONFH 2GSIA 1QBBA 3EO1A 3RTQA 4D94A 5C8JA 4HS3A 2C3WA 3SCMC 3ULVC 4I2XB 1TETH 4L9LC 3SDDB 3ZTJG 4LNVA 5IVXA 3JSSA 3V6OC 1BZ7A 2QQKH 6FABH 2NY4D 3Q5YA 5D71H 4DGVH 1QFHA 2X1OA 4OGYH 3CFEB 3MRJA 3WIHH 2GSGA 1P1ZB 5E2JA 5C09B 5C0CA 1YMMD 4ZOBA 3BPOC 3MJ7A 5IB1A 5DJXA 3U2SA 4D0CA 5FUZL 2VDOL 3MQIA 3PIQA 4HC1H 5EU3A 2WV3A 3BI9X 2ICWB 4KUZL 4YDKH 3HE6B 5KVGH 4UQ2A 1AQKL 3BMWA 3IAPA 3G5XB 2DL2A 3JV4A 3VFNA 4WNQB 3QQ3B 3ULUD 1F6FB 1U91B 1B2WH 1WJ3A 3QUZD 1TVBA 2EE9A 3BPCB 3FO9A 3TLRA 3TH2T 2HT4C 2EDBA 3CFJB 1DVFC 2XZQL 2F15A 5T1DH 4TSBL 4XC1H 3F7RA 4Q9RL 4Y4HD 4JG1H 5HI4D 3DRQB 2BRRH 4Z7OE 5CJOL 3UCRA 5L8KB 4RGOL 5GISH 2XG4A 3LY6A 4FFYH 1F4XL 1OP5K 3CMOL 4MQSB 4P23D 3K2UL 1WCBA 5TJWK 4PJBF 4RDQF 1NPUA 1BM3H 1GIGL 4OCXL 5I8EA 1Y6KR 3H9HA 4WY7L 4YHML 5I9QC 3IFOA 5IUSA 1L7TH 1UH3A 1KEGL 1CICA 3ARZA 1JPFB 4QRQB 5F9WB 4N90E 4APQA 5JIIA 4MJ6B 3D5OF 1RUAL 4CADB 1EK3A 4UTAL 1DDHA 4ACPA 4NPYB 2MHAB 3BHBA 3UYRH 3KR3H 1J5OH 2O5XH 4YHOH 4K9EC 3GRWL 4EN3B 3VG9B 2ZZUT 1V3KA 1UZ6E 4MWFA 4NO5B 2XWJA 5F1IA 3TYGH 5JW4M 1CFSB 1SJEA 4RGNB 3QNXB 1CXHA 3IF1B 1QBLH 1AQDA 25C8H 1CGYA 3BJ91 3BE1L 3S6CA 1VADA 1N7ML 2GJ6E 4JFEE 3BZ4B 4HJGB 2XZAH 2ZCHH 5MEOA 1F3JB 2R2CA 5LG1A 3CUPA 1XGRB 1B6DA 4LSPH 5I1GL 1I1AD 3CNKA 3W82A 1KNOB 3H3PL 2XTJE 3QJHB 4PJHA 1MWAH 2DBLL 2IAMC 4X7TA 3MUGB 5I8CB 3PWNA 4Y4FC 5TDNB 2DLTA 1K8DB 4JFPB 1BIHA 1YNKL 4P9MH 4ONGH 5E99H 1A2YB 5T1KB 1S7QA 1IARB 4MHHG 3TESA 2QSQA 5E6IB 2V6HA 4KMQA 3ZYIA 4Z7OF 1NGXA 3LRGA 1WIOA 3QCUL 5D1ZA 4HH9A 3CH8A 1A5FH 1MRDH 5JIHA 4XWGH 4G5ZL 3V0AC 4ZUTA 1V7NL 2GK2A 2Y06H 1IL1A 1FL6B 2HN7A 3ARDC 3KG5A 4WFHE 4DN4L 2IGFH 3FT3B 2VH5H 5EBWA 3O4LE 4P3CH 4R97B 1CL7L 2I9LA 1P4IL 5FYLH 1A7NL 1EEYB 4K3HA 5T3XL 1BREA 1DLFH 4GSDL 1I9EA 5T5NG 3EYUH 4Y4KD 1X5YA 4ODTH 3B4NA 3LV3B 3QZWB 1XCTB 1P6AB 4BUGA 5HDBE 1NCWH 4KK8D 5HDOA 1CGSH 4NQXA 2OLDA 1MPAL 3WLWC 1WIPA 4XNYL 2AJUL 1YN7A 3LIZL 5HVHC 5IB4B 2MHAA 3TH3T 2Z31D 3LD8C 4LBEA 3RVXC 4YHPB 1UZ6F 5LJYH 4BH8B 4EN3A 4UUJB 1KIUA 1VFBB 1QQDA 1Q9KA 4NRYA 3ZT7A 4D9LH 1NL0H 1G9EA 4P2OD 1U42A 1JWSA 4G8IB 1KELH 1EH9A 3E1F1 1KPUB 5DHVH 2ZSVB 1SVCP 4QY8B 1ZLVH 1XGUB 1CXEA 2P8PB 3DBXB 3C6LC 3H9SD 4ISVB 1GGTA 2D7TH 1TVDA 3MUGA 3M8OL 4NQDA 5AG9A 2GTWA 4CN4A 1B0WA 1TQCC 3CVHL 1J12A 1YECH 4XNMA 5C08E 3NZ8B 3EDDA 4PPTA 4Z7VE 5IEHB 3IB4A 4IRSD 1SHMA 4XPBH 4JY5H 4YHYC 5GRUH 1UWEL 4Z0BH 4C59B 1OAZH 1UJTA 1FL6A 3D3VB 3LKSB 3WBDA 1PW3A 1CF8L 3OZ9L 1XIWC 1KB5H 4YC2B 3FT3A 4U6VL 5GIRA 2ATKB 2OZ4A 3CMGA 3IT8D 3OBAA 4LIQH 1R3JA 3MXWH 1IM9B 1P5VA 3OGCB 4LSRH 1YEDB 4LPTA 4J8RA 2IADA 5HDBF 4U0RB 5DFWH 1OF2A 3DVFA 2P5EA 3DXAD 1I3GL 4GAGL 3DYMA 4NM4H 3QIUA 3IFPB 5JXED 1S9XA 3AM8C 1QG3A 3MRCB 3LB6C 2X4SA 3JWOL 5TE4H 1IM3B 1ZHBB 1FORH 3HTLX 1NCNA 5ERWA 1IKNC 2ED8A 4PJAE 5J1AA 2ED9A 3W0WE 1VACA 1JN6A 3L9RA 4YAQB 1UEYA 3BZEA 4YHPA 4F2MA 1JF5A 3V0WL 4BH8A 2A74B 1BVLA 1U8JB 1H5BA 3QO1B 2X41A 4NO0A 4Z7WA 4HBCH 4QLRA 1KYOJ 2CLVB 4IRZL 3RWGA 3MGOA 4POZD 2FSEB 5FV1L 2Y25A 4ZFOA 1EUUA 5BCAA 4N5UA 1BAFH 3CMOH 2VLJB 4QY8A 3SDDC 1XGUA 4L4JA 5C0EA 1UM4L 3DBXA 2DN7A 4XVSL 4YPJA 1W0VA 1CLZH 3F7VA 1T6WA 5JO5B 4HXAL 3S7GA 4OCXH 3TO4D 1YJDL 1GGBH 5ILTL 4WV1C 3KYKH 1G7HA 1KSRA 4Z7VF 1NUFA 2NY6C 3GSNH 3TN0D 2NW2A 3GMLB 4JDTL 2N1KA 2B7DT 3FN0L 2KQMA 2V5RA 4KQ4L 5F96H 4HUKB 4MJIB 4H1LG 1TITA 1LDPL 3V79C 1MHHA 3DMMD 3D3VA 4IEFB 2F19H 3LKSA 5HHQB 2X1QA 4Q2ZA 1TZIB 1T20B 3THML 1W0WA 2BSRB 2ATKA 2RQ8A 1MUJA 2UZXB 4I18B 5TGBB 3MRKA 1JF6A 4NT6B 2Z93B 5DYOB 3QDGD 1JK8A 3LMJL 4GG8A 4E42B 4L8BA 3BAEH 5I16A 1BEYH 4QYOB 1T89C 2APTA 2FJFA 4PB0H 1D5IH 3FONB 2WIIA 4FTVD 3VCLB 3RGVD 3TA3C 7FABL 3AFLA 4FNLH 4M43L 1AO7B 4XP4L 4CUCA 3GBNL 3C2AL 3R8BB 2VRAA 1TVHA 2NLJB 4PJAF 4ZNEE 2N4IA 2BZDA 2VABB 3QEGL 1S9VA 1CLYL 2DBLH 5K33A 1YEJL 3G08B 1IMHC 3MXVH 1QSED 2OBGA 1NC4A 2GJZA 3QO1A 1WC7B 4LL9A 4M7ZB 4YPGB 2DS4A 3U4EA 3WYRA 1OP9A 3IAQA 2WUCL 5MEND 3MV8E 1S9WB 4G5ZH 3FRPA 1V7NH 3QNYB 4F58L 5DK2A 3G04A 2ICEA 4IRJD 5CJ5A 2NX5E 1AGDB 5F9WC 1A6WH 5H37H 2EYRA 3CZJA 4YXKL 1A8JH 5KSUA 4OLUH 2EIBA 1EO8H 4PRHE 1Q94B 1SJXA 3PGCB 4I77L 3C2SA 5HHOD 5I75B 4F80A 1U3ZA 1U8LB 4P5TD 2CIKB 3TH4T 3MV7A 3QDAA 4V1DA 1N5AB 4Y5VC 5FO8B 3P4OB 3ZDZE 2AV7A 5HHQA 2ZG2A 3JBG7 3VMOA 1I7RA 1RIUL 2BNQE 4LSVH 1IRAY 3MJ9L 3UJTL 2ADIA 2D4FA 5BV7L 1PAMA 3ZKQD 3EOAB 5B39A 2P5WE 1G6RB 5JHDA 1CT8A 1X5LA 2UYLB 5SV3A 2A9NL 2XT1B 3N06B 5C86A 4Z78A 2HYMA 2WW8A 2Q20A 4U1MB 4KJWC 5I17A 4M7JL 3BEWA 3MREB 3O4OB 2H9GA 4N0UE 1D6EB 4R2GD 4Y16C 5KOMC 1RJZB 2NLJA 2ZOLB 5E6IC 1TJHH 4H0HB 3G08A 1I1FA 2XKSA 3WN5B 1RVFL 4GJTB 4YHIA 5D7IB 5F7LB 4LHQB 5K9OA 3L5XH 4U6HB 4ZUUA 3BKYL 5D9SA 5JDSB 4LPCA 1CK0L 5A2IH 3K2MC 5D2NB 4ODHL 5GS0L 1PEZA 4JRXE 3QIWD 1S9WA 2W0PA 3KXFB 5E0QA 3QNYA 4XNZB 5MERA 1NMBH 3DX7A 4XBGB 4CJ1A 3N1FC 5C0FA 3NAAH 2FB4L 4K23H 1T66C 1AGDA 2VZOA 2KZ1B 5C7XL 3U6RB 2LAAA 3L3KB 5DRZB 5D5ME 3SGEI 4POYA 2G60L 1OP5H 1MI5A 5GGRY 3V0VA 1II4E 4YIQA 3HC4H 3RTQD 3BKML 4G8EB 4TNWK 5EFIB 3REWA 1LE9B 4JANB 4LKXB 4KGJA 5IHBA 1KLGA 2LE9A 4ZS7H 3I2CL 4PLJD 4XXCA 1AIFB 3ZDZF 2EICA 3JWOH 1NCCL 3T1FA 4P59L 5DJYB 1HCFX 1ZS8B 2VLRE 4LNRA 4Z0XA 4PRNA 4EI5B 4CMHC 1EGJL 1U6AH 2E3VA 3ARTA 1H3TA 5IW6B 3T65B 2B8OT 4JPKH 5LXGH 1A9EB 2XWTA 3W11D 4CDHA 3QDME 5AAMA 5C0CD 1S7XB 3OB0K 2YZ8A 3O3EA 3HUJE 4NNYB 3FQXA 3MBXL 2WWMD 3C6SA 1A1MB 3MBEA 5ADOL 4ZAKD 4X7EC 5GS1C 4UT9H 4XI5D 5KANG 2IQAA 2VZ1A 5CEYB 1V3JA 3B3IB 1G9NH 5E08L 2BCKB 1K4CA 2WBJB 1SBBA 4UU9B 5IW1B 1E28B 4JHAL 1WWAX 1NSNL 2P24B 3GUTB 4HUVB 4OFDA 2WWKO 4YC2C 1JZ4A 2NY3B 2YK1H 1GOHA 4YK4C 2EE6A 4P99A 1GSMA 2PTTA 4D0DA 2HLAB 4G7VH 5F88B 1Q9OA 1T1YB 4Y0GA 2NTSP 3KYMB 5C0IB 3VFRA 5CJBA 2NCMA 5J11C 4HQQL 4Q0XH 4JRYB 2QKIB 2JJTC 1A7OH 2MQCA 5D5MF 3RI5K 3GI8H 1VESA 4AH2A 3O3DA 2Q8BH 4JEGB 3K81A 4WUUE 5CP3A 5BOZG 1EERB 5DVMA 1UM5L 1YDPB 5TQ2H 3LMJH 1NGWB 1KXVC 1KPRB 4M6NH 1H9VA 1CICD 4RSVA 4TNWF 4ZQKB 5DJ0A 3RIFK 4KHXH 2DLHA 3TO2A 1FFOA 1KTLB 4HULB 2FRGP 4HWEH 4LKCA 2RB8A 4PJ7E 1FVDB 1PQZA 5J56B 3SJVE 1LEKB 1UXWA 4X6BB 3AREA 1U41A 1JNNH 4OZHE 5CEZE 4I48B 3BXNB 1JGUH 1A9EA 1YEKH 2VL5A 3PDOA 5DDHB 3IGAB 1CI5A 4AT6B 3Q6FB 1HCVA 1PGRB 4L3CA 2J7LA 1S7XA 3HAEH 3HUJF 5I0ZA 4J4PC 5BS0B 4NNYA 4FQ1L 3CFDB 4NC1C 4NWUH 4F7CB 3IXAB 4N9GA 3W2DH 1RK1B 3HE6D 3KHOA 5ESVB 1WAAA 4OQTL 3IJHB 1KIQB 4LLWA 2HKFL 4QHUB 1R3HA 4AM0A 1BX2B 4PJIB 4KROC 3D9AL 4FA8A 2O61B 2DKSA 1LMKA 5E70A 2OP4L 1X5IA 4MCYA 5IW1A 2IH1B 5LKNA 3O6FB 4M5YH 4HUVA 4X5WB 1HHJA 3WLBB 4OM0H 4NJAL 1IQDA 2I27N 2VC2H 4HGKC 3QZWG 4O2CA 4I18C 4UAOB 4YWGH 4QRPE 2LVCA 4JKMA 5AEAA 4F37K 3IXTB 3SGKA 1A3LL 5HBBA 4AENA 3ZE0F 4H88H 5MEQB 2G75B 3EJYD 4U1HA 3RI5F 4YUEH 2F74B 5FHAH 3T0XA 3OAUL 4CVZB 4HKJA 2Z92A 5FKPA 1R3IL 2V2WB 2J6EL 4K3DL 5DMIL 1X5ZA 5F7NC 5BMFL 3CDCA 1KPRA 4P57A 4GOSA 3RIFF 3SEPA 2PW1B 3NVQA 2EE3A 5D7KD 2YMXL 1ZLSL 1Q38A 4M7JH 4PJ7F 4RBPK 2H1PL 2D7MA 3T0EC 1GL4B 1UVQA 5D7JB 1DR9A 4Q74A 1MH5A 4M7ZC 2E7BA 3BWAB 3VXUB 1A6UL 1YNTB 4OZHF 1UQSB 4LPVA 3VXOB 2DIBA 2F9BT 2CKBL 2X70A 1HWGB 2R2BA 4KMTH 4I48A 4A6YB 4NHUA 1DEEA 2VDKL 4AT6A 1HHIB 1JNLH 3TM6A 2FWOB 5SX5K 4EN3D 32C2A 5MHSD 1NGZA 1JTTA 3ETBF 4WW1A 5KS9E 4RGND 2CRYA 3BKCL 5ESVA 4M4PA 1FZKB 5K59E 5IBLC 4Y5XA 4QHUA 3WIHA 4KC3B 3V7MA 3T09A 3DI2B 4KFZC 2A1WL 3PQYE 5FOBB 5C7XH 2PTUA 2QHLA 3G5YB 4NYLB 3VE0B 3EFFA 3QNZA 4GXVL 5HHVH 2CXKA 4HC1A 1XGTB 5E8OB 2QJDA 5IT2H 1FE8H 2AERT 3ESVF 5T1KD 3UJJL 5L2JA 2BVOA 4U7MA 1M4KA 2VLKE 4P2RA 2V9RA 1JWMA 5TQ0H 2H32B 5IROC 1TPXB 5GHWL 3GMMA 4LLDB 4F37F 5T5FH 5IVNA 1JHTA 2FX7H 1MWAB 3VFOB 1MFEH 5DUPL 5MEQA 4GAJH 3P11H 1NEUA 4NSKB 3O4OC 4JPWL 5GRYA 4CVZA 5KVDH 3BJLA 2DJUA 2IBBA 2AK1L 3OKYA 1Y0LB 2BSSB 4X4MA 1ADQL 3ARUA 4JM2B 2AJXL 3GIZL 2GCYB 3QPXL 1NJ9A 1AR2A 2P5ED 5LCVH 2AJYL 2IBZX 3QIUD 1N6UA 4KZEL 3KYOA 2B0SH 1S7WB 4LFHD 5E1AB 2B20A 4K8RH 2HMID 4AIZB 4RAVA 2P7TB 4GW4B 3VXOA 1BQHG 4NFCA 4QHKI 1I8KB 2OCFD 5E08H 3MRLA 1TQBC 2E7CA 5IKCB 4WEUD 5TE6H 4MD4A 3MZGB 1HHIA 4QXWA 5JW5A 5DT1H 2AABL 4YE4H 4NO0D 1QBML 4UIKL 5KS9F 1YC8A 4OZFA 2E7MA 2VITB 2R56H 1LP9E 4BFIB 5K59F 3SE8H 2XPGB 5C2BH 1HWHB 4AYFA 2AKRA 3EDJA 2HH0L 4LAQH 1QP1A 3ARQA 4WUKH 3D69A 4FN0A 1RZ7H 5DSCA 2VQ1A 2ZP0T 4GAYA 4NYLA 3VE0A 4FZEH 4X99B 1DLHB 3WUWG 3LRHA 4N8PA 4NFDA 4WHCA 4NZDA 1OT2A 2BOBB 3D25A 4NZRH 2VDQL 1HN1A 4X6EA 3QAZB 4WI9A 4MD0B 3DRTA 2SEBA 1M7XA 3EOYG 1MCHA 1FDLH 4UILH 5ESQB 3D3VD 4R26L 3S9DB 2YD5A 3MNZA 1A7PL 5I18H 1HH6A 4JFFA 1EO7A 3STLB 3R06A 2JK5A 1NUDA 4GXUM 4JM2A 5GS2H 3L6FB 3Q6GL 1IM9D 1U2HA 2W0LA 4ZUVB 2JB5L 4XPHL 3OKKB 4MS8C 5JPNB 1T5WA 1CD8A 3E6HB 4W68A 3KJ6H 4NJ9H 3E0GA 4HGWB 1KB5B 5E1AA 5E2UL 4LMQE 1RZGB 2NY3C 3HNTL 1RZ8A 4PUBL 4WWKA 4KGLA 4XMLL 3V6ZB 1GHFL 4G80A 3BZFB 1MIEH 43C9A 3P4NA 4MAUH 4TSCL 4U7KA 1U0QA 3J8F7 5HGDA 3MNVA 2Z35A 1CR9H 2IANB 2F5AH 2CK0L 1JUFB 1LP9F 3CSBA 3IDGA 4W4OC 1AE6H 1A0QH 3VWKB 1KTKE 3RWJB 3SKNB 3FB8B 4NHCL 1ERNA 1JNHA 3DX8A 3G6JE 3O3BA 5E2WL 5GGSY 3BO8B 5TDOB 2H26A 3O9WB 1HKFA 5CZVL 1DLHA 1OTSD 2Y9RT 2VIRA 4UDUB 3JWDL 2NNAB 3EYQC 2UZIH 3L95B 1YNLH 1LVEA 2A73B 3DVGA 4FZ8L 5DC4B 3MUZ1 3L3JB 3BUYA 4R8WL 2A83A 5DHVA 1FZJA 1QFUH 3VDAA 4MJID 1ZA6B 1S7UA 3MV7D 1CG9B 3RZCB 4P2CG 4L3EE 4I5BA 5DK0B 1T0PB 4RQQB 4S1SL 3FKUS 3P77A 3NMEA 3NFNB 2GITB 4NQVA 4U05A 1U8KA 2IFGA 4Y8DC 3HI5H 3GSNB 1MCPL 1FO0H 4PRDA 4TVPD 5I66A 2X9WA 2XWBA 4LSSL 3ZKMD 3IJYB 3SGEH 2ZSWB 2YPLE 5D7LA 5IVZA 4JPVH 3S37L 2R4RH 1GJIA 4G8GB 3F5WB 4XVUD 4AG4L 3UTSA 1OTTD 1KB5A 1AO7D 4LDEB 4ODXB 3C08L 1K85A 2BVQB 1RZGA 4R6UA 4GRWB 3DX6B 3B2UD 1MY7A 5DI8B 2ED7A 5C0ND 1HINL 3FQRB 2PN5A 1QPPA 4V2BA 4JG0H 4KKAD 4OCRL 1U95B 2HFTA 5FYKU 5J4MA 5K9QI 2R0LH 4ZYKA 1JRHL 4K7PY 4QCIB 2J5LB 5LWYL 2JTDA 3SKNA 4I13B 2GTZB 4KVCH 2ZUVA 1F2QA 3G6JF 3TNNB 4KY1L 5HHME 2BSED 2DQJH 4P49A 4URTB 2XQYG 1OQOA 4MDJA 5KAQF 1FLRL 1IC7L 2AEPL 2VKWA 4HUUA 1LO5B 5D7JC 3RL2B 2R9HD 4RGMB 1MI5D 3C60B 4RCAA 3HI1B 1HDMB 3WS3B 2PYEE 2NY1B 4P4RB 1BOGA 1T04A 5DK0A 1IGFH 1L6XA 1QOKA 3F12B 4HPYL 2GITA 4EIGB 3CXHK 2PKDA 4MB3A 2PUQT 4JFQB 1NCDH 1MCDA 4AK1A 3K8MA 4WO4A 4XZUB 1J0YA 5DD0H 4PJBB 1XGPB 4HIXL 4UIKH 3KPOA 2EC8A 3KDMB 3CH1A 3IJYA 1IC4L 2ZSWA 1RV6X 1RIHH 3PP3K 1CFQA 1HILA 1A6TB 4JQXA 1SYSB 5T1LA 2B1HH 2B1AH 1QRKA 3DROA 4IBLT 2NTFA 2IALA 2MCG1 1HSBB 1ES0A 4LLVB 4LCUB 3GRWA 1IC5L 4M1GH 5DI8A 1TPXC 2ZNXA 4DZBA 5TF1L 1YY9C 1UJ3C 1OGAA 3GSUA 1NMAL 4X7SL 3QUXA 4OZIA 2DQUL 4J1UA 4KKBD 1YMHA 1CD1B 4PGEB 1B90A 1HH9A 1UB6B 1C1EH 4DTGH 3GJFH 5KTEH 5K9JL 2OSLB 1I9RL 2XKNB 4LP4A 1VFAB 1TMCB 3N1GC 1MJJA 3KXFD 4U3XA 4FXGB 4L4TB 1Z0NA 4NGHH 3VWJA 4CKVX 5E94A 2DQDL 3S35L 1FL5B 1G7LB 4FRWA 1OPGL 1E4WH 3ZYOA 3I75A 2LVEA 2YUWA 5FF6B 1T80A 2A6DA 4ZG1A 5I73C 5E8PB 4MVBC 3RAJH 5CD3A 1TNMA 3FQUA 2PXYB 3D18A 3MRHB 5LVEA 1U93A 1G7QB 1ZV5A 3VFTB 4X6CA 5JQHC 3HI1A 1INEH 3HZYA 1E6JL 4AQ1B 5IB2A 3L3DB 3MRNB 3DO7A 1MFDL 3HE7A 2EH7H 1DUZB 2J8OA 2KL6A 2X4OB 4PGDA 5BVJB 3RWEB 1DANU 4UQ3B 5E2UH 5B38B 1S7VA 5IF0B 2BOCB 4HWZA 3CVIH 1KLUB 4HUMB 5GRZA 5GGTH 3ARED 2ZUTA 4RBPH 3X11A 3O6KL 4JFQA 1BJ1J 2XRAL 3QEUB 3GSVA 1MJ7L 3D39A 4MXVE 2DMCA 3LEYL 5DTFA 4QGTA 3VFUA 4LU5H 3N9GL 3LQAC 5ANME 3OXRA 4X6DE 3NOIA 2CDEA 1U2CA 1LO4H 1Z3GL 4FFZH 4ELKA 2Y7QA 4LCUA 3UJIL 2CGRL 4G43B 4X9BA 4ZFFA 1Q0XL 1T22B 2ESVE 4ZOEA 2WBJD 5EZLB 1XR8B 1JPGA 4MSWB 2OL3L 3ROOA 3RNKA 3A67H 4AIOA 4E41A 5B8CA 3EZ8A 5ALCH 1YQ2A 3P0YL 5D1QA 4HJJH 4N0YH 2Y1VA 5F9DC 2VISA 3UBXB 2OSLA 2VAJA 4KWUA 2NXZD 2XKNA 1VFAA 2X4RB 2GJ6B 4JFEB 3U30B 3S96A 1HKLH 4HFWB 4ODVH 4S1SH 4C57C 4BZYA 2YKLH 4S2SA 1QEWB 1C08B 2OJEA 5FF6A 4PGJA 3ARPA 4LHUA 2XTJB 3KPPA 2BNRB 4EJ1C 3QUMH 4BA8A 1KN2H 4RFEA 4WENB 3C8KB 1QPXA 4QHLB 3VFTA 3HMWH 2X4QA 3WXWL 4KKLD 1MY5A 4S0SD 4Y19A 3L5HA 1MCJA 1D3CA 1YPZB 3GK8L 3H2WA 2R23A 1HXMA 3OL2A 5F70A 3QDJE 3KS0J 4I0PA 1FHGA 1MFBL 1JP5A 3HKFA 1GAFL 3GSWB 2BOCA 1DBAH 4NRXA 1KN4H 1J8KA 5EUOA 1L7IL 2CO7B 2ITDB 5EBLB 4D9RE 4YHLH 3WS6A 1P84J 3OXSA 3O4LB 1QFPA 4DGIL 1N3NB 2ADFH 4PJDA 4PY8J 1TTFA 4U1KB 3HG1E 4R90L 2ITCA 4MXVF 5IBUG 15C8L 1GC1H 3L7FB 1WTGT 4C4KT 2EH8L 1DBKL 5IMKA 2V7HA 3KPSE 3E6FB 5I1IL 5B4MD 4IS6A 4X6DF 1RFDL 3O9WC 3OKNA 1AJ7H 5E1HB 1X4YA 3B9DA 4M6ML 4NM8L 4NNPH 1IAKB 5CBEB 4JFOB 3QFJE 2HTLD 3RQ3A 1P7HL 1C12A 1BF8A 3SGDI 2Y6SD 4UV4L 4L3AA 1LWRA 2ENYA 1WICA 3QCVH 2BVPA 4OJFL 3HAEB 3ILQD 4R4FH 3C9NA 1IAMA 3BW9A 3O6FD 4OCSL 5JZ7C 1I8LA 4MZ3A 4BKLB 2YOCA 4P2RD 4FQ2L 3AY4C 1D5BA 2CRZA 2V5YA 2GJ6A 7CGTA 4M61B 1BIIA 5I8KH 5HYEA 3MRBB 5I8OH 1XR9B 1QEWA 3NIGE 4IMKA 3VW3L 2OS7A 4XNXL 1R5WA 1BBDL 1QLFB 5CUSH 4HIHB 5IG7A 2OQJB 1N0XL 3NH7L 3PV6B 3MLRL 3WHXB 3ULUL 4MA1B 4I0KA 5TE7L 4YQXL 4N0CD 2AEIT 1KB9J 1QVOB 1ZVSA 5C08B 4QKXB 4Z7VB 2AXFB 5A16A 3HZVA 4MXQC 5F3BB 4HIJB 5CS7A 1A6ZA 3GBMH 1OARH 2QQLL 2J5LC 4X9IA 4ZXBB 1ZT4B 2D7OA 2R0KL 3T2NL 4PJ9B 3VU2A 1HHGA 5IMOB 4K07A 4N8VB 4U1KA 1YQVL 3BESR 2VDLH 1FNFA 4LASL 4ODSH 3QH3A 1JPTL 4ONHA 3CDYA 4UV7L 4OCYL 4M93B 4XXDA 3WV0A 3MCG1 5E00A 2MCPL 2YN5A 4GMTH 2HKHL 4X5XA 3C60C 4UIMA 5CBEA 3TT1H 4I1NB 2ZJSL 3TF7C 2W60A 3MLUH 5IVOA 4PTUA 1UCTA 5F9OH 1KCLA 3FHAA 2XTLA 2B2XH 3HAEA 1KACB 1I7ZB 4OQ1A 4PJAB 5KSVB 3W0WB 2F54E 4ZO9A 3T8XB 3QRGL 3EYFB 3V5DA 4Q9CA 3E8UL 1F3DJ 3CGTA 4NN6B 1E6JH 5A43C 1NKRA 4K3EL 3TIDB 5EU7C 1M71B 3T0DA 1MFDH 4GRLB 1BFOB 4LLYA 5L2KE 3RY4A 4RNRB 5F7KC 1BFVL 1I8IA 3NIGF 3MRBA 4F33B 1E27A 1YEGL 3PWVB 4MNGA 5CIPA 1AD9A 4OB5L 3P9LA 5D70H 5CSZA 3V5KA 3VG0H 5FCUL 1UCBL 4JFFD 4YXHL 4P2QA 3P3YA 1T21B 4JM2D 2J12B 5HGBB 3RWFA 2IPTH 5HHXL 3RY6C 1UKTA 4AEHL 4DW2L 1Q9WA 4UT6H 3MOBH 1WFOA 5JLZA 3CDGB 1SBSH 1INDL 2Y72A 4APQC 1EBPA 3DSFH 1A02N 4UZGA 3HN3A 4OV5B 4DGYL 4YHNB 4GQPH 3FB5B 3MJ9A 1J88A 2NY5L 3UJIH 1RZKC 5EU6A 5FYLD 2AXGA 4YEEA 3SDYH 4N1EA 4PJCA 3NCMA 3OHXA 4O02L 3K80A 2X05A 1G7JA 1S5IL 3O2WH 1DQLH 4Q7DA 4MDIB 1TTGA 3TBVB 5HPMA 4PY8I 3BIKB 5E5MB 5IV2A 2PXYC 3DVNB 4YFLI 1EVUA 1SVZA 2EDJA 1R5VB 4NBZB 4RFNC 1Q9LB 1TCMA 1U58B 1WFNA 4XX1E 3P9MA 5FO9A 1DBJL 3G5VA 1IZKA 4C83A 4PJGA 4IMLB 3TT3H 1K3IA 3G6AB 1QSFE 4NKMB 3UTTE 1JMXA 3TNMA 3T8XA 3EYFA 3O0RH 2BDNH 5D1ZC 4OLYL 5GRJH 1JHLL 1M71A 2DOCA 5INDA 4RFOH 4M9OA 2WMPA 3RBGA 3MV8B 5AYUH 4RNRA 4NQCE 1GAFH 1S9YA 2J8HA 4HEME 5I1AB 3MJ8A 2MOVA 3HNVL 1NUNB 2NX5B 3FCTB 3MODL 4YXLH 2YBRA 4O2EB 1L0QA 4LEOB 2YC1A 3MUJA 1NFIB 3JV5A 1T7ZA 3RWCB 4JGMA 3VA2C 1T7WA 4PRHB 4HIIA 4YHZL 5CILH 3MLVL 5ITBL 2R69L 5I1IH 2VXVH 4M02A 2D0FA 1G9MC 2PCPA 2KH2B 5D7LD 1G6VK 2KBGA 1E4XL 3JTSB 1EGJA 4JZOA 3UTSD 1JGLL 1YN6B 5KSAB 3HNSL 4U1IA 5FB8A 1U8PB 1FC1A 2BNQB 4O9HL 4K7PL 1ZT7A 3K3QA 5FV2A 4D8PA 2W9EH 3CK0L 4OSUL 4XVTL 2ZUQB 4X4XB 2IAND 3GHEH 4DKDC 4YBQD 5IFHL 2ZUXA 3VFVA 3BIKA 1ACYH 4FQ2H 3QHFL 3HFMH 4Z9KB 4N0UB 5L7XL 2HT3C 3MLYL 4JDZB 3AUVA 3X12B 4U1SA 4ZNEA 4XNXH 2X4UB 1BBDH 3UO1L 2COQA 3ES6A 3DIFB 5E2VH 1WZLA 4PG9A 5CZXD 4NP4H 4ZO6A 4NKDA 1S7SB 4HZAA 4NQUA 2ZKHH 1MJUH 3IJSB 2F53A 3GMPA 2Y4SA 3H42H 4YBLB 4FHBD 3EYOA 5FYKH 4QRRE 1OOAA 4U2YA 5DD6B 1FG2A 1J05A 2XA8H 4JRXB 5DJ8A 4Z7UE 1WITA 3EHBC 3CC5A 1WQVT 5I1AA 4LEXH 3RZCD 4QRSA 1MLBB 1CLOL 4KQ3L 5EOCH 1JE6A 1T7XA 4OAWA 3MJGX 3QEHA 5D5MB 4WO4D 5FUOL 4BSVB 2VDRH 3EW3B 1NFIA 1ONQA 2NY0C 3T77B 3U83A 1N2RB 3RWCA 3AS0A 1R5IA 4PRHA 5F1NB 2I9TA 2Q7YB 2MCPH 4KDVA 1MF2L 2DQCL 1RZFL 1IGIH 1B6UA 5C0GA 2X4PB 4PREA 5CBAA 4OD3H 5I15H 3MLPA 4XPTL 4PJFA 3ZLQC 2AJ3B 1ZSDA 2AEWA 5DO2C 4Q9QH 5TFSL 1E6OH 2VLRB 4HIEB 4HUXB 1ZK9A 4L5FL 4KKCD 1OGAD 1BZ9B 5BRZE 1KYOK 1RSFA 1PLGL 2BJML 3QUXD 3HI6L 2P5WA 3QDMB 1AFVH 3E8UH 4OCMC 4JFHE 4BFGA 4OQTA 1INQB 4JO3H 3HUJB 4U0QB 3D1MC 1MLCA 4U3CA 1M6OB 3DTXB 3EZJB 1EEUA 4O2FA 3VGAB 4PP1D 4S1QL 3VWJD 1DUYA 2FATH 5F9JB 1HSAA 3ZKXC 5KVFH 3ZTJH 5B38G 3BGAA 4PY7B 2OTWA 1MHCA 4J3UA 5DEZA 3I9GL 1TJIH 3QXTA 1C5BH 1OAQL 3MSPA 1KT2A 1S7SA 4G7YH 1HYSD 3WKNA 1B0GB 1P7QB 3FOMA 3RPIB 4AEHH 4ZXBC 4QO1A 4NNXA 5ENWA 2QL1A 4H8WC 4M1CD 5ACMA 4F9LC 5GZNC 2MFNA 1FZOA 4RX4D 3W5NA 1UWGH 3ALXA 4Y2OA 4Z7UF 3WFEL 1GZQB 2G5BA 5KZCB 4JRXA 1TCRB 2B5IB 1SMOA 2NY1D 2IBGA 3QUYA 1J8HA 2X4NB 1AY1L 1MLBA 1SJVA 4NUJB 3DURB 3CXDL 5BW7C 3U36B 3LS4H 2CDGA 2VAAA 3BSZH 4L8CA 4ZUSB 3JV6A 2V5SA 5FA3B 4WFED 4J6RL 3D39D 4O58L 3UZQA 2Q7YA 1OP3H 3UAJD 5C6PB 2HJLB 4AEIL 3IDXH 2ICWI 3O41B 4RWYH 5DMGC 1Z9SA 1RZJC 1UH4A 4YEFA 2OK0L 4PJ7B 2YA0A 3SJVB 1GGCL 3ARGB 3CAFA 1JPSH 1KBGH 1FO0A 2VLRA 1CFNB 1EIBA 4HIEA 4OZHB 4HS8L 2Q6WA 1I75A 1S78C 1BQUA 3VH8A 4G9FA 4OF6A 5EIQA 3RDTA 3PV7A 1A9BB 4F3FB 2I5YL 2FL5B 4KK6D 3VFMA 5D1QD 3UPCA 3QXDA 4JFYB 5I19H 4M62L 4Y1AE 5IESH 5DURB 2JJSA 1SY6L 2BXYA 3WFBL 4WI5A 3H7LA 3L5WA 5CJXA 1KJVB 3O2DL 3VDCA 1QRNB 3FRUB 1F45A 2FJGB 3NCCB 4PS4H 3SGDH 2H6PA 1ZLWK 4QOKE 3U9PH 1R3KB 5ITBH 3ECBA 2EDTA 1RJYA 2APFA 1K5NB 1XFPA 3UXFA 2DQEL 1OSPL 3LKPB 1RIVH 2E6QA 3ZO0A 4QRPB 4OGXL 4ORGB 4OZ4B 3ZYJA 3D6GA 3ARBA 3O3UN 4S1DD 3I02A 3KPRB 3BDYL 2AQ3A 2B4CL 3MROB 2RAMA 3L1OL 4M48H 4JJHA 5A3ID 4DQOL 4LOUC 2E9WA 2NY7L 4LRIC 4WRLA 4WUUA 1IGTA 3PWJB 4FXKA 2K3TA 1GGYA 1GVIA 3RU8H 3WD5H 3QXAB 2KPNA 3CLFL 3DX9B 4H25B 1HE7A 1ZGLP 2HRPL 5C71A 4XPFL 3T2PA 4BZ2H 4K7FB 4N90D 2I60H 3QXWA 3GSXB 5F21B 1FV1B 4ETYA 4JPIA 4KK5C 3T2OA 4F15C 3B2UC 3R0NA 5EN2A 4OZHA 1LK3H 5L6YH 1KCVH 2R1WA 4IHOA 2D7QA 1B4JH 2X1XR 1P9MC 3VGGA 4XGZB 5J1SC 1MFCL 3ULVH 3VXMA 4O5LH 3T4YA 2OM5A 2VN4A 1DN0A 1RMFH 3O8XB 5KS9B 5HDQH 1S8DB 4YDIH 1S7RA 1RULH 5D6CB 4L29B 3ZHLA 2GJ6D 3AMLA 4KV5E 2VUOA 1Q72H 1K8IA 3ARVA 3TJHD 1KJVA 4PD4J 1PG7L 2AK4A 4TULL 3FRUA 2H8PB 2FJGA 3PQYB 3QUKA 4JDVB 1NCUA 4OIIH 5HYJA 1PZ5A 4LCWE 5IM7A 4N8VG 5KSAC 3VGBA 5JHLH 1R3KA 3GJFA 4GKSB 4EXKA 3U82B 2CRIA 3MOQA 4JCLA 3LKPA 3UZEA 2DQCH 1OAUL 2X42A 1RZFH 2VLKB 4XXCC 4WDIA 4K94L 3V95A 1VFUA 1RUPH 4XBPA 3V5HB 1NBZA 2ZUQC 4RIRB 2HFFB 5DEGA 1U8OB 4P9HL 3S37X 3MRPB 4WFHD 5J12B 5DD5L 3J7HA 3BT2H 4OLXL 1YEIH 1PY9A 3B8SA 5ECJE 3SPVA 2BP3A 3QXAA 1KJ3H 3DX9A 3NA4A 2V2XB 3QQ4A 3IRPX 2UWEE 3OG4B 3MBEC 4Z5RB 2PO6B 4KRPC 3ZTNL 2F58L 1FN4A 1UYWL 5GGTA 4PLNC 4CNIB 5JXAH 1RURH 1EHLH 4D3CL 3RWHB 2NZ9D 2V9QA 3RKDD 2IG2L 1KC5H 3I3BA 5HYSA 5F89A 2DD8H 4K71B 2BSTA 2JJVA 3OSKA 3TBWB 3FRPG 5IJKC 5GJSH 1PSKH 1P2CA 3RHWK 1YYLH 3EJZD 3VXPB 5SX4I 5CCKL 5C07E 1U8HA 1VDGA 3O8XA 5KS9A 1F3RB 5FGBC 1LP9B 1D9KA 4KV5F 3KPMA 3OKOB 3DOSA 2NYYC 1ZLUK 4LARL 2JLLA 3GMRA 4I3RL 1KJ2B 2X1PA 3BH9B 3PQYA 2FBJH 2EC9U 1BLNA 4XWOD 3BPNB 4K9EH 3PABB 1P7KB 1QD0A 1DE4B 1AHWB 4Q97A 2DM4A 3LAFA 2A38A 4ZPTB 5C08D 3BN3B 2GK0B 3H3BC 2VLKA 1KENL 2ERJB 5INCA 3ZMRA 3PL6A 2OK0H 4IDJH 2EXWD 4DCQB 4XVJH 2VLLB 3AREC 5L88H 1PD6A 1KCSH 5ACZB 2Y5EA 3NPSB 3QUMA 1R0AL 1CQYA 1MCEA 4LLMA 3VGAC 3WE6B 4PJ9D 4PV8B 2RJMA 3P73B 4FQHB 3O11A 1S7TA 2UWEF 4U2ZA 3FFCA 2QHRL 2V2XA 3QI9A 4FQJH 4Z5RA 4MNQE 1FBIH 2B39A 1W8NA 2EKSB 2HVJA 2FR4B 1P4BL 3ET9F 3HMXH 1F11B 5D1XB 2HLFD 4CVUA 3W39B 4M62H 4CGTA 2ADGB 2EXYD 4J12A 2Z8WC 1ZA3A 1NAMH 4JFZH 3GMNA 5FO7B 3VFPB 4XCNA 1XCQB 1EMTH 4LSDA 3SDAB 2GAZA 1EXUB 3NZHH 4H1LH 2R0ZH 1ORQA 3EOBB 1CGVA 3P4MB 3W0WD 2FD6L 4HKXA 1MCBA 3CFKA 3PHQA 3S35X 3FQWB 4PR5B 1S5HA 2ZUUA 3X3FL 3EYSL 4XB8A 3RHWF 2H2SD 3VXPA 3QEQB 4MA8H 1QSZA 1YEEL 3TZVA 3F8UB 2NXZC 1MHEA 4R9HA 4GRLD 1JV5B 3G5ZA 4BQ8A 5IB5A 2XFXB 4NQEE 3F58H 4HEPG 3G6JB 5GSRA 2WUBH 4P3WA 4R96A 1T2QH 2ZOKB 3R1GL 2C9AA 5E4EB 5CSGA 4JZJB 1QA9B 2X44D 3LDBB 4R4BB 5C6TH 2CIIB 4NC1E 1BECA 3QG6B 1T03H 1FNHA 4MQ7B 3OKDB 2GK0A 5FKAA 1MAMH 5H35B 2X7LB 4PBWD 4DCQA 4N8CH 1VA9A 1EJOH 4L3EB 4XCCL 2P44B 3EO9L 4GRMB 4X6FB 1SJHB 1CD9B 5DHXB 1NGPH 5C0BA 4DAGL 3KYNA 1PG7W 3IS0X 4KTDH 2OZ4L 1YEHH 1F11A 1OSZA 4K8RD 5D1XA 4OLVL 3WNKA 2YPLB 1BVZA 4I0CC 4Y89A 2OXHA 4QHMA 5SWSA 1QSVA 5JA8B 2L0DA 1WBXA 1WBZB 5C9JB 3VFPA 4ZNCD 4LPWA 2YD4A 1Z6JT 2PYFA 3SDAA 3WNPA 1N8ZA 1XF3B 3BFOA 4B53A 3GIVB 2F8XC 3FQWA 2WM0A 5MI0C 3T0EE 2F53D 4KXZH 1RJLB 5E7FA 3LVEA 3W9DA 2RGSA 4OKVA 5AUMB 5IHZB 2BNUA 3MO1A 5IP4A 1SYVA 1J1PL 2BHUA 3MLTB 3U7YL 3MV8D 3KLAB 1MSPA 4PB9L 2EEBA 1MCNA 1QHOA 2R4SL 3IETB 4YZFF 1FGVL 4P9HH 2ZOKA 1FIGH 4LQFH 5F1SA 1XH3B 4WW2A 4UT7H 4ZFOL 1H0DA 4R4BA 2CIIA 1F90H 4XBEH 43CAA 5JR1L 3FQNB 1KTRL 2DM2A 1RQ5A 4HCRH 4XMKH 4HT1L 4TOYL 4PRHD 5EO9A 4KJQD 4EBQL 1EA9C 1EHXA 1ZT1A 1F4WH 2PYEB 4UDTB 4TUOB 5CD5D 1K6QL 3GSRB 5GSVA 1M7DA 1J1XL 1T1XB 3LSOB 5HGHA 3WIIL 2JE8A 1A14H 5GS2D 2ZCLL 3BYYA 5EU5B 1FJ1B 5GJTL 1D5XA 3ZL4H 5CHNA 5JIKA 2JJUA 5CINL 2A0LD 4YDJA 3X13B 1T0NA 2HG5B 2P5WD 1MQ8A 4NRZB 1OCWL 5CSBA 5GQBA 1F5WA 1Q0YL 2JB6A 4PJ8B 4CMMB 2JELL 1AKJB 2XA3A 4FQXB 1ZWIB 4XNUH 3FL7A 1FNSL 2E8ZA 4ZTOL 2KQNA 2WNGA 5GGVY 5KN5B 2OL3A 2ZPKL 4N5EC 2QQNH 5HD8D 1OGTA 2VE6A 3UC0H 2J8UE 4K3JH 4O51B 1TZGH 4J3XA 4MA7H 3KWWB 2CLRB 5BJTA 1F58L 4X9GA 1BWWA 1ZEAL 5EUKA 4P5KA 5J12C 3W81A 3MPCA 3GJEB 5AUMA 2E7HA 3IU4H 4YX2L 5DEFA 5M95B 1KENH 3HB3D 1RI8A 5F6HJ 1B9ZA 3S36L 4ORZC 3BIBX 3CPLA 4JRXD 5SWQA 3SOBH 3CLEL 1PYWB 5L0QB 1J8HD 2NY2D 1XF5A 3DV6B 3ARYA 3QHTC 1U8MA 1LDSA 4TTDD 3WHE1 3RVVD 4JFDA 4I3SL 3S88L 4OD2A 1BF2A 3KPTA 3SDCB 4K71C 4Y5YB 2YEZA 3CVHB 4ERSL 3TBSB 4JVWA 1LO3L 4UDTA 4L8SB 5EIIB 4WWKC 5I1CH 5J89A 2FGWH 1YY8A 3QIBB 1Z9LA 2GYSA 5DVOA 4GBXA 2VLRD 1SEBB 5DRWA 5EA0H 1MCCA 3ZE2E 1LGVA 4LCCB 3LS5H 1OAKL 3X13A 1UA6L 3QDMD 4X8JA 3BD5A 2E27L 2Q76B 5DFVC 4HXBH 3V4UH 3OAYH 4PJ8A 4OF5A 2GFBB 4HJ0C 3BQUB 5ANMB 4X6DB 1AKJA 3UTZB 3NFPB 1I3RA 1GGIL 3R1GH 1MHPL 4BSWB 3RVUD 2ZUYA 3LKOB 3ILPA 3EOTL 1REIA 2J8UF 4JO2H 3ZT5A 4E5XB 3ZHKA 3B9KB 5H94B 2ESVB 3LKNB 2F8OA 2YPKA 1MOEA 4X9HA 3WXVL 3NPSC 4LSQH 1NGYB 1YMMA 2PF6A 3GJEA 3F6IA 2A9MH 3LN5B 3VFWB 4ZTPL 1AD0A 5L9DH 1ZGLB 3W9EA 5AZ2H 3TPUB 2Y36L 4PBVC 2ARJA 5KZCD 3SKJL 4LVOB 3DLQR 4OLWL 1QLRA 4JO4H 2W9DL 1PYWA 5I6XB 3C8DA 2IEPA 4F7TA 2D7NA 4JRYE 5JUEL 4KTYA 2CXGA 4PRPE 3HS0A 1IGJB 1OAYL 2W92A 3QUZA 4JN1H 5ISZE 2I07B 4WUUD 4NZUH 1GPOH 4G9DB 3TBYA 4JR9L 3DUUA 3SDCA 2NXYC 4ZUWB 1NBQA 5KSBE 1EFXB 1LNUA 3CX5J 1CE1L 4PLOB 3FMGL 2H41A 1NBVH 5EOTA 3QDJB 2UZYB 5EIIA 3DJ9A 3ARGD 4JO1L 3QIBA 5GRVL 3AS2A 3ZE2F 4P23A 3SKMB 4BQCA 5I1EL 3VDBA 4HK3N 1ZMYA 4OZFG 3GMQA 3TFKD 4G6AD 5ID0B 3LPWA 1U8QA 1SEQL 5ID1B 4M4RA 3HG1B 4YBQC 1JF1B 3F6LA 4JZJC 4XRCB 2CLZB 5EULV 1NAKH 3LDBC 3MNWB 3DARA 3FQTA 4R4NC 4YR6A 3OKMA 3HCVA 4PB9H 4L4VE 3QFJB 1N4XL 1FGVH 1T5XB 2WINB 2AK4D 1FAIH 1U9KA 3TVMB 5JPMA 5DRXB 2JIXB 1ZAGA 3UPRB 2A6JA 1ZLUH 1JGEA 1EEZB 5ADPL 2V2TB 5SWZE 4H5SB 2CO6B 1MCIA 2YUXA 3FT4A 2NMSA 3LN5A 2EDWA 3K8KA 1PFCA 1ZGLA 4DWHA 3FFDA 1U8NA 3F7YB 4X9FA 3UTOA 3IDIB 4J7RA 4X7FC 3EFDL 3RWIA 4JM4L 4OLZL 3D2UB 5SX4H 3Q1SL 3K4AA 3MRFB 5JNYB 3VJ6B 1VPOH 4B5EA 1RHHA 2JCCE 1QLEL 2PR4L 4UMGA 1YEFH 4X0KB 5J13B 2NPLX 2WBKA 5EZOH 2YR3A 1ND0B 3NIFE 5EBMA 3HC3H 3MRMA 4H20H 2JKXA 4G9DA 4HK0B 5FXCH 5KSBF 2C26A 4CU6A 4W70A 3BX7C 1I85A 2O26U 3H9SE 4K7PX 1P4LA 4KMLB 3VRLE 4DFHA 3LQZB 4WI6A 1UWXK 5DUBB 1OTUD 5F7EH 2YSSA 5F8RC 4WVRA 3BN9D 5FA4B 4OZGA 1RU9L 3DHJA 3QULA 3QUXC 3WEXB 4ODUA 3QO0B 1B0RB 3OWEA 2FECL 1XF2B 2CK2A 4M3JA 2EDOA 3D85B 5IK3B 2VSCA 3MLSH 4MX7B 4P46C 4XRCA 5GGSA 3KPSA 3VRIA 1FVEA 1L9NA 4RRPG 5BV7B 2XG5A 1JHKH 4MJ5B 4ZD3L 1FNLA 3O8XD 5HHPA 3WDJA 4EI6A 1D9KD 3GKWL 4ZFZA 1N64L 4ZO7A 1MAKA 1WWCA 5I1LA 3I6KB 3C8HA 4QXGH 4UOJA 5E7BA 3RJQB 3DXAE 2WANA 3PQYD 2RFXB 3MMEB 1K4DB 2JIXA 4UTBH 3SCMB 1IJ9A 3GHBH 2EO1A 3X3GL 2FEEL 2F54B 4L9LB 4XPAL 5E2TH 4LPXA 5C0DA 4M1CC 4FQQA 4MXWL