4P4KD

Structural basis of chronic beryllium disease: bridging the gap between allergic hypersensitivity and auto immunity
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
241
structure length
241
Chain Sequence
b'GVTQTPRYLIKTRGQQVTLSCSPISGHRSVSWYQQTPGQGLQFLFEYFSETQRNKGNFPGRFSGRQFSNSRSEMNVSTLELGDSALYLCASSLAQGGETQYFGPGTRLLVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYSLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class II histocompatibility antigen, DP alpha 1 chain
publication title Structural basis of chronic beryllium disease: linking allergic hypersensitivity and autoimmunity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 56
structure length 241
sequence length 241
chains with identical sequence H
ec nomenclature
pdb deposition date 2014-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4p4kD02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4p4kD01
3HG1D 3P4OA 3LSOA 3V4PL 3V0AC 4PJ5E 4ZTOH 5JOFB 1WAAF 1JPFB 4G9FE 1G7IA 1QP1A 4H0IA 4JJ5B 4BJLA 1NBYB 4ERSH 25C8H 1QRNE 4JHAH 2G5BB 1IT9H 5DGQA 1NGQL 4JHWH 4K07A 3LKOA 5MERB 1QHOA 4IOIA 4K9EL 4X5XB 2ATKA 2J8OA 2Z9TA 3ULUL 4PLKC 4ZTPH 4KJQD 2YEZA 3BIBX 1VEMA 3ZDYF 5F71A 2EH8L 3QUZC 1NAML 2BJMH 3E3QC 2N7BA 1T7XA 4PJHF 4F15B 4MDIA 1CLZH 2J6EL 3DX8A 3L3DA 4GAGH 2D7PA 1UB6B 1PEWA 3IKCB 4OFDA 4R96A 2R2EB 5BV7C 1AO7D 1TNMA 5F6HJ 3IJYB 5D7IB 3L5XH 3TP4A 1D6VL 3OX8A 4WU7B 1J5OH 2VL5B 4O4YH 5T1MA 2NY6C 5HI3C 2AKRB 1XGRA 4IRSC 2I60L 5L2KA 3TZVC 3SKOA 3SGKC 4U05A 4GOSA 4XX1E 3QUKA 1BLNB 1OPGH 2GJZA 1PGRB 1EX0A 3MOBH 3VGAB 3L5JA 3S34L 4LGSB 3HPLB 1MF2H 4HXAH 3FQWA 5SV3A 5F44A 3W5NA 4U6HB 1X3DA 3LRSB 3UJTH 2BNQB 2XRAH 3SEPA 2D3VA 3SCMC 2VIRB 1HXMA 1ZANH 2R4RH 1A6VH 3FN0L 1I9RH 4JFFD 5JW3H 1QD0A 3H3PL 3HC4L 5GRYA 3RDTB 1F8TH 4X6DA 1OARH 3GM0A 4GKZA 3MACH 3HZVA 3QFJD 5JMOC 1YDPA 4HBQA 1UM4H 1KLFA 4TUJB 2A2QT 4YHYB 1EMTL 3QG7L 3OKKA 4G8GA 4IOFD 5I1KL 2MKWA 2EYSB 3TBYB 1DEEB 1XT5A 3DRTA 3TA3C 4LDEB 1CXEA 4MD4B 4X8XA 5GPRA 2AJ3B 1HZHL 2DF3A 5D1QA 3BWAA 4JZOA 2K7QA 1GC1C 4RAVB 4KDVA 1F4YH 4UT6L 3SJVE 1FJ1A 3VFSA 5TE4H 3KPRE 4U1HA 4KXZI 4OCLC 1HILA 4XNMA 3P9MA 3G6JF 5IVOA 3X13A 4ZO7A 4GMTL 4ZPTB 2DI7A 1BVKB 3CC5A 3K2MC 4RFOL 4OZHA 1P9MA 3O9WD 1NJ9B 4NQUA 5J1TC 3QEGH 2O61B 1KXVC 3QXUA 4J1UB 4WU5A 3RWDA 4WEBL 3TH4T 4JVPA 4JAMB 1NL0L 3WMSA 1DEDA 4L3CB 4L5FL 3QCTH 4XB7A 3O3BA 1K9TA 4LIQH 4NQEA 4LLQB 5KANG 5I74C 5KVFL 4RA3A 3IDJA 1A9BA 3O2WL 2AV7B 3FO9B 1JGVH 3MZGB 1BJ8A 2YD6A 3BKMH 5D1ZC 1MCHA 5CGTA 3P4OB 3LSOB 4WDIA 2Y06H 2R56H 3R8BB 1B88A 3MROA 2APXA 1G7IB 2DDQL 3AREC 4NOFA 5I9QC 1A21A 4YZFE 2PTUA 5ISZE 1XEDA 4FNLH 3GHEL 3LKOB 4KVNH 1J1XH 4IOIB 2ZOKA 1FRGH 2ATKB 4C83A 2YEZB 5IB4A 3AAZA 4YDKL 3G6DL 2RR3A 1GYAA 1A6WL 1WZ1H 1T3FB 1EBAA 1T80A 4MDIB 3GSXA 4JHBA 5HDOA 3DX8B 2D7TL 3EIFA 5EO0A 4P4KC 4R96B 4MS8C 1KB5H 3MCLH 3TFKC 4MMXC 3QEHB 4YPJA 3WJLA 3SDAA 2XG4A 1V5JA 5T1MB 4GAJL 1OQOA 1RJCA 1XMWA 1FO0A 1XGRB 5L2KB 4Z7QF 4MJ2A 3SKOB 3KS0H 3QUKB 4HV8B 2GJZB 3WV0A 5T3XE 2P5EA 4J6RL 2DD8H 1XH3A 3IT8D 3VRLE 1IEHA 3FQWB 4WHDA 2CDGA 5H94A 3SQOL 1INDL 1C7SA 4MB5A 5CJ8A 4TPRL 1FZKA 2DBLL 3BZ4A 4NBYB 4S2SA 4GG6A 5DD6A 3KJ6H 4G6KH 4J4PC 3RWIA 4DGYL 1XF4A 1H3PL 4KI5C 3AU1A 2BC4A 3LHPH 3QUXC 1MWAH 1X5IA 4MMZC 5E2UL 2Y4SA 4YBQD 4X6DB 4HJ0C 4U49A 1FH5H 4GKZB 3HZVB 1YDPB 4PLKD 2EE2A 4XVUC 3MNWA 4JG1H 2A9NL 4YE4H 1JGLL 3OKKB 1WZKA 4G8GB 1NLBL 5JQ6H 4XPFL 1RI8A 3QUZD 3DRTB 2R8SL 2DS4A 4NHCH 1SMOA 4MNGA 4TUOA 1R6VA 5D1QB 1BQHA 4JZOB 5IBLC 4ETYA 5JR1L 3ROLA 2BY1A 3IJHA 4JB9H 1FNAA 3U46A 3DV6A 3MR9A 1BQHG 1YQVH 4QXTA 5M94B 4U1HB 1HILB 3OKNA 4HS8H 4XNMB 3P9MB 2NY6D 1KT2A 5HI3D 5HJ3A 3VH8G 3X13B 5GJSL 4DVBA 3C8KA 3CC5B 4IRSD 5F1NA 3V8OA 1DBAL 3TZVD 4I9WE 3NN8A 4NC1C 5DEZA 4U7KA 4XMPH 3QXWA 2O93L 4MJID 2IGFH 1JUFA 4WU5B 3RWDB 3UAJD 4PD4J 1HNFA 4HCRH 3FN3A 3O3BB 1ZLVK 1TETL 3KGRA 2H32B 4NQEB 1MAMH 4NN5B 3NIDF 3IDJB 2JB6B 3SCMD 4LPWA 4H25A 4ZG1A 4OGAC 4GKNA 4WDIB 4YJZL 1NAKH 2HWZL 5D72L 1JZ7A 5FYJE 3ELAT 3MROB 1YEKL 1PY4A 1JYNA 3N1FC 3QZWG 3MSPA 4TVPD 3CVHL 4RBPK 3EJJX 1TFHA 1P7QA 1PYWA 4K8RC 5LCVL 4P9HC 3T2NL 3U7YL 5CP3H 1FORL 2IANE 2ZOKB 4OLVL 3TA3D 4C83B 1QOKA 3ZMRA 5LKNA 5IB4B 3AAZB 3V7AG 4GRWB 3KLSA 5GS2D 5KS9A 3GSXB 1JFQH 5ESAA 1I8LA 4U6VH 4YC2B 2DQTH 5EO0B 3RVVC 4AENA 4F15C 3EYOA 2QSQA 3SDAB 4PRDA 1FO0B 2ICCA 1ODAA 2VZ1A 4NFDA 4CADA 4HFWA 3VFWA 4NQDE 1ACYL 2Z8SA 4KZDH 2P5EB 1XH3B 5LGHL 3DURA 1LDPL 4ZSOE 3O11A 4JZJA 3P11L 5HY9A 5D1ZD 2DQCH 3VGAC 2CDGB 4QCIA 5H94B 1BQSA 3X11A 1FZKB 1QTYT 4URTB 1NGPH 2VDOL 3BZ4B 4ONOA 3M07A 4S2SB 4GG6B 3ARED 2ESVD 5DD6B 5BW7C 3QH3A 3RWIB 1DUZA 2VLKA 1Z9SA 1EEZB 4N0RA 1W8NA 3ARBB 3AU1B 2BC4B 1NAMB 1AC6A 4LVEA 1CI5A 3HRPA 3FRPA 1ORSA 1IE5A 1ZS8A 3RDTC 1F4XH 3VDAA 1I9JL 3SQBA 3FRPG 1I7TB 3MNWB 5DZOA 4XXCA 3PDOB 4UBDD 3S5LA 5D96B 1U8LA 2XQBH 4UT7H 3SGEI 4YHYC 1MQ8A 5IHUH 2QADC 3S5LG 2F15A 4MNGB 4NJAL 3SDYL 1BQHB 4P4KD 2CXGA 3ARDA 1IGCH 3TFKD 1N6QL 3DV6B 3MR9B 4NC0B 4QXTB 4Q0XL 3RUGE 4R90H 3LEXA 1IAKA 3OKNB 1ZGLA 1KT2B 4BZ1H 4DVBB 1SM3H 3C8KB 1TLKA 5F1NB 4C4KT 1B0RA 1J1OL 4PJXE 3DO7A 3GSUA 5K93A 3NN8B 4CVWA 4YDJB 3O3UN 1NCUA 1FYTA 3SE8L 1JUFB 4CMMA 3MLRH 5ANMA 5D6CA 3VMOA 1TJGL 3RVTC 1N64H 5IFJA 4OGYL 1CN4A 1HHJA 1HKLL 4KQ4L 5GISH 1KIQA 2E9BA 2VXQL 4JRYA 1OSPH 4H25B 3VXMD 4YK4C 1GPOH 2Y72A 2XKSA 4AJ0A 5I66A 3O3AA 4GKNB 1JWSA 1CTNA 2HMIC 4HJ0D 3OB0K 4JGJA 3BSZL 4XVUD 5C6WH 4KMTL 2EC9U 4MNQE 5FO9A 2OZ4L 3WNKA 3LB6C 1P7QB 1PYWB 2HFGL 3REWA 5ACMA 4NKIL 3BW9A 4ORGB 3W0WA 4YNYA 4I2XE 4PJAB 1PLGH 1T83A 3V95A 1WGOA 2X9YA 4LASH 2ARWA 5KS9B 3TESA 2PKDA 4O2EA 4YXLH 3MOAH 3GSNL 4JO1H 5ESAB 4AENB 4QT5A 3EYOB 1TVBA 3LCYA 5HSFA 1FP5A 2A9MH 3WLWD 3P0YL 5E6IA 3MO1A 4WFED 4CADB 5C0BE 4HFWB 3VFWB 2JB5H 5E03A 5AUMA 4MA7H 1CGSL 5D71L 3DURB 3GFUA 3O11B 5GGRA 2AXGA 3REVA 4QCIB 5GS1A 3WYRA 1OAXH 5FV2A 3X11B 3EKCA 3LS5H 4QRUA 2AXJA 2X4OA 1XF3A 1DUZB 2VLKB 1EJOH 2FLRT 3B83A 4EQ3A 4YHKL 4RMVA 5J7CC 3PF2A 3ZTJH 1D7FA 1ORSB 1CGWA 1KJ3L 4S1QH 1ZS8B 5JXAL 5F97E 1F2QA 1IVLA 1LE9A 2R2BB 2VAJA 2YD9A 1CDUA 3S5LB 4NYLA 5HHOA 1WITA 4QRRA 3RQ3A 1U8LB 5J89A 4X7EC 5CEZH 1T22A 3TC9A 1G1CA 4XNYH 3C6SA 1I3GL 1KIPA 5EH1A 3TEUA 3RVVD 4ZPVA 5I2IA 3U4BH 3ARDB 1QFWM 4M1CC 4UQ3A 5D1QC 1JGEA 1LP9E 2BY0A 3LEXB 1IAKB 4J8RA 5HGDA 3QDJD 5TE7L 1ZGLB 3WFCH 1S9YA 1IBGH 1UQSA 4Y1AA 4PG2A 1OAYL 3SE9H 4EEEA 3DO7B 3GSUB 2Q8BH 1G7MA 2O5XH 4LARH 3UBXI 1FYTB 1KN4H 1P9MC 4DQOL 1KTKE 4CMMB 1O0VA 3QDGD 3CXDL 3IU3A 5D6CB 3GMQA 5IFJB 1HWHB 4PB0L 4UZGA 1HHJB 5DURD 1RZ7H 1EUUA 1KIQB 2Y9RT 2HYMA 1HK6A 4JRYB 2ZJSH 3ULVC 1MAJA 1BZ9B 4NN5C 1EJ6A 1QPPA 4XWGH 2BNQD 3EO9L 3ARGB 1R3IL 5I66B 1IM9A 1HI6A 1NMBL 1U8KA 3O3AB 1CIDA 1C16A 1JWSB 1U91A 5DR5H 4QOKE 1TIUA 4OCWL 1CDHA 4TNVK 3RDTD 4LP4A 4OKVA 4C55A 5FO9B 3E1F1 3N06B 3GEWB 5IEHA 5HYSG 3REWB 1BEYH 3I50H 3BW9B 3W0WB 4QXGL 4YNYB 3DVNA 3NFSL 1RIUH 2E6JA 2JLLA 1MUJA 2LU3A 3ES6A 4K8RH 4P9HH 3ZYZA 5GRZA 4BFIA 4KQ3H 4GG8A 4JY4B 3VFRA 2YC1A 3NZHH 3U30B 1UEYA 2LAAA 4O2EB 4LEXH 4A6YA 3W82A 3QAZB 2VWEE 4XCEA 2Q8AH 4HWEL 3MXWL 4X6CA 1HH6A 3PQYE 4QT5B 3TVMA 3NIFF 1TVBB 1FL5A 4YC2C 5A43C 4YIQA 1E6OH 1J1PH 2HFFA 3EW3B 3GNMH 2CKBA 1S9WA 1CF8H 1T7ZA 5E6IB 4OLYL 3WJLC 5I1GL 4DKEH 1UWXK 3MO1B 3SDAC 3FO0H 2VXVH 3NTCH 3RVTD 2VITB 3DMMA 3MCG1 5T3ZH 5DJ6A 3VXRA 3EOAA 5IQ7L 1FCCA 1X7QA 5MENE 4G6FB 5AUMB 3QT2A 4TTGA 4BZ2H 1RUQH 2AJVL 3GSWA 5EDXA 2AJUL 3WDIA 4O02L 1MI5E 5GGRB 2AXGB 1IFHH 3REVB 2Z93A 1ZHBA 5I1LA 2BCKA 1QBAA 2D4DA 5KSBF 3U1SH 5C9JA 4NPYB 2HMID 3H9SA 3JXAA 5A3IC 5EC2A 4K9EC 4QRUB 4M48H 2X4OB 1MRCL 1XF3B 3AS3A 3HG1E 2SEBA 4QLRA 3L5IA 1X4XA 3LB6D 4UV7H 4OI8A 2Y5TA 4OI9A 2CSPA 1A7NL 3IAQA 1NEZA 4HWUA 1IARB 1LE9B 3OV6A 5TQ2L 1NCBH 4NYLB 5IFHL 1NEZG 2RHEA 2N56A 4HK0A 4KPHL 4QRRB 4YWGL 4OM0H 1T22B 3MRNA 5D96C 5GHWL 3C6SB 1KIPB 1LHZA 5HXMA 4PYHA 5GRVL 4ENEC 4ZPVB 3FMGL 1D6EA 4F8QA 1U6AH 2VC2H 2LQRA 4UQ3B 4PJ7E 2AEQH 2KH2B 4HUUA 1JGEB 3FQUA 3HMXA 3NCCB 1IILE 1FNFA 4J8RB 4PGDA 5HGDB 5GJTL 1S9YB 3Q5YA 4GT7A 1UQSB 4LVOC 4J3TA 2X4SA 4Y1AB 5SWSE 4HKBA 1CR9L 1DBBH 3NCJL 1CVSC 3RPIA 1WF5A 3BMWA 4L1DA 1ZT1A 3DBXA 3IJSA 3D25A 1G7MB 3IDUA 5L2KD 5FYKD 2DIJA 1FPTL 4OFKA 5HYIA 3VFMA 1D5MA 1TTGA 3IU3B 1JPTL 3GMQB 5DO2C 1YEFH 1OOAA 4ELKA 1RZKL 4KRMB 3EFFA 1UEMA 3CH1A 3UCRA 1RUMH 1YN6A 1DZBA 4F33A 1P6AB 2RBLA 5LAXA 1AXTH 4K3EL 4TTDC 4ODHL 1AGCA 1IM9B 1HI6B 1U8KB 1C16B 1U91B 3AC0A 4NQTA 3RZCD 2VDNL 4ODVH 4Z8FL 2Q76A 4JM4H 1V05A 3ARWA 3U79A 5DMYA 4OKVB 3FB8A 4DUXA 3Q3GA 5C08E 1JZ4A 1TJIH 5IEHB 1OLZA 5DC4B 3CH8A 1MUJB 4FHBD 4PBVC 4G8GD 4JDTH 1TENA 3ES6B 3OKDA 4L8DA 5FAAA 1PBYA 5KSUA 4B7LA 4OLWH 4BFIB 4GG8B 4M1CD 4Z7UF 5D1QD 3CVIL 3VFRB 2YC1B 5TF1L 3S96A 2CO7B 5CJ5A 3ULSA 2RGSA 2XZCL 5GGTL 5HVFB 1OTTC 3HB3D 5EUOA 1INEL 4PRPE 4XCEB 3VG0L 1HH6B 2G5RA 3TVMB 4L9LA 1MCBA 4MGXA 4OZIA 1FL5B 4MQTB 1I8LC 3TBTA 3A6OA 1KG0A 1QLFB 2HFFB 4YIQB 2CKBB 1S9WB 1NUGA 2XN9A 2HKHL 3HHRB 4NN7B 2V5YA 5D70L 4AIZA 1MFCL 1UCBH 5FGSA 5AAWA 3DMMB 2A74A 3VXRB 3ZL4H 1X7QB 1AQDA 5DXWA 3GSWB 4NQED 15C8H 4XNQA 3RNQB 3VXNA 1KLGA 1ZHBB 5I1LB 5HDQL 3KS0J 1YEEL 4QEGA 5J6GA 1FFPB 5C9JB 4JZJC 2BK8A 3H9SB 4YHLL 1UH3A 5EC2B 2NNAA 1OTUC 1I1AA 2R1WA 2SEBB 2YUZA 2Q20A 3QEUA 1G6RA 1QSEE 2Y5TB 3C5ZA 3S3SA 5I18L 5T5FL 2MCPH 1RHHA 3L1OH 3QNZA 2VISA 3RKDD 5HHME 12E8L 3T77A 4KFZC 4XXCC 4LRNH 1MJ8H 3MRNB 4OGZA 5E9DE 2ZUUA 1B4RA 4K7PY 1D5BA 5FUZL 3BWUC 5INCA 1YMHB 1D6EB 3V5DA 5BJTA 2V9TA 1A5FH 2LTQB 3R8QA 1HSAB 5CZKA 3H2WA 4HUUB 1T7VA 3FQUB 3ARDC 4RGOL 4G5ZH 4PGDB 5IBUB 2EE3A 3B8SA 2X4SB 3JWDC 3MUGA 1BIIB 4QXUL 3RPIB 3JWOC 3BYYA 1MJ7L 3VFGL 1ZT1B 4F58L 3DBXB 3IJSB 3D25B 4HJJL 1WTGT 2GTWA 3FAXA 1BPVA 3ZDXF 5DUML 5F7YC 2CQVA 3VFMB 3V6OE 1D5MB 5IR1A 4HC1A 4DCQA 3FJTA 3V6ZA 2IQ9L 2XICA 4JFQA 1SMAA 4IEFB 7FABH 1VA9A 4ELKB 4MDJA 3EFFB 4OQ1A 1H15A 3CH1B 1IC4H 1YN6B 4F33B 5A3ID 1N26A 4MLIA 1NSNL 2QQLL 5LAXB 1ZLSH 2GEEA 5FYJU 5I1IL 1AGCB 2AJXL 3UPCA 4NM4L 3ULVH 5F7KC 2J8UA 3PP4L 4WTWA 4PJBE 1FQ9C 3ARBD 1JZ6A 5DEGA 2Q76B 2C3XA 4M6OH 5BS0A 3MLYL 5FGCE 2HKFL 4Z7WA 3FB8B 1JGUL 3Q3GB 1QPXA 3T1FA 1JZ8A 3PG2A 3S37L 2N4IA 3UJJL 4OB5H 5EOQH 2YK1L 3DI3B 2Y1VA 1I8IA 3UP1A 2VZUA 4Y5YA 4L8DB 1ADQH 3DX6B 3UTZA 5KSUB 4LSVL 1R5IA 2VXSH 1R3LA 1T83C 4CDHA 3OF6D 2Q87A 3E3QE 2IPTH 3O4OB 3S96B 2R0WL 2IG2H 5EUOB 3U30C 3H8NA 3I02A 4L9LB 1TXKA 3QAZC 1KG0B 4IRZH 5C09E 2XN9B 2EH7H 4LCWE 4AIZB 4HKXA 1F13A 2EXWC 3RVUC 1A1OA 5E6IC 2A74B 2DBJA 3T0EB 1AGFA 3WS3A 4GLRI 3L9RA 1XCQB 4XC3L 3IFLH 4XNQB 4NWTL 3VXNB 1FO0H 4TTDD 1KLGB 3HNTL 1NBVL 5IJKA 4M5YL 3MLUL 3MRIA 5CEXA 3LEYH 1X9QA 5J6GB 4JO4H 1CFTA 3QRGH 5GS1C 5GIRA 3RAJH 2NNAB 2DQIL 4RMRA 3N1QC 5EZIL 1K6QH 3PHSA 1I1AB 2R1WB 5C0IA 5GRUH 3NCMA 2VYRE 3QEUB 1QO3A 5DC0A 3C5ZB 4PG9B 1F4WL 2EKJA 5JNYB 4PJIE 1P7QD 4Q9QH 5DD1H 2P4AB 1T2XA 1ORQA 1RHHB 4GJTB 3BAEL 4Z0BL 4JCMA 1OD7A 3QNZB 3KYKL 5F1KC 3IGAB 3GMNA 4OLUH 3QXAA 4E41A 3EYQC 3T77B 1GXEA 2A6KB 5IM7A 1NFDE 2PYEE 1OTTD 4WGVB 2B1AH 2H2PC 5D9SA 1HHGA 2CDFA 1D5BB 4RGND 4UTAL 5INCB 4AG4L 5BJTB 1U95B 3HE6A 3IETA 1S7XA 4QF1A 2EC8A 4CGTA 1XGUA 3MUGB 1CK0L 2UUDK 2AS5M 4PG2C 1MCOH 2GTWB 5TDPA 4DAGH 4PP1C 5E08L 2YA2A 1RSFA 3UTTD 3ARTA 4YHOH 5HI4D 1NCCL 3I6GA 5IR1B 3DI2B 5I8EA 1OF2A 3V6ZB 1WWBX 4DCQB 4JFQB 1J10A 2ZP0T 4NQXA 4MDJB 1XF5A 1H15B 2WINA 5C9KA 5I30H 5T33L 4ZO9A 1UWEH 4JPIB 1L7IH 2D03L 1R3HA 3W81A 2UVFA 1QA9A 4NZRL 1CZ8H 2J8UB 4NRYA 4EOWH 4F2MA 5JOPD 4TUKH 2VLKD 1QSVA 4AQOA 1P53A 5DEGB 2ESVE 5BS0B 5E2VL 3NH7L 1IQWL 4Z7WB 4JPKH 3DYPA 1NUFA 1AR1D 5TQ0H 1TMCB 3T1FB 4RFNB 4ZOBA 1KLUB 1D3CA 1I8IB 3ZSTA 3PWVA 4Y5YB 4IIQA 1K2DA 4Z5RA 3UTZB 1JF1A 1R5IB 3F7RA 1P84J 2KZWA 1A3LL 1R3LB 5C3TA 3DSFH 1EGJA 3ARDD 1E4WL 5H2BA 3ZHDA 4WWKA 2ZSWB 4YBLB 1PX4A 1KTDA 3I02B 1I1CA 5F21B 1RZFL 5D7SH 5TJWK 2I9LA 3TVMC 1ZTXH 5ITBL 4R2GD 5IESL 2WNGA 3GRWH 1T1YA 3JZ7A 4HKXB 4P5TD 3D6GA 2LVCA 1A1OB 4B7IA 1HIMH 4NN7C 1MEXH 4AL8H 4EI5A 4Q6IA 4M4PA 3E8UL 5B39A 3EBAA 3WS3B 4XMLL 1LE5A 4OQTH 3DMMC 1ETZA 3L9RB 1AJ7H 4LSPH 5B39G 3CMOL 4K94H 1PDKA 4LLWA 4PY8J 3VRLF 3MRIB 5CEXB 3S88H 3ARGD 1CFTB 1N4XH 4Y4KA 1JF5A 1YYMH 1WIOA 2XA8L 5GIRB 5BOPA 4POZC 3IS1X 2ZCLL 4OLZL 1JHTA 3VXSA 5C0IB 4ONHA 4UTBH 4KI5E 5DJ0A 5JDSA 3BDXA 2JF1A 3UTPE 4AIOA 1QO3B 2AEIT 1DDHA 5DEFA 1FVCA 4BYHA 4YEFA 1QEWA 5HHXH 3I3EA 4PGJA 1JPGA 4P2QB 2OK0H 1CIUA 1ORQB 3BN3B 3W0WD 5CEZE 3GMNB 3BGMA 2XTJB 4P99A 3L3IB 3QXAB 1ZAGA 4E41B 5KTEL 5IM7B 3DX7A 3CSYA 5EOTA 3HZYA 4LPYA 5CP7A 5D9SB 3EFDL 1HHGB 2CDFB 4Y5VA 2C3WA 1G9MH 3E6FA 4QRPA 1JHLL 3VXQA 1DN2A 1QSFD 3HE6B 3S9DB 1S7XB 4QF1B 4U6YA 4L3ED 1WSST 4Q74A 1J87A 4FP8H 1XGUB 5DK3A 5I1JH 1FG2B 2Y36L 1QFPA 2EXWD 4KWUA 3RVUD 1W0YT 5LQBL 2KUTA 1K5NA 1PX3A 1BZ7A 4YX2L 3I6GB 1UACL 4G6FD 4D9RD 5I8EB 1OF2B 4XI5D 4NQXB 4W4NA 2DQHL 2FRGP 3F58H 5CS7A 5AG8A 5IGXH 4XBPA 1R3HB 5AWNH 1QA9B 4X9FA 3WO3B 4EXPX 1JGDA 3V52L 5INDB 3IXAA 1W72H 3ESVF 4NRYB 2WP3O 3QISA 3WSQH 1MFAL 4FQ2H 3A67H 2J3SA 3H3KA 4OI7A 2R0KH 3HC3L 4NUGL 1TITA 4ODTH 4OUOA 4DKAA 3FFCE 2CD0A 1B6DA 1NKOA 3OAZH 4F3FB 5C0AD 4HAGA 3PWVB 2H2PD 3HI5H 2G75A 4IIQB 1K2DB 5E5RB 4Z5RB 4O5LH 2VKWA 1VGEL 5GZNC 1JF1B 5GRJH 1X44A 1RY7B 4EVNA 2LU4A 2Q7NA 2C9AA 2VAAA 2VDLH 5BO1H 1H3TA 1VFMA 2XZQH 5H2BB 2XXMB 4WWKB 3SGDI 2X09A 1MCPL 1KTDB 1HHIA 4KRPD 4Y1AD 3ZT6A 5KVDL 4PLJC 2I9LB 4L9LC 4PP1D 2ICWB 5T3ZE 5D7IE 4CN6A 5B22A 1T1YB 4FQIH 1B3JA 4GO6B 1D5IL 3UTOA 5CLTA 1RVFL 4X4XA 4EI5B 4Q6IB 1X5KA 5B39B 4P5KA 3O0RL 1N5YL 4MJ4A 1LE5B 1ZGLM 1ETZB 1ZEAL 4H20H 5FKPA 1G0YR 1ND0A 4AZ8A 2XZZA 3GJFA 1M6OB 4LLWB 2FIKA 2HVKB 3RIFF 4Y4KB 1IM9D 1LEGA 3LPFA 1UM5H 1JP5A 3VXSB 4ONHB 1MHCA 5JDSB 5DJ0B 3SDCA 1R3KA 1I1AC 3JSSA 1HDMA 1AR2A 4LHJB 4U6TA 1DDHB 1FVCB 2A73A 4LSRL 4MB3A 5T3XL 4N9OB 2YPLE 1F4HA 5EOCH 1QEWB 2OBGA 3C5ZC 2BY3A 1F00I 4NNPL 1TVDA 2H6PA 2E9WA 1FYHB 3BGMB 3VG9B 4JGMA 4LFHD 5CJOL 2I26N 3DX7B 4TOYH 3EO0A 4MB4A 3CSYB 4PGBA 5EOTB 3HZYB 5CP7B 3Q6GL 4Y5VB 1ZGLP 1DBML 1CLYH 2H3NA 4U1KA 3E6FB 4G7YL 4Y16A 1RUAH 2ZG3A 5DJDA 4QRPB 4XVTL 3VXQB 4ALAL 4U6YB 1C12A 5C1MB 3WKML 5DHXB 1BGXH 2X9WA 4RISH 2YD1A 3QIWB 4PUBL 5I1HL 4OD1H 1FSKB 1I9EA 1IGMH 3WFHB 4PLNC 1N8ZA 4OZGA 4PJXF 1HN1A 1H5BA 1KJ2L 4XCCL 1P69B 5EORL 1NPUA 1EO8H 1CXKA 3U36B 3EGSA 2W59A 5IKCB 3LKSA 1U3ZA 4FZEH 1YUHA 3HTLX 2G60H 4XBPB 4B41A 5CJBA 4POZD 1P7KA 3H9SD 1AE6H 2E27H 4MD0A 4KJPC 1FGNH 1JGDB 5BVPH 2P42B 3IXAB 1YNTA 5I1CL 1ZLUH 3PUCA 3K3QA 5EO1A 4PPTA 2BVTA 5KVGL 3MA9H 1LO5A 4GUPB 3X3FH 3PDGA 4ZS7H 1MCWW 3IYLW 1KENH 4KV5E 4P2OD 4M61B 9CGTA 3ECBB 1BOGA 3VGHA 2XV6B 5ADPH 2G75B 1EEYA 5HBBA 3VD3A 2DQJH 4Y5YC 5ID1A 2PF6A 1EVTC 4EVNB 3MLVL 2VAAB 4A2MA 2W38A 2CH8A 2YUXA 4Y8DC 5JHDD 3QULA 2NZIA 5CJQH 3UTSA 1DQDH 4YBLC 3N9GH 2IFFH 1RZKC 4F7EA 4KKCD 4FN0A 4A6YH 1FN4B 3T3PE 1JNNL 1FE8H 4BKLA 4X4XB 3C87A 2WLYA 4P5KB 4BK5A 3ZKSD 4POYA 4X98A 3LPGA 5HI5C 4YDIH 2OTPA 4YFLI 5FKPB 5C7XH 2DIAA 1U3HA 3GJFB 4K3JH 1EHXA 5C92A 3QPQC 5CSZA 3KPQB 2DQUH 3TIEA 5IJKC 2PCPA 4XC1H 3FT3A 1MHCB 3T2OA 3SDCB 3UC0L 4PJ5B 1R3KB 3PWNA 4KK5D 1YPZA 5EZOL 4YFLF 1CE1L 5ISZA 4OIIL 4PRAA 1CTOA 1DL7L 1QRNB 5IW1A 3ZDZE 2H6PB 3H7LA 3QHFL 5GZND 2P24A 2VN4A 3TBWB 3WE6B 1VEPA 5KSAA 2FGZA 4DGIL 3E2HC 2XTJC 4PGBB 1A6PA 4P49A 5BOZG 5CD3A 1AFVH 2H3NB 2VTFA 5CGMA 4FQXD 3V79C 4Y16B 2W0LA 5DJDB 1GVIA 1C12B 2EEAA 1LP9F 2J8HA 4X80L 3WFBH 3HE6C 3UZQA 4HX1B 4IMKA 1U93A 2NY7H 1E4XL 2XN9D 2IF7A 5D8JL 3ETBF 5CINL 3P0GB 3QIUD 1DANU 5J12C 1N8ZB 4OZGB 4UUJA 1QNZL 4DVRH 3ORJA 1H5BB 2F5AH 3HMXH 4OZHE 3UJIH 3T0ED 5DZNA 2XNAA 3EGSB 3SBWA 1QKZL 2BNUA 2BNRE 1MFBH 3LKSB 3RFZC 4BQ9A 1BECA 2BXYA 5CJXC 5D7JA 4RMSA 2B5IB 3ULVE 3MLZL 5FHBH 4UILH 1P7KB 1MREH 1OSZA 1DBJL 5DRWA 5K9OA 4EUPA 5CKGA 4DTGL 1WWWX 4JDVA 5IG7A 1YNTB 1FNEA 2YSSA 5EC1A 3MRMA 4EUPG 2GIYA 4UINL 1FBIL 2VB5A 2B4CL 4LP5A 5EO1B 3C5ZD 4IJ3B 4CKVX 5CBEA 1LO5B 1S7TA 2D0GA 2GK2A 4TSBH 1JYXA 4OCXL 3SKMA 1M7DA 4WGWB 1C5CH 5DJ2B 2O5ZL 5H37H 5DUPL 3WUWA 4B53A 1BOGB 4FQLL 4YXKL 2CIKA 1EEYB 2NMSA 4GQ9L 1LO3L 1U8NA 2B1HH 3TBVA 1RU9L 4LVHB 4IIQC 2ZCHH 1MFDH 1RK0B 4GRWE 4F7CA 2J88L 3QULB 4MHHI 3HPJB 2EICA 3LKNA 3U7WL 3HFMH 3VW3H 4KTYA 4Y2DC 5J11B 4WWKC 2NY0B 2DTSA 3OHXA 2WSKA 5EA0L 2FCBA 4JQIH 3SPVA 2NY5C 4TN9A 4LSSH 3RBSA 3QJFA 3S3JA 2F58H 1UT9A 4X98B 2ERJB 1S3KH 4EI5C 4Q6IC 1WFOA 5C07D 2P5EE 2B2XL 3IFNL 2QQKH 5AYUH 3V6FB 3P30L 5CSZB 4KVCH 3T65A 1GIGH 5FO7A 3TIEB 5E56A 1S5IH 2PCPB 1NDGA 3BFOA 4NZDA 2JCCE 2ORBL 2PR4H 3FT3B 4Y4KC 3C09C 4GG6E 1ZWIA 1SEQH 1I7ZA 3PWNB 4OBRA 1YPZB 5JIHA 2C4FU 5ISZB 2DM7A 4WI9A 4PRAB 1KTRL 2Z91B 1A6TA 4MA8H 1FDLL 3HE7A 1NMAL 4U0QB 2P24B 1NCDH 4FG6D 4HH8A 1G6RH 1RHFA 4Z7NF 1JNLH 5KSAB 2CMRH 3DUHA 3VG9C 5C0JA 3H3BC 4O9HH 5CD3B 4X7SH 5JHLL 2NR6C 3FT4A 3DOSA 4TSCL 4MNGE 3WFEL 4DEPB 4YXHL 1KCRL 2FX8H 1WEJH 4Y5VC 1EA9C 4F7PA 1GGUA 2A1WL 3O2DH 4RDQF 1U93B 4NCC1 3U0WL 4ZAKA 4UUJB 1E28A 5IQ9B 1FSKC 1K8IA 3OJMB 3QI9D 4D8PA 5L7XH 3PE9A 2P7TB 2Z35A 1I9IL 4BK4A 2NQCA 4NQDA 3TBSA 4I3SH 2BNUB 4GSDL 3TH2T 3EAKA 4I0PB 2DTML 3CK0H 1LDSA 1N5AA 2CUHA 5C0DA 5TPWL 5A2LH 2QR0A 5D7JB 4ZSOA 1OAKH 5F9JA 1OSZB 3BISA 4N5EC 4XPTH 5K9OB 4EUPB 4NKQB 4S1RL 2HJKB 4J2XA 1GZPB 4JDVB 5IG7B 3CAFA 5CCKL 4GW5A 1FNEB 2YSSB 5EC1B 3MRMB 1A3RH 1I3RA 1KV3A 4MAYC 3HC0A 1CLCA 4KC3B 3IDGA 1ONQA 3LH2L 5CBEB 1S7TB 3SKMB 2ED8A 3AB0B 5K59E 4P2QD 2DKUA 1MIEL 1M7DB 1QFHA 3ROOB 3WUWB 2XTJD 4E41D 3AXLA 1H0DA 3I6LD 2CIKB 4ZTOL 3V7AE 5F1IA 1U8NB 5BCAA 3MV7A 3PL6A 4LU5H 5F70A 1XFPA 3BDBA 2VZSA 4ERSL 25C8L 1NCWH 1IT9L 4F7CB 3RI5F 3HE6D 5F9WB 3LKNB 2D2OA 4E9LA 1T66D 3F7VA 3QUMA 1QLRA 3RUGA 1RIVH 3MV9E 4K7PH 4O58L 3OHXB 1UKQA 1V3LA 4XP5L 3NFPA 5EWIH 3L3OA 3SPVB 3ZKQD 2D9QB 2BJML 3WUZA 4BFEA 2HTKC 1YEIH 3I9GL 1S7QA 3AMLA 3JTSA 3QJFB 5CGYD 5IBTL 4X0KA 4GAGL 2HH0H 1GGIH 1BP3B 3T08A 4NP4L 4X6FA 5CILH 4EBQH 1YNKH 4P59H 3BIAX 4H88L 1GH7A 4ISVA 2ZCKH 4S1SL 1OGAA 3PGFL 5EU6E 4LKCA 2GSGA 1MJUH 5FO7B 3QPXH 5GGVY 4NIKB 3MOBL 4PV8A 1ZWIB 4P3DA 5ALBH 3ABZA 1ZOXA 2FH8A 4U4BA 4LSQH 2IC2A 2FGWL 3SDCC 3O4LA 5HHVH 1C5BL 2CO6B 5HPMB 3V9FA 1WCQA 5EBGA 3RJQB 1A6TB 1A6UH 2XRAL 4MSWA 5IIEA 2GT9A 3HE7B 1YMME 4XPGL 1CXLA 4HXBL 4HH9A 4XTRC 1NCAL 2NTFA 4OFYA 4AY0A 2R4RL 4I2XA 1I9RL 5JW3L 4HLJA 3VI4E 3WIHA 1NDMA 4FTVD 1OARL 1KBGH 4MJ5A 3FT4B 2E7HA 3OXRA 4LLVA 3QCUH 2HT4C 1BM3H 1UM4L 1MNUH 1Q9WA 2DOCA 4Y16C 5IROA 2A77H 4PRHA 4K71B 4LCCB 1RUPL 3QXDB 2DMKA 4ZAKB 3BKYH 1E28B 4MJ6A 5GGQH 1K8IB 4KY1L 4BFGA 4D8PB 4FS0A 4ONGH 2Z35B 1F4YL 4EI5D 1I7RB 1H5BC 3GDBA 5C0BA 2ZKHH 1FYTE 4NQDB 1T6WA 1U8PA 2BVEA 4JQVA 1S5HA 5ANME 3MRKA 3K2UH 1N5AB 5C0DB 5HYEA 4PRBA 4ZSOB 3DUSA 1TZHA 4FZ8H 3UYRL 4WW2A 5F9JB 2PW2B 3QEGL 4PJFA 4Y4KD 4JG0H 3O41A 4JRYE 3V5KA 5MEOA 1SY6H 4GW5B 4TULH 3VXSD 1BAFH 2HN7A 2YKLH 3INUH 5EIIA 5KSVA 1I3RB 4KTEH 3WFDL 4BELD 3HNSH 2YD7A 3PWJB 4E5XA 3IDGB 4JLRA 4B0MM 3SOBH 2CK0H 2IH1A 4LLYA 5EPMA 1Z5LA 2OI9C 1RZJH 1G7PA 2Y06L 2R56L 2DKSA 1KEMH 3W0WE 3MODH 1H0DB 1J0IA 5F1IB 2NR6D 3PV6A 2V9RA 2X4QA 5ESQA 2OJZL 3MV7B 3PL6B 3PABA 3JV5A 1H3WM 3LVEA 3BN9D 1MCLA 3O6MH 5HYJE 3P4NB 5JLZA 4FNLL 3EDFA 4LVHC 4QTHA 3K80A 4L4TE 3BD4A 3VFNA 3F7VB 3QUMB 4EN3A 2ZUSA 3RUGB 3QIWD 3MRBB 2YWYA 5JW4M 1EGJH 5DLMH 4GRMA 4JKPH 5J11C 3NFPB 3L3OB 4M1DL 4XP6H 5FYKH 1S7QB 1TVHA 3JTSB 4OT1L 1MCSA 2CIIA 2OL3H 4F80A 2V2WA 1KB5L 1H8NA 1Q9KA 3MCLL 3HUJE 3NMEA 4JFHD 4X6FB 4N5ED 4ISVB 1VGKA 2ERJC 3G9VA 5LGJA 2VXUL 4LMQI 4LKCB 3LAFA 1FLRH 2COQA 2GSGB 1U3HC 4KJWD 4N1EA 4NN6C 2ENYA 1Z9MA 3H9YA 5L88H 4PV8B 4QOKA 4RZCA 3HMWL 4P3DB 1AY1L 4LNRA 3T4YA 3O4LB 4HS3B 2YZ8A 3P4LA 4MNQB 1G84A 2HJFA 5IIEB 2GT9B 5F7DA 3B9KA 3V0WH 4HH9B 5T1DH 3LOWA 5CZXD 4I2XB 1YEDA 4NNYA 2HAZA 5HHOE 5EOCJ 1Y6NR 1MWAL 4QRRE 1NDMB 4U3CA 5KSAC 1NFDF 1IRAY 1D9KA 1B4JL 1FH5L 2MFNA 3ZKXB 4MJ5B 1JL8A 1IL1A 5DJAA 2GJJA 4LLVB 2Q3ZA 4TYUA 1TQBB 3QNXA 4OZFH 5IVZA 4FABH 2WBKA 2E6PA 4YE4L 4DEPC 4OSUL 1S7RA 4W6YB 4JPVL 4L1HA 4PRHB 3IDMA 5I6XB 3LD8B 5JQ6L 1JZ3A 3PWPA 5EBLA 1KSRA 2HTKD 1T4KA 1MFEH 2W0PA 3QCVH 4Y1AE 2B0SL 4IMKC 3HAEA 4MJ6B 1N0LA 4QHUA 1WBXB 5CKAA 4FQCH 3KPSE 5JORA 1UWGL 4UIKH 5C0BB 1QBLL 3HAEG 3L6FA 4U1MA 1U8PB 2R1YA 4HS8L 4HFUH 3MRKB 2NY4D 1TQCB 3SBWC 4JFDA 5MP6H 4PRBB 4OGXH 4GBXC 3DUSB 1PG7X 2AQ1A 3MGTA 4XMPL 4WW2B 4PJFB 5CMAA 5D7JC 1R0AH 2IGFL 2V7HA 3D3VA 1F58H 3V5KB 5MEOB 1QFWI 1M7IA 5JUEH 1PKQE 1WBZA 3SGJA 2HN7B 5E4IA 2PYFA 5EIIB 5KSVB 3SDCD 4G42A 4PJ5D 4JO2L 5BQ7A 2QL1A 1MAML 4G9FD 3BPCA 4JLRB 4R7DA 4DWHA 1X5YA 2IH1B 4LLYB 5EPMB 2RCSH 4Y2OA 1QRND 1Z5LB 3CX2A 5AG9A 4XHQA 2VZ3A 2F5BH 1G7PB 3AB0C 1NAKL 2NPLX 4P23A 2EDDA 4OTXH 3PV6B 2X4QB 5ESQB 4PJDF 2AGJH 4GMSH 3D9AH 1CGTA 1PG7L 5JLZB 4Y16D 3SKNA 4QTHB 5FXCH 3VFPA 4AIXA 3VFNB 5JDJA 4PJ7A 4EN3B 1KXTB 3TN0D 4FFYH 4X6CE 4WNQA 4JPWH 5F9WC 4KHXL 4JDZB 2IMMA 2H2SC 4AEHH 1GGYA 3V0VB 4NQVA 3V4PH 2XY2A 1TVHB 4HD9A 2NXZB 4NZJA 2VQUA 4M7KL 4KH2A 2CIIB 2BRQA 2DJ4A 1BREA 2P46B 5F96L 1Q9KB 3B5GA 4M7ZC 3VXRE 4D0CA 3IAGC 3UBXA 4TQEH 2QEJA 1VGKB 1X5AA 4R8WL 1NGQH 5E70A 5BV7L 5LGJB 3PHOA 2HRPL 3UBXG 4N9GA 3ULUH 1ED3A 5J0BA 2AK4E 1A7BA 3S36X 1JWUA 2ZWLT 4RZCB 4QOKB 2EH8H 4G43A 2VDML 4KI5F 1V3JA 1XZ0A 4LNRB 4HMCA 3T4YB 3STBA 5C3LD 3UEZA 3BQUD 2GITA 5C08A 2V5TA 1HH9B 2HJFB 5DJYA 3IVKA 5ALCH 5F7DB 1NGPL 3B9KB 4NM8H 4YHML 1G0XA 3GJEB 4I0CC 4MXQD 2WIMA 4XP4H 3D0LA 2BHYA 4LCUA 1YEDB 3HE7C 4NNYB 1J0KA 3PV7A 3QQ3A 2I60H 2MKLC 4KZEL 1D9KB 4ZXBA 5D2LF 1IL1B 5DJAB 4HT1L 3LQAH 2CR6A 1KB5A 3QNXB 4QNPE 4J23A 5IVZB 5KAQG 4Y7MA 3S36L 3SJVD 5SWQB 43CAB 3S34H 2GQHA 4PRPA 4OM1H 1S7RB 2X4NA 1KOAA 4LBEA 3IDMB 1CICA 2NY0D 3PWPB 4UT7L 5EBLB 1C5DA 4TVPL 1T4KB 3LKPA 5CZVH 3ZYIA 4JO3H 4K71C 3HAEB 4N0UA 3PWUA 4QHUB 3EZJB 4ZAKC 4O2FA 2R9HC 3LQMA 5HDLA 1MCQA 2HT3D 3L6FB 3H3PH 3HC4H 1LILA 4U1MB 2R1YB 2P8LA 1GC1L 4NJ9L 3SE3A 5EO9A 4ZFOA 4JFDB 5BMFH 3IAPA 1MI5B 3S3PA 3CFBA 4DOHE 2HG5A 1EMTH 3QG7H 5CMAB 2V7HB 4LF3B 1M7IB 4PLOB 4NGHL 1WBZB 4HWBL 4POUB 5SX5K 3RL1A 2PYFB 3HLAA 4G42B 5BQ7B 3BPCB 4R7DB 4UB0L 4CVZA 5GS0C 4UT6H 5GISL 5ISZD 1QSEA 4LDLB 1A7OH 1OSPL 5HGAA 2BSRA 3RIAK 4QHMA 2A0LC 4K55A 2FDBP 4P23B 2MTPA 1DUYA 5KSAD 2XZAH 4OF5A 3OB8A 5F88A 1TZGL 4GS7B 2FB4L 4I48A 5E9DA 5JO5A 1AHWA 3PL6C 4NRZA 3STZA 1NL0H 3SKNB 4L5FH 2E8ZA 3H9HA 4KKBC 3EOYG 4P46B 4PJ7B 5KVFH 1PLGL 3C60C 3EJZD 1L0YA 2BSTA 3TO4A 4WNQB 1T5WA 5SX5H 1N7ML 3TYGH 4OZIE 5SWSB 3OR6B 1QFWL 2B20A 3A6BL 2CGRL 5D7IF 3RBGA 2Y07H 4NQVB 4NOBA 4M8QA 4HCRA 5D4QA 5FKAA 2IADA 4JO1L 5ICXA 2DDQH 3BUYA 4D0CB 5T3XD 4I0PD 3V6OA 3UBXB 2A9ML 3BGFB 4OFIA 5D7JD 1BIHA 1RJZA 1FIGH 1JN6B 4FFZL 3WNLA 2D9CA 1QBBA 1NC2A 2GJ6E 3G5VA 4R7NA 4N9GB 4PGZA 1ED3B 5L8JB 3ARQA 3S35X 4Q97A 2JB5L 1ZXQA 4YDKH 1JWUB 2A6IA 4C57C 1A6WH 4MA7L 4G43B 1T21A 3QYCA 4PJBA 1XZ0B 3UPRA 1QFUL 1CGYA 2E7MA 3B9VA 2D7TH 5CP3A 1OAXL 5C08B 1R5VA 2GITB 1KB9J 1PY9A 5DJYB 3IVKB 5F1OB 4PJCA 3BRGC 3LS5L 4ODBD 1EERB 1OVZA 4GAJH 3D0LB 4LCUB 5FCUL 4C56A 5C0RL 3ILQC 4FQHA 4WI3A 2VH5H 3QQ3B 5DK2A 5IVNA 4ZXBB 1YEHL 4S1QL 2QSVA 4TRPL 4WFFD 3RWFA 1KB5B 3EOTL 4J6RH 3IFOA 3S35L 3ZKXC 4NHUA 4KK8C 5SX4I 4PRPB 4LLDA 1LEIA 3TV3L 2X4NB 1TQBC 4LBEB 1C5DB 3RU8L 5CEZL 4ELMA 3HKFA 3LKPB 4TPRH 5IROC 1BWMA 4XNYL 2DBLH 5I6XC 2YD4A 3LD8C 4I9WD 3PWUB 4O2FB 4DGYH 1QRKA 5JZ7C 2F74B 3OAYH 2XFXA 3Q5OA 4G80B 5E2UH 1V7NH 2P8LB 4D0BA 4AEIL 4ZFOB 4JQVC 4PFEA 3CFBB 2HG5B 2A9NH 2Q8BL 1TQCC 1JGLH 4LARL 1MH5A 1KN4L 1II4E 3X14B 1KELL 2VLJA 1YN7A 4WW2C 1MWAB 3RL1B 2QQQA 3HLAB 3PP3K 3CXHK 5GGSA 3OR7A 5IT2L 5FYJD 1YEJL 5F7LB 5TE6H 4CVZB 4EUPH 1MCEA 2EEBA 3VWKA 5BS0E 1QSEB 5HGAB 4Z7WE 1KYOK 2BSRB 4XWGL 4PJIA 1JPST 5DR5L 1DUYB 1DBAH 2IAND 5HVHB 1CYGA 1GOHA 5B21A 5HHMB 4ZODA 3T8XA 5F88B 3QHTC 4WHYG 4HUWA 4I48B 5JO5B 5E9DB 1RURH 2XOTA 1AHWB 3JUZA 3QWQB 5HTSA 1DFBH 1RQ5A 2P1YA 3H9HB 1TETH 4MQ7A 1RIUL 5C0FA 5DC9B 4HUXA 3B5HA 2X89D 3TO4B 4K8RL 1T5WB 4P9HL 4OD2A 1OWRM 1CT8A 4ZAKD 3SDDA 4EN3C 2R9HD 4KQ3L 1FL6A 2BXZA 1A4KA 4AQ1B 3AVEA 3NZHL 2YA1A 2HWZH 4M8QB 2BVQA 3EOBA 2IADB 3BP5A 5FKAB 4DN3L 2CLRB 5ICXB 1YEKH 2XWTA 4NQDD 1V3KA 2X4PA 3BUYB 2NXZC 5EBWA 3WL9A 1PW3A 1EBPA 3CVHH 1J1PL 4KXZH 3TO2A 1CF8L 3QO1A 5I1AA 1EUTA 2LE9A 1FORH 3BMVA 4DKEL 4OLVH 3G5VB 2FJGA 4S0SD 4R7NB 4M4RA 4N0YL 3D2UA 3RVXD 2X10A 5T3ZL 2D0FA 2A6IB 4BZ2L 1T21B 4PJBB 3UPRB 2WWKT 1J05A 4F37F 3F7YA 1IFHL 3RP1A 1TJHH 3DVGA 4FA8A 5DD5L 2A0LD 5AYQA 1U3JA 1R5VB 2QHRH 3DWTA 4NKOB 4X7TA 2EIBA 4X6DF 3ZDZF 3MLWH 1LO2H 3B9AA 4C56B 3B9KC 4FQHB 3MJ9H 3MV7D 3PL6D 4JJHA 1CXIA 2IBGA 5DK2B 4UV7L 2EDTA 2GTZA 1IGFL 4ZUSA 4KKBD 1ACYH 1T20A 3BZFA 2M26A 2GY5A 3RWFB 1ERNA 1D9KC 5E8PB 3IFOB 2NYYC 4NHUB 1BFOA 3BEWA 4LLDB 1LEIB 1LDPH 3P11H 5DDHA 1GCFA 3QEQE 4U1LA 4ELMB 2Z8RA 4ZFGH 2R29H 1ROWA 1A3QA 3F7QA 3G04A 1CL7I 2NLJA 3MNVA 4OZHF 2VC2L 2XACC 3MLSL 3O6LH 3BPNB 2XFXB 4LCYA 1WT5A 4D0BB 4X5WA 3CX5J 3ZTNL 1I9JH 1DBBL 2E7LA 3WXWL 3QB7C 3BRDA 4KHTL 1MH5B 5L2JA 1A9EA 2VLJB 3MXVH 1YN7B 4FQQB 4M9OA 4X99A 5GGSB 3OR7B 5K9JH 2X42A 3SDYH 5IVXE 1YEFL 5GGUA 3SGJC 3NFNA 3QUXA 3O4LD 1N6QH 3VWKB 3WHXA 4MNQD 5EG6C 2DB8A 1AXTL 1HEZA 4PJIB 1J88A 4QHLA 3BH9A 5GS0H 1QFOA 1AGEA 3ILQD 1CFQB 1NGXA 2AXFA 4ODVL 4JM2A 5I71C 1KACB 4PTUA 3T8XB 4JM4L 3S4SA 4P23C 4IBLT 5DK0A 4HUWB 1NFDB 3GHBL 2PYEB 4S10A 4JFXA 4XAWH 2FHFA 4XPHH 3S4SG 5HVWA 4GRWF 5JTWA 4JKKA 4NQSA 4MQ7B 1RAMA 1CS6A 5C0FB 1HKLH 4HUXB 4RGMB 4ZOAA 3KPOB 2VXQH 2APTA 1CT8B 3SDDB 1FL6B 1A4KB 2F9BT 5TGBA 3DRQA 2BRRL 3KLHD 5MHSE 2BVQB 4HJGA 4JVWA 3EOBB 3BP5B 4C59B 2DRUA 5C0BD 3RWGA 2R4SL 2XWTB 5FOBA 2VR9A 3WHE1 5EBWB 3WL9B 4KMTH 4HG4J 3TO2B 2HFGH 4Z77A 3QO1B 3WNMA 5I1AB 1XF1A 5I74B 3AM8A 3AS0A 5ICYA 2FJGB 1C1EL 2UYLB 5IWLA 1DN0A 3D2UB 1F2XK 4GW1B 1VFOA 3LN5A 1OAQH 3B9EA 4GG6F 15C8L 1J05B 3F7YB 5J3HD 3GSNH 2R0LH 3H6JA 3DVGB 2V5MA 1P4IL 1K3IA 4X7TB 4EIZC 4NBZB 1DLHA 4DK6A 3FFCA 4C4KO 1BBJB 3QDMA 2JELL 2VDKL 4TVSa 2CLVA 3SHSA 4LHUB 4OCYL 3OSKA 2GTZB 1DVFD 3VGBA 1T20B 3BZFB 2MCPL 4ZXBC 4FOMA 5D71H 1BFOB 3STLA 4I3RH 1EXUA 4PJEE 4QRPE 3VDCA 3WIHH 1EHLH 4OD3L 1VPOL 4ESKA 4U1LB 3IFPA 2AQ3A 1CICC 4YAQA 3G04B 2W07A 4ZDHA 3BEVA 4WCYH 2JJTA 2NXZD 2EDWA 4Q7DA 1MPAH 4LCYB 4G5ZL 4FQJH 4X5WB 4WIQA 3TT1L 1KN2L 3GZKA 2C4FT 4IDJH 5JXAH 3SE3C 2BDNL 3DGCR 4LCIH 4P3CH 3CDGB 3KWWA 2C3HA 5L2JB 1A9EB 4X99B 5T1KA 3NPZB 3LKRB 4QOKD 5BW7A 1G7QA 1I3GH 4P5MB 5EZLA 2DL9A 4XNXL 4YLQT 5GGUB 4Q2ZA 2CK2A 3NFNB 3QUXB 3G5XA 2P47B 3WHXB 1UA6H 4O2CA 5GGVH 5E2TL 2YPLA 1WIUA 1ZLSL 3BH9B 3B9KD 3WNNA 1AGEB 2EIEA 2VQ1B 2M1KA 1A6AA 1NGXB 4FMFA 4MXVE 4U1SA 3ULVL 1OAYH 4OCRH 2P44B 4GXVL 4PTUB 4KUZH 1CL7L 3RY6A 5HVHC 4NZTL 4DQOH 1D9KD 2EXYD 4IHOA 4JFXB 1NANI 3CXDH 2GK0A 1AHWC 4OB5L 5T5NF 4K23H 4GXUM 4NQSB 4PB0H 5KS9F 4JKLA 3VFTA 1AIFA 4ODWA 4ZOCA 4CBPA 3EO9H 1R3IH 2VXSL 3SGEH 3TO4C 1NMBH 5TGBB 3DRQB 2FX9H 4HJGB 2JK5A 2DL2A 2AJYH 3RWGB 5FOBB 2Z4QA 1AP2A 4KK9C 5I8OL 5K9QI 1MAKA 4IRZL 5CD5C 3NABL 3M45A 1IAIM 4Z77B 3RIAF 3VXOA 1U8IA 3V6OC 1MI5D 2EH7L 4QXGH 1IQDA 1ZHLB 5E24E 3NFSH 5ICYB 3K8LA 5DJZA 3WNOA 3O3EA 1DN0B 3LDBB 2QV2A 3OKMA 5B8CA 4JE4B 3FZUC 4OF7A 4P9MH 3T1WA 1NBZA 4M6AA 3IFLL 3O6FA 1A4JA 1FO0L 5DVKA 2JTDA 2AJSL 4HWEH 2M8XA 2A6JB 4JO4L 2O5YH 3O6KH 4I8DA 2P45B 3EHBC 5GZOC 1DLHB 1IKFL 3RAJL 3U0PA 3FFCB 3VCLB 4P23D 3I2CL 1K6QL 4J7RA 4L8CA 3MJ8A 5GRUL 3QDMB 4ETQA 1NCNA 5ICZA 4OLYH 2CRZA 3RWHA 2DQGH 3TT3H 3UTQA 3VXUA 3QA3A 1WVZA 2VABA 2XI9A 1X5XA 5D5MA 3NIGE 5GXBB 1BX2A 1BOYA 4I77L 4JR9H 2AJUH 3STLB 3TWCL 4P46D 1BMGA 1EXUB 5GRVK 3MUY1 5F9AC 1FV1A 4X7DC 2G2RA 4OLUL 3FKUS 1YEGL 1MY5A 5SWSD 5EB9A 2W9EL 4YAQB 4YO0A 4ZDHB 5KN5A 5EULV 4OZGE 3GKZA 1FZJA 3ALWA 3MFFB 1HYSC 3BPNC 3LEVH 4A2LA 1A7NH 3HAEH 1A7QH 4P2RA 4G7VH 1UM6L 3FQRA 3LN9A 5IFHH 1QSZA 4KPHH 3CDFA 3ZKMC 4YWGH 5T1KB 4YHOL 2AVGA 5GHWH 4UDUB 2FX7H 1G7QB 4ZUTA 1CBVL 3OQ3B 1N3NA 4Q2ZB 3BD5A 1PD6A 3QO0A 2QQNH 3G5XB 3RX5A 5AEAA 3KNBA 1T89A 1MY7A 4O2CB 5C08D 4M7LT 5D6DA 2YPLB 5DJXA 5A16A 5GJTH 1QR1A 3VWKC 1A6AB 4U1SB 3NCJH 4TUKL 3B8YA 2VXTL 3FO2A 1FPTH 5KVMC 2QADB 4JPKL 4ZXBD 4XCNA 2NXYD 4IHOB 3SE4A 3NGBB 5IB1A 3IU4L 1A6ZA 1JPTH 3EYSL 4H1LG 4PRPD 4X7FC 2XPGB 5JIIA 3VFTB 1AIFB 4WW1A 3DV4A 4NQCA 5E5UB 4ODWB 1ZT4A 3GO1H 3GMLA 4WI2A 1QACA 4K3EH 43C9A 4RGMC 3UTSE 1X4YA 4ODHH 3BP7A 5AAMA 2V2XA 5JW4N 4WHCA 3DSFL 3SDDC 2VDNH 1K85A 1F90H 4Q9RL 4Z8FH 1CFSA 1L9NA 1HWGB 3MJGX 2AI0H 5FIEA 2Z4QB 1AP2B 4H0HB 5D7SL 1SJVA 2BNRA 1JPSH 1T1ZB 2N7AA 3VXOB 3C2AL 1U8IB 5HGBA 3AS2A 3ISWA 1IQDB 3F65A 4ODUB 5DJZB 3O3EB 4YK4B 3OKMB 2IPUK 2UY6A 2MWCA 3T2PA 2Y6SD 4OQTL 1CD0A 1AJ7L 3O6FB 5TF1H 5E99L 1A4JB 2XZCH 1MRFL 5GGTH 3FQNA 3OMZA 1QSED 3VG0H 1MHEA 1YPZE 3S88L 1LO0L 3P4MA 1N4XL 1GGBH 1YYML 4Y0GA 5HYFA 1ADQA 4G6AC 4HEME 3U0PB 1XF2A 3ZDYE 4L8CB 3MJ8B 4ETQB 5ICZB 2FEEI 5HHMD 3RWHB 5I0DA 4PJHE 1MFCH 2R39A 3J8F7 3VFVA 1NKRA 5FA4A 3UTQB 3VXUB 2B7DT 3OJVC 5E9DD 3QA3B 1T5XA 4RMQA 1XGQA 2VABB 4JREB 5L6YH 5D5MB 3FL7A 4QHNA 2OK0L 1BX2B 4ZNEA 5I17A 5ECJE 3TNNA 1FV1B 1S7UA 5DI8A 2CRMA 5I15H 4M62L 2A38A 3L3DB 3ZLQC 3DX9A 4YHLH 1DLFH 3FHAA 1VEOA 4YGAB 5KN5B 3OX8B 1G9ML 1FFQA 3ARVA 3GK8L 4KK9D 1EZVX 4MQXC 2NY3C 2ARJQ 4V1DA 4RX4A 1GGCL 5I1JL 3VA6A 4P2RB 5I18H 5T5FH 1WT5C 3FQRB 1WBYA 3L3JA 1PFCA 3JWDL 2E7LC 2G9HA 5FA3A 3JWOL 3KAAA 4YHPA 5D7LA 2JCCA 4NZUL 4ZUTB 1UG9A 4EKXA 5FUZH 1N3NB 3ARFA 3QO0B 1HXMB 3NA9H 5IGXL 3KNBB 5GZOD 2WUBL 5A16B 5DJXB 1QR1B 4OKDA 2EZ0C 3IB4A 3EZ8A 4ONFL 1Q1JL 2WLZA 1MCJA 4QXUH 4HAFA 1MJ7H 3WSQL 3FO2B 4DZBA 5ADOL 4HJJH 1AI1L 4FQ2L 1YC7A 1XIWA 5IHZA 4JM2C 4XCNB 5DUMH 1EEQA 4I13B 3VJ6A 2R0KL 2CUMA 3G6JE 5I76A 1A6ZB 2IQ9H 1S9VA 5F8QC 4OLEA 1FL3A 5IOPA 3BWAB 4WFFE 2ZPKH 3ARPA 3DV4B 4NQCB 4RAUA 4WW1B 3VH8A 1FJ1B 1ZT4B 4PJGA 3VFSB 1NSNH 3QQNA 4LEOA 4X6CF 43C9B 5C09D 3D85A 2F54A 5GRJL 4EDWL 3BP7B 2J2ZA 3O3DA 2V2XB 3JV0A 4LCWD 4JCLA 2NZ9C 4Q9CA 5BO1L 4OZHB 1CFSB 2XZQL 2OTUA 3MLYH 1SBBA 1JGUH 5DMIL 5EBMA 2BNRB 5F7MC 1FGVL 3ZKMD 2YK1H 4WI4A 1E0OB 4I18A 3MRRA 2JJUA 1ZE3C 4L4VA 3AM8C 1JI2A 3EYVA 1A9BB 4CJ1A 3CFDA 4P57A 5IWLC 2ZG2A 3LDBC 4F57L 3DXAE 3C5SA 3L5HA 2R0WH 4LLUA 2BHZA 3FQNB 3QZWA 5DMKA 4D94A 1GOGA 5CBAA 3R1GL 2Y5EA 1MHEB 3U0TA 3P4MB 1G7LA 3CDCA 1XF2B 2DMBA 5MEPA 2F19L 1AXSA 2K7PA 4N1HB 1UC6A 4XZUA 3KYOA 4AEEA 3VFVB 3ZE0E 3LS4L 2PYED 5I19L 1T5XB 5JMRA 2MQ0A 4GKOA 1XGQB 1ZVYA 3HCVA 1WFNA 3FB7A 5EOCL 2OR7A 1N2RA 3MV8E 4QHNB 4JFYA 1ZLVH 5I17B 2FH6A 4NWTH 3TNNB 1S7UB 4XAKE 5DI8B 5LG1A 3HNTH 2IBZX 3SDDD 3GRWA 4TOYL 3MV9A 3DX9B 1AKJA 4KK6C 4DW2L 2DQIH 5EZIH 3E6HA 4JFEA 3KPPA 3SY0A 4OF8A 4OQTA 4CNIA 4MHHG 2EIDA 3C5JA 1N59A 3Q48A 2JJTC 1TNNA 1BGXL 4V1DB 1DBKH 1F4WH 2VO5A 4RBPH 4DUVA 5E8NA 3L3JB 1UJ3A 1SEBA 4Z0BH 3RJDA 2G9HB 1J8HE 5EU6A 3H42L 4K2UH 1D5ZA 2FEEL 3D2UD 4ZQKA 2I9TA 5FA3B 1Z9LA 1EO8L 2V17L 4YHPB 5D7LB 5GSVA 2JCCB 4UTAH 4AG4H 3AROA 4NDMA 5C70A 2G60L 5AZ2L 1XF4B 2ZG1A 4G6AD 1DQLH 4BQBA 2H1PL 5KOMC 3VGGA 3DETC 3WIIH 1FGNL 1BVLA 3QNYA 4X8JA 5BVPL 1CK0H 1YMMA 3I85A 5HYQA 3GJFK 4DZBB 4UOW0 2FO4A 1JMZA 4LHUD 1OT2A 1XIWB 3MUJA 5IHZB 5E08H 2AXHA 3MA9L 4XWOC 4Q58C 3MV7E 4M1GL 3X3FL 2VDQL 5J1AA 4Z7VA 5I75B 1NCCH 3RY6C 3I75A 5I76B 4WHYH 1AO7A 1S9VB 5E8EA 2X70A 4TUOB 5IOPB 4RDQG 5FYKU 3GBLA 3NGBC 1ACZA 5T33H 4QGTA 3ROLB 2GYSA 3WHE0 4MS8D 4RAUB 3ZT7A 2V7NA 2VN7A 3IJHB 3VH8B 3U46B 1MJJA 5EUOF 1N0XL 4K3GA 5LBSH 4LVOB 2DQJL 4LEOB 1WZLA 3D85B 4K3DH 2F54B 4NZRH 4OZIF 3O3DB 5HJ3B 2VSDA 1T1WA 2OTUB 5E2VH 3NH7H 2DLFL 3NIDE 1IQWH 4R4FL 3UPAA 1DQDL 2QSCL 4BQCA 1VFBA 5EBMB 3U9PL 4QRQA 1OAZL 2BOCA 4LPVA 4A6YL 3OWEA 4HUKB 4I18B 3MRRB 1W72A 3K0WA 4L4VB 1OGAE 3IDIA 1FE8L 1WFUA 5ENWA 4JFFA 3MMEA 3CFDB 4P57B 2CKBL 1OQXA 5FFLA 5B8CC 1CD1A 4J4PD 1A3LH 2QLVB 4KI5D 5DVNA 3C5SB 2Z0BA 2YS4A 4LLUB 5HHNA 3UTPD 3QUXD 5C7XL 1E4WH 3QFJA 3QZWB 3CZFA 3MRFA 4WV1A 2EZ0D 2QHLA 5CBAB 3O6FC 1T7YA 3U0TB 1OWWA 3O4LE 2DQUL 3GI8H 2UWEA 1RZFH 3N1MC 1ES0A 5MEPB 5CEZD 5ITBH 3JUYA 4DKDC 5EU7E 5F8RC 3KYOB 1CWVA 1O7SA 1V7MH 4JKWA 4HULB 3HCVB 1SJEA 2IMNA 5IBLD 3FB7B 4XMLH 5HYJA 1KFAL 1N2RB 3FONA 4JFYB 4L29A 4JREC 3CMOH 1DQMH 4L4TA 2VUYA 4EDXA 1RFDL 2E9IA 3KDMA 3O9WA 1VFUA 3RWJA 1YJDH 5E8DL 2NZ9D 3MV9B 1CDBA 1AKJB 2YRPA 2V5RA 4PRHE 3FCTA 1BBDL 1XR9A 3MNZA 1AFVL 3E6HB 5AZEH 3KPPB 3SY0B 4PRDB 1WZMA 3OB0H 4CNIB 2VLRE 3ARRA 3OKLA 3C5JB 1N59B 5IF0A 5A2IH 3WFBL 4QGYA 4PREA 1U9KA 3HUJA 3NA4A 5E8NB 2NY7L 4TSAH 4Y88A 2UZIL 1SEBB 2WV3A 2X41A 2F5AL 3HMXL 4OF3A 2R0ZH 5EU6B 2I9TB 1D5ZB 4JZJB 3OZ9L 4ZQKB 5HY9B 5KTEH 4OGAD 2MMXA 4PJFE 2AP2A 5E0QA 3TNMA 1B0GA 3EFDH 1WJ3A 5B4MC 4GLRH 1T03H 1HQRA 2J8UF 4NDMB 2GFBA 3QH3B 3MRHA 1VB9A 2DWEA 4UILL 1SBSH 1MCRA 4OF6A 4Z7WF 4K8RD 1T89C 1BVLB 2DLEA 3QNYB 1K8DA 4K7FA 3FFCD 4X8JB 4YHZH 5D6DC 1YMMB 2WW8A 4G6ML 2IPKA 5HYQB 2FBJL 4LKXA 4HUMB 2FO4B 5I1EL 2V9QA 1JE6A 3PNWA 1RPQA 4Z7VB 4YX2H 5J1AB 3I75B 4HPYH 1AO7B 2ZOLA 5E8EB 3HZMA 2X70B 3SE4C 3MA7A 4WUKH 2EDHA 4XPAL 2DQHH 3KPNA 3KR3L 2V7NB 4KK6D 1MJJB 4DJMA 4J3XA 2B1HL 4WTZA 3UO1H 2C1PA 2MHAA 5DWUL 4EXKA 3OPZH 5T3ZD 3N85H 2ZCHL 4LGPB 4KDWA 4WTZG 4UI2A 5E7FA 1B0RB 3QP3A 1VKXA 1T1WB 1J9CT 4NFBA 3KPSA 1CDCA 4ZMAT 1IGTA 3K4AA 3HFML 3VW3L 5JQHC 4M7LH 1VFBB 1O5DT 2KPNA 1CE6A 4QRQB 5M7QA 4NUGH 5C0CE 5ANMB 2BOCB 1U0QA 4ZFZA 4JQIL 3DIFA 1W72B 2P5WE 4UV4L 1OP5K 2LABA 4X9HA 5E4EB 3CSGA 2FATH 3EYUL 1UB5A 2F58L 1VGEH 3MMEB 1OCWL 1PKQA 3LRGA 1Q72L 1CFVH 1S3KL 5M95B 5HHNB 3CZFB 3MRFB 4WV1B 4FXKA 2QQKL 4CN1A 5C0GA 1MCPH 2YPLD 5HYSA 4KVCL 4XVSL 2UWEB 3FAWA 1ES0B 1S5IL 2EDOA 1M1SA 5DD0L 2C3VA 2OSLA 1U8JA 1X5FA 2OP4L 3GMRA 1GOFA 2QADD 1D5IH 4NWUL 1SJEB 1PVHA 1RZIA 5HYJB 2WANA 3FONB 4J3UA 1SVZA 4MA8L 4L29B 1Q9OA 1ZEAH 2EDKA 3K74B 1OP5H 4NCC2 4N0FA 2PXYA 4L4TB 4EDXB 1G6RL 3ALPA 4PS4H 3O9WB 3RWJB 4D2NA 4LNVA 1G0DA 5DRZA 3CFCL 3C8HA 4WTXA 4Y4HA 4MJIA 1UJTA 3PWPE 3FCTB 4O9HL 4HWNA 1XR9B 3MNZB 2RQ8A 4X7SL 1YYLL 1LEKA 4YDVA 1P2CA 2PO6A 1P5VA 3NVQA 1WEJL 1IEBA 5IF0B 1VACA 4LSRH 4PREB 5DFTA 2ICES 3HUJB 3BXNA 4AH2A 4JFDE 2VDRH 2J4WL 4N68A 5GS1B 4GH7B 3N1PC 4NNXA 5F6IB 1PEZA 3D3VE 3DTXA 2AK4A 3TNMB 5DQDL 1B0GB 3SKJL 2FLBT 4MZ2A 3CDYA 3CK0L 4U2ZA 4PY7A 4DUWA 1HQRB 2YRLA 3MBEA 5I0ZA 2GFBB 4G7YH 4XVTH 2JKXA 3MRHB 4NRXA 2DWEB 1Q0XL 2PETA 1MCFA 3ARFC 1KNOA 4HC1L 4K7FB 1K8DB 4PUBH 4WY7L 1EHNA 4H8WC 1NFKA 3QXTA 2IPKB 1X6NA 1A3RL 2PNDA 1UWXH 2D4FA 4LKXB 1KJ2H 4XCCH 5DYOA 5HHOB 3PNWB 3VXUD 2JJSC 5EORH 2ICWI 1NGWA 2YUVA 3WS6A 1XIWC 2ZOLB 3HZMB 3HS0A 3K1KC 3MA7B 5I75C 5I2IB 2HJLA 4Z95L 3NBNA 4KGLA 3BJLA 1CDJA 4LU5L 1UH2A 2AW2A 4H26A 3DYMA 3AGVA 2KQNA 4X6BA 1OT1A 2HT2C 4N8CL 4RNRA 5I1CH 5FHAL 3BO8A 5ID0A 5C6TL 4XHJC 3KPSB 5KVGH 2APBA 1RIVL 5L8LB 4LIQE 1CE6B 1QLEH 1S9XA 2VSCA 5EWIL 2XA3A 5DMJB 3DIFB 3W11C 5IMOA 5HD8C 3WJJA 1A0QH 4I18C 1XR8A 3MLTA 3NZ8A 1PKQB 5FV1L 1AD0A 3ARZA 1JRHI 5CILL 4EBQL 2ZCKL 2EDNA 4FXKB 4M6MH 4V2CB 4HLZG 5C0GB 3G6AA 5HYSB 3WXVL 1A22B 1MJUL 2JE8A 2EO9A 4AK1A 5H37G 2C3VB 2OSLB 3OJDA 1XGTA 1U8JB 1GL4B 3DVNB 3GMRB 1I3UA 3ARUA 4OCNC 3RIFK 3A0OA 5HHVL 1RZIB 1Z3GL 1Q9OB 3MREA 5FUCE 4UAOB 4MVBC 2PXYB 2AERT 5KBNC 4NQCD 2FECI 4A6YB 4HQQH 5DRZB 2X4UA 1JWMA 4X6CB 2DJUA 2MPAL 4Y4HB 1L6XA 1LGVA 4D3CH 1KBGL 1LEKB 1VFAA 4HSQA 5J1SC 4YDVB 1P2CB 3QCUL 2PO6B 4N0UE 1IEBB 1VENA 5C0NC 1E6JL 5EN2A 3SGDH 2BNRD 5DJ6B 5AD0A 3EOAB 5FM5O 3BXNB 2W0KA 4K94C 3BKYL 1KJVA 4AH2B 5IB2A 3ULVD 5GGQL 4IMLA 5T1LA 1UJ3C 2GJ6A 2Z93B 3QHZH 4DN4L 2BCKB 4NNXB 3C9NA 3QXVA 4DGIH 3DTXB 2AK4B 4HGWA 3WNPA 2C5DC 4PY7B 5IV2A 3MBEB 4UQ2A 2XQYK 1FC2D 1P4BL 1EHAA 2DWDA 2Y23A 3V4VH 3WO4B 2WIIA 4JG0L 4X80H 6FABL 3P77A 2VKXA 4M8VA 3F5WA 3MV01 1E4XH 5E2WL 1NEZB 4MXVF 5CINH 4XPBH 3INUL 3EYFA 1KPVA 3HNSL 2H26A 5DYOB 3BDYH 4HK0B 2CK0L 1NGWB 3LMJL 1G9MC 1QKZH 3HS0B 3LZFH 2YD5A 1RZJL 1L9MA 3O2DA 2HJLB 5TFSL 4Q6YA 1KEML 4H1LH 3MLZH 4GXUN 1T2JA 3BKCH 1WTLA 4Y8AA 3ARYA 4XNUH 5ILTL 1DBJH 4H26B 4DTGH 1RMFH 4HKBB 3SDAD 3BO8B 5ID0B 3FHQA 4I5BA 4UINH 1RUKH 3L7EA 1FBIH 2B4CH 2YA0A 4RX4D 3OAUH 3S37X 2HLAA 1QQDA 4PBWD 1DSFL 2B39A 4OCXH 1EGJL 1S9XB 5DLML 3TM6A 1N6UA 2P5ED 2O5ZH 3SDXA 1NCTA 4DOHB 4FQLH 5L9DL 5ERWA 1IC7L 1XR8B 2NY5L 3MLTB 5F9OL 1RU9H 5E4EC 3QFDA 2GAZA 1AD0B 3ZYJA 1YQ2A 5F6HI 4EQ2A 2J88H 4LRIA 4UT9H 1J0JA 4D9LL 3G6AB 1FLRL 4WV1C 5FGBA 1OP3K 4HS6A 2F8OA 5L88L 3OJDB 2NY2B 4PJCE 1KCVH 4CDGC 4IOFC 3DHMA 4KMLB 1IMHC 3M8OL 1XIWD 4C56E 3OKDB 3C08L 5FYLH 1UB6A 4ENED 1L7TL 1MCWM 3IJYA 3QDJA 1KIRA 4R26H 2DLIA 3TCXA 3ULSB 2B2XH 3IFNH 2FEDC 5FCSH 3P30H 2X4UB 2HT2D 2AKRA 1JWMB 3D85D 5FM8A 2YN5A 3P9WB 4OZIB 3O9WC 3TBTB 1OAUL 4ELME 1VFAB 2ORBH 1BLNA 2ZNXA 3QDGA 1JRHL 4NO2A 4OZGF 4HPOL 4WJ5A 3JWNC 4MLSA 5DO2D 4RA0C 1EVUA 4LLAA 1RULL 4HEPG 2DIBA 1AQDB 1FDLH 2BNQA 5IB2B 1NMAH 4IMLB 4FQCL 5T1LB 2GJ6B 1J86A 4HGWB 3P0VL 5E6ZA 5KW9L 2NX5E 2VLJE 5JHLH 5F6IC 5IV2B 5HDBE 3L95A 3WFEH 4UQ2B 4YXHH 5MP6L 4KJYA 1Q38A 4G3YH 4OGXL 3UZVB 3AY4A 2DWDB 2FECL 2WIIB 1G6RB 2PUQT 3P77B 1F58L 4PR5A 2A1WH 1SYSA 3U0WH 4YUEL 1UENA 3EYFB 3T0XA 1KPVB 1BJ1H 2EYTA 2H26B 3MGOA 1KJMA 3K8MA 3GB7A 4H8WH 2VISB 3BJ91 4RAVA 3BH8A 1CQKA 2RB8A 3RHWF 2FSEA 4LSUL 1IC5L 2RCSL 5D7KD 1WFTA 4GSDH 5F3HA 2DTMH 2F5BL 3MTRA 4ZPTA 1B9ZA 1BVKA 3V5DB 4P4RA 1X6LA 3MV9D 1AKJD 3QEQA 4UIMA 4QRTA 3D9AL 1YECL 4PIRF 4I5BB 4RCAA 3L7EB 2VUOA 2QBWA 3EDDA 4LLQA 3LH2H 2HLAB 2ITCA 1QQDB 4LPCA 2AV7A 1PZUB 4NSKA 3NAAH 1MIEH 5CJXA 3SDXB 2K1MA 1SY6A 3LPWA 2KDGA 5EU6D 2ADFL 5CWSA 5ERWB 1DE4A 2Z31A 3D0VA 1OTUD 2FYYA 5LWYH 3NCFB 2EE6A 2ZSVA 3QFDB 5FUOL 4QRSA 2GAZB 4LDOB 3MRCA 3PGCA 4TQEL 5IVXA 2IBBA 2FO1A 4YR6A 4YBQC 3DSNA 2VOTA 2X4TA 1IZJA 2GSIA 5JA9A 4ZD3H 1YPZF 2FR4A 4HS6B 2DQDH 4JANA 3N50A 4KI1A 4YZFF 4O58H 35C8L 1YMMD 2UUDH 4XP5H 1SJXA 1CD9B 3KPTA 2VLME 4GAYA 1T3FA 3I9GH 4FMKA 5KZCB 5IBTH 3U4EA 4LQFH 1W8OA 3QDJB 1KIRB 4NP4H 3O45A 5ALCL 3QEHA 4NM8L 4H88H 2AABL 3VXTA 4S1SH 5E2JA 4XP4L 4Y2DA 3PGFH 3M1BA 1QYGH 1BD2E 4UAOC 2PXYC 1KC5H 3BT2H 1ZKAA 2Q3AA 3QIBA 2OL3A 4Y4HC 4HV8A 3LQAL 3QDGB 1PZ5A 3UYOD 5FO8A 3C6LA 3WKNA 4NO2B 3UAJC 3FO1A 4WJ5B 4HGKC 4OM1L 2VZTA 2PO6C 1FYTD 5DURB 2DM3A 4XP1H 2FGWH 5IEKA 4CJ0A 1C5BH 1AGFB 3HR6A 4JVUA 5CZVL 4JO3L 4XPGH 3BE1L 4HXBH 3V7MA 1NCAH 3RZCA 4M43H 4JRYD 4HBCH 4KGJA 3EO1A 2X05A 4BUHA 5A2FA 3L95B 4KJYB 3TIDA 5BMFL 3HI1A 5JW4R 3ZT5A 3MBEC 4HIXL 4PP2A 4PR5B 1BWWA 1RUPH 2YPVL 1SYSB 4ZS6C 4Z78A 3WO4C 1KEGL 1VERA 2YD2A 3B2UC 3OL2A 2EYTB 3MGOB 4KY1H 1KJMB 1TDQA 3NPSC 3GB7B 1MFNA 3E2HB 3BH8B 4ZO6A 4RMWA 4OZFA 2FSEB 5HYJD 1A7OL 3T0DA 4PB9H 4CAGA 4U1JA 1T2QL 5F3HB 2FEDD 4OZFG 3ZHKA 4G8EA 3B4NA 1W0VA 3WS6C 3CSBA 4L4TD 4QTIH 2XT1B 2W92A 4P4RB 2XZAL 4PJEA 3UYRH 3IETB 3QEQB 2DLHA 3QJHA 5EFIA 4UIMB 4QRTB 2DM4A 5J12B 2V6HA 2EDXA 3WFDH 5E6ID 1I1FA 2H32A 4LL9A 5TDPB 2ITCB 3CGTA 2CKNA 2GW5A 2JB6A 1BFVL 3X3GL 4NSKB 3P2TA 3TYGL 1WICA 3MRLA 3CCHA 2E7BA 3RI5K 4CVXA 2Y07L 2EDBA 1XF5B 2WINB 5CWSB 2LAGB 3BPOC 4RWYL 5KVEL 1DE4B 1ULVA 4PGEA 2Z31B 2OJZH 2FYYB 3D0VB 2ZSVB 4ZUWA 3LIZL 3WJJC 1Y6KR 3D48R 4FFWC 4QRSB 3MRCB 3PGCB 1A14H 4MAYA 5IVXB 4F2MB 1JIBA 4YR6B 1FIGL 3ZSSA 2AEPL 4JN1L 4ODSL 2X4TB 2GSIB 4OJFH 5LXGL 1J0HA 2FR4B 4JANB 2H45A 4UBDC 1EIBA 4WWID 1FLTX 4M1DH 3EYQD 3GMOA 3T0WA 4GAYB 3W9EA 2YMXL 1PSKH 1HHKA 5HHOD 2NY2C 3QDME 4R97B 4QRRD 4OT1H 3U4EB 3ZE0F 3O45B 2EDLA 5DHVA 4JY6A 3AFLA 4BSJA 3VXTB 2VXUH 3OTTA 4Y2DB 3M1BB 4JQXA 2VH5L 2HRLA 1MQKH 3QIBB 2OL3B 4WEMB 4M5ZL 1PZ5B 1Q94A 5FO8B 3HMWH 3C6LB 3KPSD 1AY1H 3FO1B 5EIVA 3WN5A 2X1PA 5IEKB 1MRDH 1X5GA 2VR5A 2YN3A 2EE9A 5CUSH 4W4OA 5J13B 5DT1L 4KAQH 5CHNA 3RZCB 1JTPA 1EEZA 3ARBA 4DZ8A 1NAMA 1VHPA 1V7NL 3SN6N 3EO1B 2J6EA 1FIEA 1E4XI 1B4JH 4U1GB 3C09B 2BHUA 2EEDA 3U48A 4JHZA 3TIDB 1JHTB 3C2SA 2EDYA 3HI1B 3VFUA 3D69A 1I7TA 3PDOA 4OSUH 4JPVH 4PP2B 5DEFB 2ZNWA 4Z78B 1JPGB 2B0SH 5JIPA 1UYWL 3OF6A 5TE6L 4OCSL 5E94A 4OZFB 1UWGH 3O2VL 1CLOH 1QBLH 2APFA 3MJ6A 1C08A 3GBNH 1Z0MA 3HNVL 4U1JB 3HI6L 4G8EB 1W0VB 2PXYD 4DKFL 4JY5L 4PJEB 4YDJA 1M7XA 1NC4A 1V8HA 3WLWC 4Y4HD 3TVMD 3QJHB 5EFIB 1HKFA 2OR9L 3RUGF 1RURL 2ZUTA 2AEWA 3L3GA 2PO6D 1DFBL 5TDNA 1I1FB 4JO2H 5I73B 5IFAH 4IOSD 1K5NB 1H3GA 4J12A 3DARA 5HVGB 5EU4A 1BZ7B 3DMMD 4OLXL 1RD6A 3VXRD 4W70A 2W91A 3DPBA 3MRLB 4CRPA 3FN9A 2WQRA 1OTSC 3CCHB 4CVXB 1MIMH 3DYOA 3MFGB 5DQ9A 4H5SA 3I3BA 5J8OA 3RNKA 4PGEB 2AK4D 3D18A 2DN7A 3RZWA 4ZUWB 4XVJL 2WAHA 3N0PB 4WO4A 1PG7H 4MAYB 3MBED 5KOVC 3HR5A 4D9QD 1F02I 1QHPA 4MAUL 4ORGA 3I6KA 4ZS6D 2AK1L 3QQ9C 4PJAA 4XP9H 4LRIC 5FGRA 2F8VA 3B2UD 4KHXH 4S1DC 5I8CA 3DGGA 5FGBC 3LKQA 1GAFH 2EIZA 3GMOB 5DS8A 3W9EB 5LJYH 1UCTA 3DHJA 1HHKB 1IAII 4M7KH 1TJHL 1QG3A 1N6VA 2DLTA 2IAMA 1LWRA 5T5NG 2QHRL 3RL2A 3VXUE 3K46A 5F96H 5EU3A 2VJXA 5DHVB 1IGYA 4JY6B 5FYJL 2BVPA 5D5ME 2DLGA 3MLWL 4R8WH 5BV7H 1LO2L 2HRPH 1DP0A 3MJ9L 4Y19E 3LY6A 4U3XA 1V3MA 4LHQB 1HHIB 3ZE1E 4PRIE 3UTTA 4XCFH 1Q94B 2VR4A 3L3HA 2AQ2A 2VDMH 1EZVY 5F1SA 5IK3A 3WN5B 3P73A 2WBJA 3ZZ1A 3KXFA 4ZFGL 3JTTA 2R29L 4P2RE 4YHMH 2EYRA 5CHNB 4QXWA 5DFWH 2ZUWA 1ND0B 4OBSA 4FFWD 3O6LL 1T1XA 2FJFA 1WAAA 4DZ8B 3JBG7 4WW2F 2FIKB 3V4UL 4PJFF 4KZEH 5K9QG 1W0WA 4WUUE 3P9LA 1LEGB 4OIBA 2L4OA 4HT1H 4BQ6A 2R69L 4G8IA 3ILPA 2R2BA 2W9DL 3D69B 4HKJA 2UY7A 3S36H 3VFUB 1MVFA 4DGVL 3NCBB 1HDMB 4WHTA 3AY4C 1AQKH 2A73B 1JHKL 3F6LA 3MXVL 4TVPH 2NY2D 5F7HA 4J3VA 4JKMA 1RIHL 5K9JL 2VMFA 4PJHA 5E94B 2BFVL 3SO5A 3B3IA 3K81A 4JFPA 2BSED 3RPKA 1C08B 3EO0B 5FEBA 4UNTA 1GC1H 5GS0L 5IMKA 4NJ9H 4AT6A 5GS2H 7CGTA 4U1KB 1P84K 3R06A 1NC4B 4PLJD 5C2BL 4P5TA 4NQCE 4FQ1L 1KCUL 3PDDA 2Q86A 4NGHH 4HWBH 2CRYA 4XAWL 3A6CL 3L3GB 3GMMA 4XPHL 2QTEA 5TDNB 2CJUL 5CIPA 1EEUA 3RA7H 4UB0H 5EU4B 5GGRY 4NUJA 1BZ9A