4P4KD

Structural basis of chronic beryllium disease: bridging the gap between allergic hypersensitivity and auto immunity
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
241
structure length
241
Chain Sequence
GVTQTPRYLIKTRGQQVTLSCSPISGHRSVSWYQQTPGQGLQFLFEYFSETQRNKGNFPGRFSGRQFSNSRSEMNVSTLELGDSALYLCASSLAQGGETQYFGPGTRLLVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYSLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of chronic beryllium disease: linking allergic hypersensitivity and autoimmunity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords HLA class II histocompatibility antigen, DP alpha 1 chain
total genus 56
structure length 241
sequence length 241
chains with identical sequence H
ec nomenclature
pdb deposition date 2014-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4p4kD02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4p4kD01
2R29H 3WKNA 1KN2H 3N1QC 3WFZA 3ME0A 4PV8B 4HKXB 3GEWB 5E6ID 4KDTC 1MHPL 4H5SB 5T3XL 2GHWB 3FB5B 4MAUH 3MRCB 3VFTB 3KJ6L 4POYA 4JKWA 4KPHH 3UTSD 2JK5B 3QUMB 4MJ6A 2R2BB 2IGFH 4FQIL 4YPGB 3A6BL 1JUFB 2OS7A 4KI5D 3WD5H 3HZVB 4S1SH 4JY4B 1J0YA 2ATKA 1OTUD 4H5SA 1TLKA 4QLRA 3QUKB 4QOKA 4JZNA 4PTTA 4KRLB 3BVNA 4JDZB 3DMMA 1OAZL 3U83A 4PV8A 5T3ZE 2CLZB 2W9EH 4ORZC 5DGQA 3FOMA 1MAML 4HMEA 4C59B 1GGIL 2CGRH 3EO9H 3SHSA 5HI3D 1UGNA 5FGBA 4A6YH 5F96L 4MXQD 1AP2B 3WS3A 4WV1A 3ZE0E 3VA2C 4K71C 3FTGB 4PJAA 1UWGH 1XGTA 4PJHA 4M6OH 1LWRA 5JLZB 2ATPB 4FXKB 3LV3A 5JO5A 1Q38A 1TZIB 1U41A 3VD9A 4KKLD 1X5JA 4P5TC 1FNFA 1IAIL 4UDTA 3IKCA 1F11B 3TNNB 3V2AR 4X0KB 1TETH 4AT6B 4MWFA 2X1QA 4A6YL 5JNYB 4OKDA 3GSXB 2Q3ZA 3DXAE 2B4CH 1EAPA 2I25N 2V2WB 4RFEA 1CE1H 2ZSWB 1IT9L 2J2ZA 3VW3H 2VE6B 5IK3B 5EO9A 3MZTA 4F8QA 4ODBD 2H1PL 4YDKL 3MA7A 4LLMB 5FUZH 3OKOA 3GSWB 5AD0A 1A6UH 4E5XB 5EB9A 3C5ZC 1H3TA 4K8RC 3BKCL 5F3HA 1UM4L 4Y2DD 5F1IB 3O9WD 1QNZH 2AXFB 1FZJA 2YK1L 4P23C 3RWEB 1A1MA 5D70H 1CTOA 4PRHE 4XBEH 3TV3H 3C08H 1EZVY 3WFBL 5HHXL 1CIDA 3EYOB 3MGTA 5ABDE 1JBJA 2FLBT 3GIZH 5FXCH 2EKJA 2UWEF 1K5NA 4QXGH 4GW4A 4YEFA 4L5FH 2YXFA 1V3KA 2NW2A 3VI3E 3SDCA 1JZ3A 4JFXB 1FL3B 3PHOA 3MXWL 4LSVL 3VDAA 4LPVA 2ZG1A 4GLRI 4L8BA 1TPXC 3D39B 4OCYL 1JZ8A 4G8GB 2DQDH 3TT3H 3ECBA 4KTEH 2J5LC 2BOBA 3EYSL 3CFJA 4Y5VB 1YYML 4F80A 3SGJA 3P4MB 4S1RH 1W72L 4HPOL 4NHUA 1N0LA 1G7JA 1RZKL 3AU1B 5GZOD 2VXVH 3CZFA 5D7LE 3LZFL 5DRXB 3GZKA 2CDFA 1MFAL 4JRYB 1JFQH 4HIEA 3CSGA 3MMEA 4G80A 4XAKD 2NXYC 4YFLF 1OW0C 4JREB 1BM3H 3L3GB 1DE4A 3C60D 5LCVH 1IGMH 1V7NL 5FOBB 4QHNB 5D7IA 4AG4H 4ETQA 3H9SD 5IFJA 5ESAA 3FQXB 4CVXB 4KJQD 1MAJA 1PVHA 4G8GE 4MJIE 2QADC 1QA9B 2I24N 5SWQB 3JWNC 3NGBB 2RIKA 4EOWL 3HPLB 1XF3A 4OD3H 4ORGB 1Z0MA 3WLBB 5B39A 2ZSVA 3QUXA 3NIFF 1I8IB 1MCPL 3QZWG 1WK0A 4X4XB 4HK3N 2H41A 1CLZH 3MFFA 4JPVH 4R96A 1P69B 1T0NB 5DR5L 1QKZH 4OD2A 5JQ6H 1IGML 1V7NH 3CFBB 1YEKL 2NY3D 1SHMA 3B9KA 1DCLA 4XCYB 3ULVH 4XMLL 5DFTA 2ED9A 1JHLL 2C3HA 1I85C 5FCUL 3C8KA 4YHIB 5DEGB 2DQCL 4I1NB 1H15A 4OQTL 3F5WB 4KKBC 5ICYA 2R2CA 3B5HA 2OTWB 4OZHE 1GAFL 2YRPA 1A6VL 3U9PH 1N3NA 2MKWA 2IADB 1OSPL 2EIEA 1X4XA 5SV4A 1A4JA 4PRIE 4LFHG 4Y4FC 5BRZB 3C5SA 3T0VA 4QGYA 1M4KA 3KJ4C 1UB5A 1B4RA 4Z7QF 5JW3H 5TF1H 3IFOA 1X5FA 1D6EB 3IETA 1G7QB 4UTBH 3VD7A 2ED8A 4HLZG 3HE6A 4C83A 1GGYA 1P4IL 4L8DA 2X4RA 3B83A 2HJFA 5GRYA 4B7IA 1MCSA 2XA8H 1W0VA 4RMUA 3U9UA 2HAZA 5KS9A 5T1KB 4GBXA 3WFEH 1A5FL 4KK5C 4OB5H 5CMAB 3AM8A 3TH4T 1KN2L 3AREA 3L6FA 5E2JA 1N6UA 4KK5D 5IB2B 3Q6FB 2CKBL 5FKPA 3FZUD 2EYRB 1TJIH 2MQCA 1CTNA 3V95A 4G80B 4LLAA 3FB8A 3KAAA 4ODTH 1H8SA 3CD4A 5I8OH 3BVNB 4JDZA 3CVHL 4GBXB 4MCYA 4I3SL 4YHLL 4LSDA 3WEXA 1I3VA 1F6FB 5C09A 2XWJA 1S8DA 4NQDA 3GSNA 1YY9C 4G8IA 1P5UA 1CLCA 5GS0H 3NH7L 4G8GA 2K3TA 4KROB 1D6VH 1JCKA 4XP5H 1I1FB 3EFDL 1ORQB 1N26A 4KJQC 1RZKC 2VZTA 4KFZC 2O5ZL 3MUGB 3S34H 2N1KA 2BVQA 4WENB 5IM7A 4IRSD 4L9LA 4WW1A 4CU7A 4Z8FH 4G9FB 4X4ZA 2AJXL 5KSAB 5DZLA 4G9FE 2OR9L 3SDCC 3Q0HA 3CXDH 2X4NB 3L95B 5TJWK 1NC4B 2IH3B 3JVGA 3OR7A 2J6EA 5DJ2B 3CDYA 4YEEA 2ZSVB 1QLRB 5C07E 5FKAB 1WGOA 3WS6A 1DQLH 5E08H 1P7QD 2VDMH 3RWCA 1VFAA 1RURL 4NUGL 4ZPTB 3MACL 2WIIB 3VRIA 3LSOA 3DUUB 3OAZH 3RVTD 4P46B 3WLBA 2GSGA 4K7FA 5IB4A 5GRVK 1G7IB 1YEHL 4ZNEE 3DVGB 2CJUL 2WSKA 4WV1C 2EDRA 5E8PB 5KANG 3NOIA 2X42A 3BWUC 1CVSC 5D7LA 3CFEA 3HAEG 3FQRA 4U1KA 3STBA 4Z7WF 2X41A 4X7SL 3OKNA 3T0ED 4OLXL 43CAB 1OAQH 5T1DH 1I8KB 1MFBH 2CR3A 2YN3A 5AZ2H 2EDBA 1AR1D 4OIBA 1OCWH 1EMTL 5JQHC 2CIKA 1XR8B 3MODL 5ECJE 1PQZA 1F00I 4L4TD 3MRRA 1OGTB 3I9GL 4ZD3H 5HDQH 1ES0B 5H2BB 5BZWA 2BNUB 3ARVA 4OF6A 4GW5B 3ARED 4C54A 2BOCA 4OZFG 3MR9A 2VMFA 2H26A 3GMRA 4PJ8D 4HBCH 4N8PA 3ZYZA 2DQGL 3VH8G 2BHZA 2YBRA 3TPUA 3Q3GB 2AEIT 1DBAH 1JYNA 2HLAB 4P5MB 4WI4A 4M6ML 4Y16C 4X5XA 2YPKA 4CDGC 4U6TA 1SJEB 4RRPG 4RMRA 4BFIB 4Z7QE 2NY0B 2D7QA 1D9KA 3WUWA 1A14L 1QFOA 5GGRA 4DN3H 4UINH 2AQ3A 1QR4A 4LLDA 5ADOL 2D9QB 5DVKA 2R4RH 1KPVA 2H32H 1RK1B 3AMKA 4PPTA 2DRUA 4Q6IB 4PJHF 3PV7A 2Z4QA 3MLXL 5C2UB 1OTSD 3QBTB 2IBGA 1QZ1A 3CAFA 2DICA 4P99A 4K3JL 5HYJA 4PJGE 5KSUB 5IMOA 5C07A 4N0YH 4E9LA 3TNNA 5I1JH 3O6FA 3DX8A 1EHXA 3D18B 2XZCH 1NEZG 3FMGL 4OZ4A 4X4YB 2R29L 3LHPH 5DK2B 2P5WE 4Z9KB 3KXFB 2WBJD 4LLYA 3ZL4L 4HXAH 3K2UH 1AO7B 3FO2B 3W11C 4XNQA 2AJVH 4EVNA 4K3JH 1G0DA 5FKAA 5FO8B 3GI8L 4Z5RB 2BDNL 2LTQC 2GUOA 4HS3A 3EO0B 4P23A 1MY7A 5MEOB 1U8JB 1YEEH 2Z0BA 2JJWA 2F5AH 5EG6C 3VFRA 1IC4H 3KYNB 4G8FA 4M43H 3WS3B 2VC2L 1WCBB 2XNAA 1NAMA 4GG6A 3WN5B 5D71H 3EDKA 1M7IA 2FX7H 3SKMA 1D7FA 4HHAA 3CFIC 4BKLA 5A43C 1KIPB 4LHUB 4RSVA 4DCQA 4EUPB 1WZ1L 2CKBH 1AHWB 4TYUA 4XRCB 4LCWD 3SKJL 1IFHH 2PTVA 4HC1L 4F8TA 5D6CA 2YA1A 1YEEL 3QDGB 5E6IC 5DEFB 2M8XA 4FTVD 4BFEA 1MFNA 1LILA 4NJ9H 1C5DA 5FECA 1YPZA 3C08L 5K9JL 3QDME 4LCYA 4XP1H 4F37F 4ZOBA 4BZ2H 2W65B 1QVOA 3DXAA 5DD5H 1NEZB 1NUDA 3WS6C 1R3LA 4DEPC 3A6CL 3EOAA 3FOLA 3MOBL 3QDGA 2NTFA 2PETA 4XC3H 4ONFL 4J6RH 4LHJB 3BQUA 3SKJH 2W0LA 1KIUA 1T7WA 2B2XH 4HH8A 2BNUA 3L3JB 5HHOD 2CLVA 3HE6C 2HRLA 3GK8H 2F58H 2PYFA 3IS1X 4FQLH 4YWGH 3FN0H 3DIFB 4Z7WE 5CD3B 5FUZL 2N7AA 3NCBB 1JPFA 3GHBL 5HVWA 4Z7WB 3FJTA 3MREA 5DK0B 4X9IA 5L2KB 2GUOB 4HS3B 3KXFA 1JGEB 2E6JA 4P23B 1QSEB 1RZKH 3MJ7A 2EXWD 3OKDB 4NO3B 1MHCA 1XF4B 2QL1A 4F7MA 1LP9B 2A9NL 5FM5M 3VGFA 4U1LB 3K80A 3UJTH 3REVA 1NBYB 1T03L 3K7UA 3PV6B 5DVMA 4XNYH 2PYEA 5B8CB 4W6XB 3D18A 2BSED 1U8QA 4LCWB 4C56A 4FXGA 3LY6A 3ESVF 5GGVH 1KPVB 3O2DA 3CFKA 3ULVL 4HPYH 1CD0A 4AIOA 1ZVHA 1T3FA 5JORA 5IJVA 4GG6E 3P40A 2ORBL 1MPAL 4OIIL 4DKDC 4M6NL 5HXMA 2RAMA 1CDUA 2OP4H 2CRZA 4MMXC 4OGYH 4PGEB 3SO3C 1T03H 4GXUN 4OLXH 3VD3A 3QHFL 2VUOA 4HIIA 1BECA 1ZLSL 1DUZA 5K59F 3GDBA 3IXTB 3KLHC 1RZ8B 2CRIA 4LPCA 5IJKA 2EKSA 1CFVL 5HGAA 4Q9CA 1IGFH 4KV5F 4ZXBD 1FLRL 4HH9B 4LF3B 4X7SH 2ERJB 2HFFB 1MFBL 3DETC 2I26N 5K9KB 4AH2A 3QP3A 4EQ3A 3QJHB 2ICWI 3BZ4B 4MSWB 4Q6YA 4XH2B 5EZIH 3GBNL 4U2ZA 4JHWL 4P23D 3TBWA 4PJGA 2F74A 1JNJA 2FL5B 1KIRA 4P3CH 1JPST 2AJZB 4DQOL 1UB6A 1CYGA 1FCGA 1G7JB 3JWDH 4NQEA 2WP3O 1H3PH 1WAAA 2JJSA 4L5FL 2P5EE 5BV7L 1X6LA 2XTJD 4A6YB 5HYQA 3WFEL 4WW2F 1ZEAH 5CJXA 5A2FA 2D7MA 2MJWA 4TSBL 2R2HB 2Y36H 3O3EB 5IT2L 1RK1A 4JZJA 4Q6IA 4P5KA 1IAKB 4XWOD 3OQ3B 8FABB 5I1EL 3AROA 5MHSE 4TQEH 1PY4A 5HHME 1PW3A 1F6AA 1FH5L 3PWJA 2KPNA 3PQYE 1UA6H 4PRDB 4U6HA 4UINL 3UPCA 3BH9B 1EEYA 5KN5B 2HLAA 3BXNB 5EBGA 2ADIA 3GMLB 2HKFH 5EU6E 1X44A 4L3CA 3EFDH 4Z5RA 3QIBB 1MCEA 2NYYD 5BCAA 4FQIH 4QCIB 3S37L 1W8OA 3ZYIA 1WZKA 3UTZA 4PRPE 2JIXD 1A0QL 4GMSL 1EHAA 1FH5H 2YA0A 3WFDH 3LRGA 1HHJA 1RIUH 3HUJA 4HXAL 3KYMA 1E6JH 1A7RH 2PTTA 4I0CC 3S96A 1FGNH 4Y89A 4JPIB 5HGHB 2Q76B 5JOPD 5HHMB 4XNZC 4QEGA 4WEMB 4G8EA 4ZFGH 4R4BB 4OZGF 1HQRA 4ZDHA 2DYPA 2LE9A 4IRJB 5JNYA 3RWFA 5HHQB 2AJ3B 4RFOH 1S7XA 4QCIA 4Y4HA 4U1KB 1SYSA 3UCRA 5C8JB 4UUJB 4MQTB 2DI8A 3QDAA 2X1XR 3ZYJA 4X7TA 3RI5K 4R4NC 3RVUD 2BVPA 4KHTH 3NPSC 5D96C 3TT1H 2GTZB 1P53A 2V2TA 2HRPL 3DSNA 1MJJA 4R97B 5TH2A 3UTSE 2FGWL 3ZDZF 2D03L 4TPRH 1A1NB 1UM5L 3QA3A 2FJHA 2JJTA 1O7VA 4M4PA 2P8MA 2H26B 4GMTH 5FGCB 3TJEL 3IF1B 1HQ4B 4LCCC 3D3VB 5SWZD 1Z0NA 1MEXL 3PDGA 5F1SA 1HIMH 4ZAKC 4DGVL 4YQXH 5IW1B 1XR9A 2MPAH 4WHYH 1CDIA 1YEGL 1QO3A 5BZDA 5DT1H 3VGAC 3P9MA 1SBBA 5MEQA 1FVCA 3BH8A 1JL8A 5KS9E 4X6FA 2WNGA 3S5LA 2HJFB 4DZBB 3LRSB 4XI5C 3C8DA 3TC9A 5I8CB 1H3XA 5DC0A 4U3HA 4RNRA 3L1OH 1RQ5A 3ULUC 3H3PL 3WFCL 4Y19D 5K9OB 2WWKO 3CLFH 4M62L 3NCCB 2RHEA 1OAXL 1MJ7L 2C3WA 4NHCH 1FHGA 4PB9H 3U0TB 1IVLA 4JN1H 3MXVL 1QSFB 2HKHL 1S5IL 1M1SA 4AYFA 4NQED 4PREB 3PJSB 2V5MA 2D7PA 5TDPA 3HI6H 4WU7B 4LVHC 1CU4H 2XY2A 5ICYB 4IBLT 4QRPA 4G6JL 4JM2C 3TJHD 5ESVA 3BN3B 3LZFH 1P4LA 1HWHB 5EBMB 1ZHLB 3BH9A 4WUKH 1I7TB 3QJFA 4MQSB 5D7KE 1BZ9B 1U8HB 1KNOB 4MJID 5HJ3A 1ADQL 4MNQE 1HI6A 4IIQC 1G0YR 5ESAB 2IAMB 4E41B 3F7QA 4HWUA 3D5OF 3M8OH 2A6IA 2AJSH 5F7LB 2HJKB 4G6AC 3BUYB 3FT4B 4PJ5D 5INCA 2C1OA 5IFJB 5D4QA 5GRJH 1V7MH 1D6EA 3GMPB 1S7XB 4RFNC 4EOWH 5EU7E 5D2NC 5I2IA 3BRFA 3U30C 2H2PD 5ALCL 3C5SB 3VXRD 3P2TA 1OT2A 4APQC 2BOBB 4TUJB 3O45B 5HYQB 3RNQB 4JLRA 2GJ6E 1XR9B 3MRJA 3DTXA 1J1XL 5IBUB 3D39A 3HLAB 3UZEA 4H8WL 4OKVB 3MRKB 2X4TB 1SY6L 1LO3H 1AD0A 5CEXA 3LEVL 2B5IB 3FB8B 4OGXH 2NTFB 3P9WB 1MHPH 4NOFA 1R3LB 4RMTA 1J0IA 4HC1A 3O3UN 3WUWG 4PBVC 4XNMA 1UWEL 2HVKA 3CCHB 3VWKB 2G5RA 2EC9U 3S35H 4HZAA 2DQFA 2MHAB 5A3ID 2FD6H 2QV2A 3ZSTA 4HIHB 3ZL4H 3B5TA 1M05B 1G9MH 3HNTH 4NP4H 3CX5J 5IHUL 2JJUA 4GG8A 5GGSY 5C0FB 2B0SL 1UEMA 2M26A 4PG9A 3GJFK 3ULUE 1MI5B 4DKFL 3BZFA 3TZVD 3OKLB 3IFPB 4OZFA 5CUSH 1HSBB 1P84J 1OF2B 2VDOL 4LMQI 3CU7A 5I8EB 1T20A 1KJMB 5D71L 4XMPL 5KSVA 4PJ8C 2I60H 4RAUA 3THML 5C0BE 4K55A 3C2AL 4XB8A 1S7SA 2FJFA 1U8PB 4OLVH 2X1PA 1BVZA 5ADOH 3CMOH 5K33A 2OJEB 5E0QA 1DQDH 5LAXA 3S35X 2JJTC 5DZNA 5F3BB 3QIUA 2CDGB 1U8KB 1WZLA 4PGCA 1LO5B 4MHHG 4P0DA 1JPFB 4HULB 5JLZA 5E8DH 4KMTH 4LIQH 4XBGA 5JXED 4JZJC 3I02B 1JTTA 5F72S 5K9JH 5IV2A 3DMMD 2FLRT 3KYOB 3O8XB 5IMMB 4DN4H 1TZHA 1IAIH 3HI5L 4I18A 5DJDB 2YWZA 4HPYL 4X5WB 5I9QC 1DLFL 3VU2A 4HFUH 4UT6H 4I0PD 3WKMH 4WO4B 3HC0A 2OR9H 4NRZA 3O4LB 1XF1A 3QDJB 3D85D 4G7YL 1AC0A 5J57B 5DDHB 2HFGL 5D7JB 4X6DB 2RFXB 5A16B 4KKNA 3FFCB 1IC4L 4M43L 5L0QB 5AYQA 1IAIM 1XGRB 3BD3A 4JFZH 2VZUA 1MI5D 4MXWL 5F9JA 2Z35B 5DJAB 1FNEB 1F11A 5C71A 4D9QE 3AAZA 2IG2L 2JJSC 1CGYA 1HK6A 3GRWH 4HAGA 4OZFH 5ERWA 5ID1B 1XF2A 5C6WH 4E0RA 1N4XL 3TCLB 4P48A 1MFEL 1WCBA 2Z8SA 1U3HB 3FKUS 2QSTA 2HFFA 3MXWH 5C2BH 4YHOL 1KCUH 4NZUH 4PJEA 2RGSA 3O4LE 2EDFA 4HF5H 4PJFE 4K94L 3TVMB 3KPSD 3JTTA 4J23A 3BJ91 3MRRB 3ZKQD 4ELKB 5TGBB 5DD5L 4MLIA 5D7IF 3NVQA 3U1SH 3H3PH 5C0IB 3PGFH 5I74C 3DMMB 3UO1H 1A3LH 3B9KC 3NFSH 1RI8A 5I30H 5D93B 4WWKA 1JN6A 1RZIA 3EOBA 4OQ1A 5FYJU 5EBWB 5CWSB 1TTGA 1QQDA 3FRUB 4WCYL 5IB4B 1ZHBA 4X4YA 1PJ9A 2MOVA 5INDA 4DVRL 2VAAB 2X70A 3ZHDA 4ZPTA 3LN5A 5B22A 5D7JD 5F7YC 1A1OB 2OBGA 2Y7QA 3BKYH 4X99B 2XQBL 4HK0B 2LAGB 4PTUB 3TT3L 3CLEH 3SGKA 2MWCA 2VWEC 1LO4L 2P5EA 5BXFB 4Z0XB 1I7ZB 1KJVA 5GGQH 2WQ8A 4KRPC 4BFIA 5LXGL 3MRGB 1GAFH 3FQUB 1F13A 2BVOB 4PP2A 4HJGA 5TDOB 2D3VA 5DRWB 3TBTA 3NGBC 4XVTH 3MNVB 4JJ5B 4ZUUA 2J7LA 3ULUF 4CVUA 1A3RL 5DMKB 3WXVL 1JNLL 2DIBA 3UZQA 2MNUA 4KAQL 2K9UA 2HVKB 2VLKA 3KPQB 4LKXA 3DRTB 4HUVA 2NXYB 4P2RE 5FA3B 1FNAA 1VGEL 3GMQB 2XA8L 3DXAB 3AAZB 1NBZA 3HCVB 2QEJA 3ALPA 3VXSD 8CGTA 1QBAA 2DLHA 3QO1A 4MCZB 1F97A 4HKBB 1H0DB 1UCBL 4UAOB 5C0BA 3D39E 4ZNCD 4NWUH 2DIAA 4GKNA 4F9PA 3LDBC 3ULVC 3B3IB 4FQ1H 2XICA 2EE9A 2R1WB 2YRLA 4G7VH 2X4OA 4TNVK 1CXLA 32C2B 5T33H 4GAYB 1XEDA 4TSAL 4N68A 1NMCB 3LN4A 1MIML 4W70A 3RIAK 4MYWB 1RZGA 4XPHH 3I6LE 1YEIL 2G60L 3MV9B 4K9EL 4X9HA 5GHWH 5LG1A 2YPKB 3DUHA 5CBEA 4FZ8H 4FABL 4P2YA 5DHVA 3QAZC 4HT1H 3VWJC 4O9HH 4EI5D 1QLEL 1YEGH 1IEAA 5T3ZL 1BOGA 4NJ9L 5E2TL 2EDTA 5HHNB 4N0FB 3FO2A 5EUKA 4XCNA 2NY0D 5MERA 4JY5L 3C5ZB 2NX5D 4N5EC 5I0DA 3D0LA 1XAUA 3ARBA 4GKOA 3SJVE 4LQ1A 1UH3A 43C9B 1YJDC 1GOGA 2Z8RA 5GRWA 1FNGA 2YK1H 4FZ8L 4KMTL 1S7RA 1DLHA 2CKBA 3GJFA 2VSCA 2BCKB 5CJOH 5E6IB 5GSVB 4ODSL 1S5IH 4X9GA 4PJCF 4FQLL 3CVHH 4HW6A 4N0FA 2V7NA 4KI5E 3H9YA 4NRYB 2HT2C 1FO0H 3ZKMD 1IM3A 1RURH 2ADGA 2EDEA 4K8RD 4XMLH 3V4VL 5I75C 1S9KC 3V7MA 2R39A 2R1YB 3KVQA 4WI8A 3X13A 3TIDA 1U8LA 4HWBA 4KHXL 4OI7A 1KNOA 3L1OL 3CFCH 3D2UA 1G9NL 2VDRL 2VXSL 4XWGL 2A83A 1WTLA 2P4AB 4KKCD 1KEGH 1AGBA 1NGZB 2L4OA 3LEYH 1HQ4A 1CGSL 1WV7T 5CEXB 4LU5H 1SJHA 5GGVL 2DL2A 4H26B 3OAYH 3OR7B 5DJ2A 4IDJH 4QRSA 2X4NA 4Y1AE 4K7PX 4KQ3H 5EFIB 5I1KH 3P9LA 5AAMA 2B7DT 4YO0A 1LNUA 3KS0H 4UILL 3X13B 2H32A 2Z93A 5JXAL 4EDXB 1OPGH 5JHDB 4XCCH 4ZFZB 3KPPA 2SEBB 4L4VB 1VCAA 5I15H 2QLVB 1RIHH 4HWEL 1DR9A 5FYKU 3V0VA 2ZKHH 3CX5K 4CNIA 1N0XH 4POZD 4QRUB 5CSZB 3ILQC 4YHZL 1KF9B 4G8IB 2NY7L 4U1MB 3IXAB 3O6FC 1KV3A 3B2VH 3CFDB 5IVXB 5TE7L 4ACPA 4D94A 4PJCE 4NZJA 4U6VL 2BCKA 5J1SC 3PGFL 4OBRA 3RKPA 4KI5C 1ZHLA 3RTQB 4FTVA 4M1GL 2GTWA 5MHSD 4YX2L 2MFNA 5BRZE 1J5OH 2P8MB 3RKDC 4C56E 4N0YL 5F89B 2E8ZA 1MFAH 3GSOB 3PWPA 1YYLL 3ULUD 2LU7A 4X83A 3V8CA 5GGTL 3BPLC 4JRXA 5L2KD 1CCZA 4F7CA 3LOWA 1OD7A 1IGCL 1CK0L 1RVFH 1BD2E 5IVXA 3NABH 3BKYL 2CXKA 3IB4A 1ZGLP 3L3DA 3LEVH 3RGVB 3BGAA 2AGJL 1AI1H 3JV5A 4IMKA 4YC2B 3ULSA 5E8NA 5DHVH 2BDNH 1DBAL 2DLIA 5GGTH 1DE4B 1I1CA 5FYKL 2F5AL 2UVFA 5GSVA 3RVVD 5I8OL 1DQLL 1PZ5A 1G9ML 3GJFB 5D1XB 2ESVA 3SDAD 2IADA 3BW9A 3MLVL 5JTWA 4Y1AA 4JO3H 5IF0B 1TNMA 4HKBA 1MVUA 4XVJH 1TVBA 4DZ8A 2H45A 2FYYB 4IOFD 5B38B 4YUEH 5IEHA 3CUPB 4IIQB 1M7XA 4ZS7L 1EDQA 5I74B 4KJPD 4UU9A 1UENA 5C7XL 2LU3A 1KPRA 2EH7L 1Y0LA 2P7TA 4RGNE 5IEKB 2R69H 3A67L 4P2OD 5KAQG 1FNSH 3TFKD 4NM8L 3SDCB 1UYWL 3SGEI 3V0AC 2NY6C 1U91A 3RTQD 5T1KA 4I2XE 2JK5A 5DFVD 5EIIA 1DQDL 4KK8C 4HX1B 5JPMA 2VABA 2J4WH 4UZGA 1QLFA 5E9DB 1DVFB 5GGVY 4GRLB 3OKKB 5F7DA 3ZTNH 3O3EA 2JB6B 4NC2B 3MQIA 4FQXD 3B3IA 3VDCA 1JVKA 3RA7H 1E4XI 2AV7A 1PLGH 4PV9A 4XNUL 3GKWL 4B0MM 3FRPG 5BRZA 3TA3B 5CKAA 4XX1G 3G6JF 2FD6L 5HBBA 2FL5A 4KK9C 3VXUB 5IHUH 3KS0J 1N6VA 2AKRA 2JB5L 5GS3A 4EN3D 4OCMC 3FCTA 4MD0B 4LBEA 2F5BH 3FB7B 3TN0A 1Q72H 5EOTA 4OQTA 3CFBA 4JHAL 2OX5A 4RGMB 5CEZE 1G7LB 4BUGA 1J1PH 5DQDL 3B4NA 4X6EB 5GS1C 1RK0B 4OUOA 1YNLH 4WJ5A 3X11B 5IOPA 5IQ7H 4ORGA 2AKRB 5TE6H 3PNWB 5HYIA 5BJTA 1SEBB 1W72H 4HPOH 1T1ZB 4ONHB 3KXFE 5DK0A 2XKNB 3WJLC 1REIA 3BD4A 4GUPB 2IALB 4WY7L 3W0WE 5E99L 3O9WB 4XBPB 3HHRB 1OF2A 5DRNA 4PGEA 5FB8A 2CLVB 2J88L 3C6SB 3ARDB 4X6CE 2W9DH 5IJVB 1K8DA 5CP3A 3MBEB 5I73C 1CF8H 2A74B 4AEIH 1U3YA 1CFQB 2H2PC 4YWGL 2E9JA 5ITFB 5GGRB 3HR6A 3LEYL 4QRRA 3OV6A 1E4WH 3JUZA 5I1DA 2IWGA 2IQ9L 3PXHA 4F33A 3HG1E 4KJPC 4Z76B 3S3JA 1JGUH 3OHXB 3GO1L 1JI2A 5FDYA 3TA3D 4Y0GA 4ZPVB 1NGPL 1R0AH 3ZDYF 4PBXA 1TITA 3TYFA 4I77H 5FHAH 4O2EA 1QEWA 3K4DA 3KYAA 5EC1B 1ADQA 2OMBA 4NWTH 4MA7H 3LH2L 1KTDA 4BK4A 35C8H 3RNQA 1B88A 2A9ML 2XQBH 5IG7B 3WSQL 3G6JE 1CFBA 3PDOA 4FQXA 4RGND 1XIWC 4OZHB 1OAKH 4F58H 2APBA 4OZIA 2AXFA 3EO0A 4ZTPL 2AEWA 5BS0D 1AGCB 3A6BH 3NN8A 3DSFL 5C3TA 4PRAA 3V5KB 4LLUA 3HZMB 1LK2A 1OY3B 1J8HA 2VXTL 3RWGA 3SDXF 1J5OL 3DO7B 2IH1A 4ODVL 2I9TA 1RHHB 1WJ3A 2VAAA 4JM4H 1YPZF 4YDJA 3GI8H 1ZHBB 4XB7A 1YYLH 1KLUB 1KYOJ 3VG9B 5EIVA 3RKDD 1OGAD 4PJDB 3OXSB 3WLWD 5FCSH 5J13B 5IKCB 2O26U 1MCWW 4XP9L 4RAVA 1AGFB 3O11A 3BRGC 1Y6MR 4ZMAT 2F8VA 3NAAL 5LGKA 1C16B 3V6FA 1JRHH 3V8OA 3TN0C 5HVHC 1XGQB 3W9EB 3DLQR 5GGRY 5E7BA 3LPWA 3L95A 5SV3A 3WHE1 5JW4Q 1XGYH 4O02L 2R4RL 1OP5H 2BSTB 2BERA 3QEUA 1X5AA 4NRXA 5F71A 1KTRL 3GRWA 5IBTL 4HS6B 5DHXB 2LVCA 4KJWC 4J12A 1T1ZA 5LQBL 4H20L 4W4OC 5L8KB 1WQVT 1RJYB 2BJMH 4U1GC 3UXFA 5KVFH 1ROWA 3I02A 3N9GL 2FZ3A 4LP5A 1RK0A 4NFBA 2WK2A 5KOVC 2BXZA 1LO4H 2GJ6A 1G7LA 5FAAA 3TESA 5JPNA 1GZPB 3FHAA 3TYFB 3IFNL 3ZT5A 1I1FA 4ELMF 3KPOA 1UA6L 4BK5A 4RGNB 4PJIB 4ONFH 1Z9SA 3LKRB 4ODWA 3BP6B 1QFWI 3FO9B 5KANI 2R69L 2VUYA 1DANT 4OUUA 1HOCB 3AB0C 5L8JB 1HNGA 3BPOB 3O41B 4W6WB 4YR6B 3W39A 2P43B 3VFSB 2EIBA 2YD4A 1RFDH 1JYVA 1ZLUH 2EDYA 4IM8A 3C09C 4GMSH 1A0QH 3EJYD 1AGCA 2X4OB 3GBLA 4MNQA 4ZUSB 3PDOB 5F1NA 4BSVB 3IDNB 1IAOA 1MJ8H 1INEH 6CGTA 1O7SA 1VERA 2R1YA 2Q7YA 2BNQE 5C0GB 2GAZB 5C0RH 5DD3H 3TPUB 1AD9B 3HE6B 4X9BA 4KGLA 4BA8A 1KJ2H 5D5MB 1C08A 3O2DH 3D6GA 2DLGA 2J8UF 2QR0B 3KLAA 5TE4H 2VXVL 5F7UA 1YUHB 4NDMA 1INEL 4ODUB 1OTSC 1SYVA 2R9HC 3I2CH 3QQ3B 2VQ1A 4MA1C 1FVEA 1B9ZA 1M7DA 5E6IA 2NW3A 3QQ9D 4OD1L 3NPSB 1ZT7A 2HVJB 2RB8A 25C8H 1GH7A 1OSZA 5SWZA 2P24B 5GS2H 2HTLD 2NX5A 3TZVB 3W0WB 3ARQA 1MJUH 2A74A 3ARFA 2BK8A 1IE5A 1HE7A 1CIUA 5AZEH 1NCNA 4IHOB 4TTDC 2OSLA 3ZLQC 3UAJC 1F4YH 1XF5B 2W91A 3FL7A 5E8NB 5C08E 4R7NA 4JDVA 4K3GA 2C4FU 1WF5A 5I17A 1QFWM 4D0CB 5DUPH 2F19H 3MUY1 1BJ8A 4JG0L 3VXTB 2VITB 5DT1L 4WY7H 4OTXL 2YSSA 2V2XA 4YHYC 1IQWL 5E8EB 1W8NA 4NQTA 4OLZH 4FQHA 1M71A 3BRDA 3ILPB 1ZAGA 1RIHL 1ONQB 3LS4H 3PWNB 4Y7MA 2O93L 4HDIB 3U9PL 4S1RL 3EOBB 2EXWC 5C09B 3KLHD 2Q8BL 3SGEH 4NPYA 4JFYB 5JZ7C 2XT1B 1NJ9B 4TUOB 4W68A 3MMEB 1T1WB 2XN9B 5T3XH 2F19L 1PKOA 5KG9A 1LD9B 5ESQA 3GBMH 1AXTL 3D85A 3U2SA 2X1WL 1LO2H 4EUPG 2OK0H 4UT7H 4O51A 4JRYE 4POUB 4JLRB 3C6LA 3VE0A 3NZHL 4PJBA 4ZS6D 3WBDA 3QHFH 3GMOB 4PJFA 1KG0A 5I2IB 4ONOA 4XVJL 5EU6B 1DVFA 5SX4H 4OD3L 3IJHA 4JFXA 3MCG1 3U46A 3VFUB 4R2GD 2JCCB 2ICWJ 5IW3A 2YUXA 2IANE 1GVIA 1KENL 2XXCB 1SMOA 1QFHA 1CFNA 3SOBL 3GSNB 1C1EL 1BAFL 1FNHA 4LOUC 5IEKA 1NC2A 2J6EH 3N0PB 4LARH 1O5DT 2WIIA 2WMPA 3GM8A 5FUOL 3VRIB 2K7PA 1T7YA 1E6OL 1BREA 4ELMB 3GSOA 2VXTH 4CKVX 1I3RB 3QEQE 4PJIF 1IM9D 2Y72A 1UCBH 2EEDA 1FORH 4Q2ZB 3G04B 1VEPA 5HTSA 1FSKB 3ULUL 4PP1D 4YBHA 4HDIA 4CADB 1IT9H 3WJJA 5J06A 3D9AH 3GB7A 4HUWB 3WFCH 3L3KA 2WBJB 4MNGB 1ZMYA 1WBXB 4RBPH 4HMDA 3T0XA 4ONHA 5J1TC 4J8RB 5JMRA 3HZYB 3PNWA 1U3ZA 3VFGH 2EIDA 4D0BA 5C70A 3H7LA 2G60H 2KUTA 3MUGA 4K9EH 4NN5B 5TFSH 4FQJH 1DUYA 4Q9BA 3K1KC 1I9JH 4R4FL 4OFKA 1MHCB 1XF4A 3HRZB 4ZFOA 4XBEL 3QIUB 3RGVA 1U58A 3RVXD 5EU5A 4RWYL 4JHBA 2DYPB 2DQHL 5J12B 1NEUA 3ARFB 1CDYA 2CGRL 3EO9L 4DFIA 5JMOC 5BMFH 2Q76A 1T2QL 2VKWA 4RA3A 3QCTH 4LHUD 3MRPA 1IJ9A 1OTTC 1NKOA 5CLWA 4QWWD 3GUTB 1BF8A 5F89A 3EYVA 4ZTOH 4ZS6C 3U2SB 1NGQH 1J7VR 3BGMB 4FTVB 4J3VA 1CXFA 2ZOKB 2E3VA 3NACL 1ACYL 2FATH 2D4DA 1I3GH 1HH6B 4M00A 2APWA 1HDMA 3FQWB 5CMAA 2IANA 1H8OA 4R0LB 4N8VA 4XNYL 4KI5F 3O2VL 1W0WB 4M7LH 2HFGH 4FQXC 2NXYD 4BQ8A 4P2RD 3VXPB 4DGIL 1JZ4A 2XG4A 4I0PC 4AENB 4L4VA 4MS8C 1Z2KA 2BHYA 4Y1AD 2R1WA 3O6FD 3P0YL 3Q5TA 1MCKA 1QNZL 1VA9A 5D1ZB 5HHMD 2H3NA 2ICWA 5ENWA 4G9DA 4U7SA 3KGRA 3WFBH 1HQRB 1QBLL 1MCFA 4KROC 4P2OC 1YEJH 4DWHA 4XPGL 1UB6B 3RIFF 1KYOK 4PBWD 3I2CL 1N3NB 2HFEB 3JWOH 5F9OL 1T7VA 2NY1C 4ZTPH 1NSNL 3TNMB 1SJHB 2X4SB 5DF0A 2APVA 2BRRL 2X10A 1K6QL 5DJCA 2UVEA 3IDIA 1JF6A 1UJTA 3E6HB 4Y8AA 4M93C 2V9RA 4G43A 3SGKC 2DJSA 1ZSDA 3RL2A 3QB7C 2EZ0C 4GSDH 4JFOB 3MRFB 4QO1A 4N9GB 1N8ZA 4LCUB 3UTOA 4M6AA 4XCCL 3VXMA 3CMGA 1F4YL 2HLFC 3EYSH 3IRZA 3RU8H 4UIKH 5J4MA 3HMXA 2ADGB 3EYOA 2VDOH 3MV9A 1OAXH 3ARRA 4HJ0D 3K0WA 4EQ2A 3VFVB 2YC1B 3FMGH 1FZMA 4Y16D 5ESVB 2Z92A 2A0LC 4CW1B 3EKCA 4LSTL 3OMZA 2R23B 1G7MA 1ZHNA 2DLFH 4WW2A 4I8DA 4FNLL 1CQYA 1OB1A 4FXGB 4U1JA 2ZCLH 1T4KA 3EOAB 3FOLB 3MV7D 6FABH 1JWMB 1BZ7A 3L5WB 4LIQL 2PUQT 3EJYC 5JIPA 1S7QB 2EDDA 4OF5A 2XIDA 5HPOA 2CKNA 5I73B 2ITCA 4MSWA 2OYPA 1G1CA 3RPKA 3IFNH 3TBSA 3NCJH 4X80H 3DV6B 4UTAL 1WFNA 2YA2A 2DQCH 2FZ3B 3E3QE 1T0PB 2XTJB 4MZ3A 1AY1H 2AJUL 1I7UB 2NQCA 3DTXB 1X6NA 5A2IH 3RBGA 2QQQA 3RZCD 1MY5A 1RFDL 1E4JA 3GO1H 3ZKSD 2CIKB 4P9ML 4PJEF 4M1DH 1BGXL 2A6DA 4MX7A 1L9MA 3S7GA 4NQCD 1R0AL 3WFHA 3IS0X 2IMMA 4TSCH 1UZ8B 4E0RB 5I1HH 2IAMD 2XN9A 3IDMB 4TOYH 3H42L 2PW1A 3U82B 4ZSOA 3EDDA 3TIEA 1FGVL 5FYKD 5C0NC 4UQ3B 4QHLA 3VFOA 3FT2A 3ILQD 1RMFH 3N9GH 2R0KH 2MQ3A 1X5IA 3FFDB 3C6LC 2FGWH 3NFPB 1EJ6A 2KZWA 3PWPE 3GMQA 4F58L 4TPRL 4XPHL 3S97C 4PJ5A 1OB1B 3C87A 3LKNA 5TE4L 1P4BL 2HTKD 5IB3A 2ZUUA 4JG1L 3ZE2E 3EO1A 1DVFC 4ZOCA 5MP6L 3T8XA 2ITDB 1KULA 4I48A 2F53B 3GSRA 1LEKA 4HIXH 5F9WC 4HS6A 1KPUB 4NZRL 5EO0B 2D7TH 3JV4A 4RX4A 2ZNXA 4P46C 2YN5A 1JGLH 4XP9H 1NCAL 1ND0A 1UG9A 3PUCA 3BHBB 1HYSD 3KPLB 4JRWA 3T77A 5L6YL 3N06B 3G5XB 3GI9H 5FO8A 3D0LB 3KLDA 1NMCC 2YD5A 4JFOA 4NKDB 3L3OA 3SE8H 5ICXA 1IQDB 1FO0L 1YEIH 4NNYB 4NZDA 1ZT1B 3MOAL 3HAEH 1HKLH 3KR3H 3PQYA 3LDBB 5HHXH 5GGQL 4ZTOL 4BSWB 3MFGB 5KBNC 1EH9A 5E8DL 5HY9A 4CVWA 5J3HC 1HHIB 3HC4H 2DTMH 1A22B 4DW2H 3WIHL 5IFAL 1CLYH 3QEGH 5TDNA 2XWTB 1HSBA 1QSVA 4H1LA 3FT2B 3SN6N 4PGJA 2R23A 3F7VA 4CN6A 3QDJA 1HN1A 4PJXE 3SE9H 5DXWA 4JRXE 3RIFK 4OGAC 4Y4HC 3D48R 4KZEH 3EZ8A 2H6PA 4K8RH 4HHAB 1N5AA 1NFDA 3WKML 4JPWH 4R4ND 5TDNB 2E9BA 3HG1D 4XBPA 3KPTA 1OP3H 1ZS8B 2BVYA 4OCWH 3UTTA 4U1IB 4JKMA 1TZHB 5KZCD 4OT1L 3T3PF 2HWZL 4R0LA 1ZOXA 1MCIA 4X7EC 4Y2DB 5A40E 4L8DB 1QHPA 2GJJA 3O2WH 4Y4KD 4UUJA 2Y23A 3O6LH 2XZQH 5LCVL 4WW2C 4PJ5E 1GZPA 4XP6H 3F58H 4LPUA 4XXDA 4JPWL 3QDMA 1T66D 1EIBA 3Q1SH 3BKJH 4L9DA 4UNTA 5SWSA 1TMCB 4CBPA 2CIIB 1NMAH 1H3VA 1RZ7H 3TFKC 1N4XH 4NT6B 2WAHA 3KPNB 1PGRB 4X6DF 1U2CA 4H88H 3MLYL 1ZHNB 3C8KB 2YMXL 4YHIA 5DEGA 2HH0L 5IIEB 2FBJL 4BH8B 1LO3L 3MRHB 4AEFA 3HA0A 5C0AB 4ALAH 2J6EL 5DD0H 4LSQH 3VFPA 3W9EA 4UBDC 5I1KL 2BC4B 4NO2B 3T0AA 4JFDB 3IDGB 4JGJA 3BUYA 1MWAL 4PJ5B 4LCWA 5F70A 1S7VB 2WLZA 3O8XA 3OX8B 5DC4B 4ZO9A 4OV5B 5I30L 4ZFFB 5E6YA 2WWMC 4AM0A 1P2CB 5IB5B 1TCMA 1I9JL 5AZEL 4I9WE 1HH9A 3HG1B 4MZ2A 3BX7C 5LAXB 3JV6B 3SO5A 1MREL 2D2OA 4V1DA 4ZFGL 2NY7H 4EBQH 5B3NA 3VXMB 2F54A 1HHHB 3KPRB 3HPJB 3MRKA 3SKNA 3GIVB 4Z7VF 5I1JL 1E4KC 5DJZA 2HG5A 1RJZB 1YJDH 3QFDB 1IC1A 2PYFB 3BW9B 3P77A 1CICA 1A2YA 3BEWB 4X9FA 2CRYA 3H0TA 4JFFA 4ZUTA 4GRLA 1IC5L 5CP3H 3QIWB 3MUZ1 2FH8A 3DI2B 5K9KA 3MLPA 1C8PA 1L7TH 5HDBF 5D1ZA 4X8JA 2E7CA 5MEQB 4Q58C 2EH7H 4JY5H 3S8WA 2VDLH 4YO0B 1C5DB 4TRPH 3QFDA 1MF2H 4CJ1A 4KQ3L 1WWWX 3M1BA 4JFDD 1WAAE 1ULVA 2ADFH 5HJ3B 3EHBC 5GRVL 3OGOE 2ICES 1BOYA 5KVEL 2X5PA 3C6LD 4TUOA 3UJTL 2GTWB 2B1HL 4DZ8B 2QQNL 1MVUB 1QR1B 2YPLA 4P4RA 5EZLB 2VR4A 4PJ9D 4XAWL 1HKFA 1FJ1B 4CMMA 4WEBH 2DQTL 3MRMB 1KT2A 3VFRB 12E8H 4NSKA 3K1DA 1BQHA 4HIXL 3LQMA 3MGOB 3LD8C 4JN1L 5CP7A 5I1GH 3X11A 2VSDA 2VLKD 2FATL 1WIOA 2J8UB 3A6OA 1K9TA 2IJ0C 4ZOAA 3UYPA 1U8KA 2IPTL 3DI3B 5ISZD 3MRDB 4PJHB 3IVKB 2ZUYA 2OLDA 3C09B 2ZPKH 4UT9L 3H8NA 4YX2H 4R90L 3ARYA 2A1WL 5GS0D 3O3BB 5BQ7A 5IBLD 1CR9L 4PG2A 3GI9L 1F3JB 4NUJB 4W4OA 1U95B 3CPLA 1BVLA 4P3DA 2EDWA 4Z77A 5DHYA 4HGKC 3MCLH 4OZFB 3I75B 3VG0H 1NDMA 1I3RA 3BP7B 2WV3A 3GKWH 2FB4H 1T0NA 4MA3B 1NGZA 5FHBL 4L8BB 3GM0A 4IJ3C 1GOFA 4P3CL 5F9AC 2ZNWA 5I16A 4HWEH 1Z5LA 1D9KB 4U1GB 3U0TA 1ZGLM 3OBAA 3RVWC 3BQUD 4IS6A 4YXHL 4YHZH 5BOPA 4I18C 5D2LF 2IMNA 3ES6A 5E4IA 1OTTD 4UV4L 3OPZH 1HYSC 3MX0A 1UH2A 4UTAH 4C83B 4CUCA 2GIYA 4P2QA 2UZXB 1U93A 2ZP0T 5J11C 5DMGC 2CSPA 1KB5A 2PCPA 1YNLL 5IQ7L 1AQDB 3GSQA 4LHUA 4M6NH 5JHDA 3ZKMC 4LGSB 2DJUA 2YPLE 3NCJL 3NIGF 4EDXA 5CBAB 1UKQA 4U1HA 5HI4C 4Z0BH 1KUMA 3V9FA 1Z9MA 1T21A 4JAMB 3IGAB 4B50A 3QO1B 5CINH 3A67H 3CH8A 4Y5VA 2AAVA 1JNLH 2W38A 1TVHB 4XH2A 2NY5H 2Y07L 4GKZA 3WIHA 3FRPA 1YN6A 3ISWA 4QNPE 5JW4R 2Z31A 3DMMC 3MLRH 4X0KA 3O4OB 4L4TB 3P4LA 1NCUA 3QWRA 4PLOB 3KLAB 3KPQA 3BO8A 4JFDE 3ARBC 5F44A 1KTLA 4EEEA 3EDEA 1GGBL 4AEHH 1EV2E 1WBYB 3ZHLA 5I15L 4OZIE 4LFHD 3R1GH 1S7VA 1D5XB 1RULL 1EEYB 1T6WA 1HSAB 2FBJH 1CZ8H 3RA7L 3DX8B 1P4BH 4NWUL 4Z78A 1K6QH 5JR1H 1L6XA 4JRXB 3UPAA 5KSBB 3MRIB 1KJ2A 1OARH 2A0LD 4U49A 4P4RB 3SEPA 5FOBA 5IROC 3C2AH 1C1EH 2ZOLB 1BEYH 3L3GA 3SY0A 1YNKL 4PRID 2GK2A 4U31A 1L0XA 1UXSA 2V5SA 4D8PA 4UBDD 3AXLA 4N5ED 2XN9E 5IKCA 1XGPA 5F8RC 1FNGB 1KGCD 4PRHD 4NCC2 4JQVC 2B2XL 2AJZA 2NLJA 1UWGL 3RI5F 3GSXA 1A7PL 5JOPE 3F6IA 4LSPL 3IKCB 2C3GA 4HLZH 3MV9E 2P8LB 4EI6A 4RMWA 4BJLA 1PDKA 2QKIB 1BOGB 2UY6A 4GFTB 3DRTA 3DVIA 2QBWA 1YPZE 5T1MA 4WFEE 5DRZB 2AV1B 4ISVB 3ES6B 4MNHA 4EKXA 3ESUF 3G5XA 1A7NL 2OJZL 4LGPB 1X5XA 2MCPH 5I19H 5EC2B 4KI1A 4PGBB 3PWJB 4AEIL 1PLGL 4XNUH 2VB5A 4R97C 1AO7D 3QEGL 2H1PH 4OFYD 1T1XA 3TBYB 1SJVA 1P5VA 32C2A 4NO5B 4GAGL 1SM3L 2AK4D 3OF6D 1N5YL 1AXIB 3MRGA 4M62H 3U48A 2XOTA 3HFML 5CCKH 1QRNE 1DSFH 2VZ1A 1L9NA 3GRWL 4M48H 1X4YA 2E6PA 5IBTH 2MCPL 1JYXA 4K7PH 3RVTC 4EI5B 1D5BB 3TPKA 1GCFA 2XTLA 5J6GB 5T3XD 2FSEA 5BV7B 3HCVA 1A3QA 1A6AB 15C8L 2DB8A 3RP1A 1KEMH 2R2BA 4OIIH 3O2WL 4F7EA 5GIRB 3QWRD 4TNWK 3CK0H 5F1OB 1NBVH 3ZT6A 4WDIB 2QHRL 4R6UA 1P84K 3V6BR 5IHZB 4U6XB 2CXGA 1OAUH 2C4FT 5F6HJ 2BY1A 3HC0B 2WUCH 4NRZB 4NO3A 2YPVH 2XTJE 1HEZB 4PY8I 4QXGL 4RQQA 2AXGA 1MEXH 2Y6SC 3VDBA 1B90A 1U92A 5DI8B 4ZSOE 4R2GC 5EU4A 1I75A 5ELIA 3QEQB 1DBJL 1FIGL 1CLYL 3VWKC 3QWOB 1DLHB 2CKBB 4OM0L 4AK1A 4PRIA 3T77B 5BJTB 5LKNA 4QYOA 1VPOH 1BIHA 1YMMB 3NCEB 4ALAL 5DD0L 1MCWM 4U1SB 3ARBB 5DWUL 3T2PA 4NDMB 4ODUA 3F7YA 2Q6WB 3MOQA 2NR6C 5L7XH 5DTFB 5GS0C 1OQXA 3MSPA 1T22A 3MFFB 3UJIL 5B39B 1PAMA 4O2FA 1J1OL 4YAQB 5E9DD 3GMMA 3AY4C 5GSRB 1NBYA 1IRAY 1CFVH 1BQSA 4A2LA 2VXUH 4Y19E 1MUJA 4XCFH 4MGXA 4EN3A 2AV7B 2DQIL 1S9XB 1EEUA 1JHKL 1SBSL 1FZOB 4YHMH 3U1SL 4XPBL 1UWEH 1EZVX 2XZZA 4OD1H 5EZIL 1ADQH 4JHWH 4R26L 3RGVC 1I7UA 5BO1H 1WUNT 2YMXH 2IAND 5CIPH 1VENA 2DKMA 4X5XB 3L5XH 3GSNH 3QULB 3LMJH 5ACZA 2AI0L 1F4XL 1HYRC 5EC1A 4PYGA 1D9KC 3CC5A 4PJ7F 3VFNA 3B6SB 5TF1L 1E6JL 1T1XB 2X4RB 3BPLB 1P1ZB 1AGEA 3OZ9L 3BZ4A 2Y06H 2OI9B 5I71B 1BD2D 1KTDB 3HNSL 3UTTD 5D9SB 3QNXB 4M5ZH 5CJBA 5ERWB 5FO7B 2CDGA 1LDPH 2DWEA 5I1IH 1JPSH 3EFFA 3VJ6A 1K4DA 3MRLA 4Y5XB 4U1SA 4HH9A 1GIGL 3SOBH 3PL6B 4X6CF 2I9LA 4B41A 4I2XB 3BT2H 1J10A 5BW7C 4JQVA 4YDIL 4CMHC 4LSUH 4N0UB 3RDTC 3GNML 3FN9A 1DN0B 1J05B 4XVTL 2QJDA 1CLZL 1EGJL 2I5YH 4XHJD 1VGKA 5E94B 2CLRA 5DS8B 3OKLA 5JIIA 1XGPB 1QTYT 4KRMB 2X1OA 3WXVH 1DTUA 5L2KE 2A77H 3GMPA 5FYKE 3VGAB 4QXUL 3QUXB 1I7RA 1MHEA 3MLUH 5FYJL 2EDXA 3TZVC 5IR1A 5CILL 3R8QA 2X70B 1KCLA 1FBIL 5D2LA 5IESH 3QCUL 3DGGA 3C60C 1WBXA 1K4CA 3VXUE 4QT5A 4X6EA 2ARJB 4PY7A 2OM5A 4PGCB 5E5RB 1Q0XL 2CJUH 3PWVB 3OKDA 3U4EA 1U8PA 4OJFH 4RMSA 5DLMH 1NC4A 2IH3A 5EOQH 3X12B 2FYYA 5B38A 1T2JA 1T2QH 1WSST 4JN2A 5BS0B 1FL6A 5CS7A 3VXOB 3JTTB 5EO1A 3KPMB 3OJDB 1N5AB 1F42A 4NZRH 1TJIL 3OG4B 2R4SH 4LASL 2MMXA 5C0FA 4WI6A 1QLEH 5C2BL 3MJ9L 5EU6A 3T2NL 4EZMA 3HS0B 3QZWA 3PWUB 1AC6A 1B6DA 2ICWB 4S1QL 1FE8L 3ULVF 4JY4A 3O2VH 3LKPA 4M7LL 4D0BB 4MVBC 3VH8B 3S3PA 3L3DB 4RGOL 3HR5A 5EN2B 1QFUH 3OKKA 2QQKH 4IRZH 3VE0B 1BX2B 1ZLUK 1I3GL 5IW1A 3MGTB 5E1AA 3PABB 4Y5XC 4LNVA 1GSMA 4NO0A 1XIWA 3WEXB 3NA4A 1AO7E 3BE1H 1MCNA 4JGUA 2QSQA 4NGHL 1AD0B 1F6LL 2AK4E 1E4XL 5JUEH 2VZOA 3NCYP 5HYJE 2EYTA 2VLRA 4WCYH 5FM8A 3L6FB 4IRZL 2BXYA 1W0YT 2NZIA 1CL7L 3LQZB 4OCRL 3OAUL 4Q7DA 2AJYH 5IEHB 3U9UB 3C60B 2YD9A 4HWZA 4UDTB 3MRDA 1EHLL 2YPVL 4LLWA 3FFCE 4XP4L 5CSZA 4U6VH 5HVHB 3LHPL 4OT1H 5FUCE 3WDIA 5IB3B 1T89C 4K9EC 5I8CA 3GJEA 2OSLB 5CP7B 2HJKA 5CJ5A 5DGRA 1B0RA 2F15A 3DVGA 1G7IA 5D6DC 3OAUH 1EO7A 4Y5YC 3Q6GH 2R8SH 4PJ7B 3VG9C 5IGXH 1YEHH 4RRPA 5DWUH 1LO2L 2E7MA 1TJGL 1DZBA 1K3ZA 4G5ZL 3RRQA 1VFMA 3PGCA 2B1AH 4Z7OF 4KZDL 3ELAT 3RL1B 3DSFH 4UILH 5C0BD 4JCLA 4NFCA 5JXAH 4QRPB 1VGEH 3MRNB 3P73A 1BQHG 2QR0A 4OD2B 1OARL 1U2HA 5ALCH 3S88H 2ZCHH 3QUML 3RX8A 1XIWB 3BMWA 4XPGH 2W9LA 3V52L 1NUNB 1Q8MA 2A73B 3L5JA 2XQYG 5GS1A 2GT9B 3E0GA 2R8SL 3IDYC 4DTGL 5K9QI 1DBKH 3NFNA 2XKSA 4OM1L 2AERT 5KS9B 5EC2A 4J3XA 2DQIH 1EXUA 4EIZC 3BDYH 2R0WH 4PIRF 2ZCKH 4Y19A 2D7NA 2YEZA 4HV8B 4XZUA 3KWWA 3SCMD 4XVUC 4J1UB 5HPMB 1DEDA 5C0CE 1A5FH 2NZ9D 1GJIA 1XF5A 3IFOB 3HMXL 4D3CL 3RUGA 4LNRB 5TF0A 3D0VB 5B8CC 3IJHB 1MNUL 3VXOA 4O51B 1MQKL 4NQDB 3E2HC 4KKAD 2DQUL 5EFIA 1AXTH 2H2SD 4PJGF 2XWBB 3OPZL 2VLLA 1IGTA 2J12B 5MEPB 5K93A 1CICB 2C9AA 1EA9C 3AS3A 4HWBH 4C4KT 1DSFL 1MCRA 4X7FC 4WIQA 2W0KA 3P0VL 4JFYA 1IGIL 1MCCA 5IHLB 5J7CC 1HNFA 1F2QA 5FV1L 5CUSL 1DBML 4NBZB 1QRND 4QT5B 1CDBA 4PJAF 1PKQB 1K5NB 2FEDD 3H3KA 1FGVH 4CRPA 3EYQD 4KROD 3TBTB 4PRDA 3A6CH 1YQVH 1XIWD 3MRFA 4JO3L 1RJLB 5D7IB 4G6KL 3J7HA 1H5BA 1Q9OB 1JMXA 4IEFB 4TRPL 5C0AA 3G04A 4OZGE 4DEPB 4IRSB 4E5XA 1CE6A 2ADFL 2V7HA 5I17B 1A4JB 3MZGB 4QHUA 2XPGA 2X4PA 1X7QA 1KCSH 4CVZA 2G9HA 4M8QA 1HCFX 1QSEE 3BPNB 1MRCH 2OTWA 3JTSB 3B8SA 1S78C 4NKMB 2JCCF 2PTTB 3ULUH 4CDHA 1KLUA 1G1YA 2O61B 2F54E 5DD3L 4KJYA 3TA3C 1P7QB 2D7TL 3QQNA 2VZVA 3UBXA 4ODWB 1KCKA 3O2DL 2A9NH 2EICA 1F4HA 5C0CA 1EGJA 2DM7A 4F7MB 2ZZUT 3FT3B 5H94A 2VL5A 3PF2A 2DOCA 4LDLB 3BOVA 1CE1L 1WFOA 4YFEA 2DLEA 4XC1L 3OSKA 3MYZA 2E9IA 3FQWA 2BX5A 2D7OA 5DO2C 1DUZB 2AW2A 4BZ2L 4PJEB 3PP3K 2NXZC 3U79A 1W72A 4KTYA 3S4SA 4Z7UE 4XC3L 3GSUA 4H26A 4NN7C 2EEAA 5HDQL 3U7WH 3I75A 1QBMH 1UM6H 4MLSA 1QSFD 3PGDA 2FRGP 3KYKH 4QOKB 2GT9A 3TO4D 2DDQH 1N7MH 1VACB 4IOIB 4KJWD 1NGQL 3QXDA 2ZUQB 5CSGA 5CJQH 1GGTA 1XGUB 3QXAB 5D1XC 3ZE0F 3HI6L 3E1F1 4QHKI 3K81A 1PX3A 3QIUD 1HILA 2EE2A 4M03A 4N8CL 1E4KA 4L4JA 4NGHH 1YDPA 5GZOC 1LK3H 2AJUH 4PP1C 5HI5D 4M5ZL 5CWSA 5D6CB 1R6VA 1I9IL 1MHEB 4Q6IC 4MJIB 3OJ2C 4DKEL 1P9MA 4G6FB 5DSCB 3VFPB 2UYLB 4MA8L 4Y2OA 5AG8A 3HKFA 4UV4H 1RJYA 2YD3A 5DS8A 4GO6B 4O5LL 1NLDL 2RJMA 2AEPH 2ICCA 2X44D 5IIEA 4R4BA 4L3EA 2P42B 3VXQB 1U8MA 3HRPA 3JUYA 1A7OH 3DIFA 2HT4D 4NT6A 1I8MB 1F58L 1FG9C 3HAEB 2V17L 2XG5A 5BVPH 1IEBB 3OB0K 4JKLA 1KB5L 1IMHC 1FYTD 1VEMA 3DHJA 2KDGA 3BUTA 5F3BA 3DX6A 5EOTB 3VRJA 3I85A 1KCRH 4PJDA 4HEPG 3VCLA 2OL3H 2JELH 4MAYA 3BP5B 1HZHL 4UTBL 1I85A 2FSEB 2W9EL 2VLKE 4QY8B 1VPOL 4ZUWB 3O6FB 2KQMA 3SDYH 3MLWL 5GRUL 4P2RA 4WDIA 1MIMH 5INDB 4MXVF 4KHTL 5KSBF 4UIKL 3HS0A 5D1QB 5B38G 4KDWA 5HYJB 1YN7B 1RULH 5CGYD 4BM7A 1C5CH 1FIEA 4OCSH 1IILE 1QQDB 3FRUA 3QUYC 1CGVA 1OAKL 2JB6A 1FAKT 1FNSL 2HKFL 2QADD 5L9DH 4WV1B 3T0WA 2HA1A 5J11B 1EFXB 3S4SG 3TVMA 4PB0H 5GRZA 4B5EA 5DMGD 3NBNA 5DJZB 4GAFB 4QKXB 1OAYL 1WISA 2IAMC 4MNHB 4XNXL 4RA0C 1LD9A 4ZO8A 3IAGC 3MROA 2BFVH 1TXKA 1D9KD 4HKZA 3IU3A 3QDGE 5JW4N 2HFTA 2PO6A 4GQPH 4EI6B 1KPRB 1EVUA 5LBSL 3IJSB 4LKXB 3OAYK 3OHXA 3G6AB 1HHGB 2W59A 5DRZA 3TCLA 9CGTA 4FZEL 4FQHB 4E41E 3L3HA 4EDWH 4GRMA 2C4XA 4KTDH 2RFXA 2I07B 1OTUC 5E5MB 4R7DB 2JIXA 3BE1L 3D3VE 4ONGL 2AEQL 3HE7D 3BP5A 2F58L 1K3IA 4P5TB 1JPTH 3QIUC 2BJML 2KBGA 3SDDD 3DX6B 5DSCA 3J8F7 3NPZB 4M9OA 5L88H 1QLFB 4WTZA 5DJ6B 2CDEB 5HYJD 4KTDL 5E08L 2VXQL 3H42H 4M6OL 5IV2B 3NFPA 4YHNA 1D5IH 3MACH 5DC9B 4G6KH 1NCWL 1RY7B 4I13B 4LLVA 1LP9E 4FFVD 5DJDA 1YUHA 1KELH 3N1PC 4RFOL 1FFNB 1RZIB 2ESVD 4HXBL 1FYTA 3QNXA 4P59L 2ATPA 3FFCD 5AG9A 1EX0A 4UU9B 1NCBH 3K3QA 1T04B 3X14B 1U3JA 4GAJH 4YHKH 4PR5B 3U4BL 3NCMA 4YDKH 5IHBA 4N0CD 1SVZA 2PTUA 1W72B 3WYRA 4PRBA 1PY9A 3O6KH 2OXGA 1DN2A 1EMTH 1IM9A 4D0DA 3DX7A 3C5ZD 1UWXK 4NQCA 1OGAA 4AL8L 4QRUA 1PYWB 2GFBA 4UQ2B 2ZCHL 5DFWH 4JJHA 3QG7H 3KJ4B 4XAWH 2FBOJ 5JOFA 3GSVB 1BQLH 3PGDB 3GMNB 4L3AA 1ZVSA 2YD6A 3QIWC 4HIHA 3TH3T 2DBJA 35C8L 4P2RB 2W65A 4YXHH 4L8CA 5I18L 1MFDL 4Z76A 3SE8L 1JZ2A 4WGWB 5HHOA 1U93B 4KJYB 5D7IE 3BKJL 1I9EA 5D1QA 3LKRA 4P9HC 5GRJL 4QRRB 1AE6H 5ILTL 2BY0A 4QRSB 4MJ2A 3ZO0A 1CGXA 3P73B 1RUQH 1KBGL 3AC0A 5SX4I 5GSRA 2P5WA 3LKOB 1DQQA 2CR6A 3V6ZB 2Z92B 1KIPA 1JGDA 4W4NA 2QQLH 1LGVA 1E4WL 1ES0A 5CKGA 2YD7A 3WHXA 5ALBH 5M7QA 3B9DA 3P4OB 4P2QE 3QXWA 3VXQA 3PHQB 3U6RB 3M17A 4QRTB 1Q94B 1HSAA 4K8RL 4WW1B 1MCOL 2NY5C 3QNZB 4XPFH 4PGZA 2AXGB 5F7MC 1IL1B 3P30L 5KJRL 2PW2A 1X5YA 3GSNL 3K4ZA 5D8JH 4B7LA 1HXMB 4RNRB 1AO7A 2EH8H 3HNVH 2Z8VC 2CK2A 4IRSA 5E1HB 4RQQB 4J8RA 4OIAA 2FO4A 4ODTL 4NYLA 2W0FB 1KT2B 5JHDD 2FHFA 4Y5VC 5JQ6L 1FQ9C 2VRAA 4L4VD 2V17H 3DUUA 5HGHA 5INCB 5J6GA 1NGYB 1N64L 4M1DL 1OGAE 2EYTB 3QFJE 2DQJL 1R3HA 4Z7VA 3TA3A 3HMXH 3FQTA 3VGGA 4D3CH 2BNRB 3PP4L 2FECI 4OCLC 4NQCE 5EUOE 4NBXB 5EBMA 4JM4L 1CXKA 4M1CD 2JE8A 4FRWA 4X6DE 2BMKB 4PGBA 5F9WB 2X09A 3GSUB 4X5LA 2QSVA 1GOHA 3MYJA 3VXNB 4DUVA 4RZCB 4RIRB 3WV0A 1XCTB 1H8NA 3BP4A 2ARWA 4MXWH 5MP6H 1X5HA 1AQKL 2SEBA 4KRNA 4QGTA 5AAWA 3GMRB 4UDUB 4JM2F 3VG0L 1F3DJ 5KVEH 2AV1A 4ISVA 4D0DB 1UYWH 1KJ3L 3C8HA 2F5BL 1KCVH 4O4YL 1MCLA 4GG6F 5C0RL 2P45B 5L0QC 1BZ7B 3O3DA 4PJFB 2VDNL 2DL9A 1WEJL 3REWB 2C3VA 1CFQA 5KOMC 3OJDA 1LNUB 3SE4C 1UM6L 4G7YH 4AY0A 5HYSG 3FO0H 3HI5H 4PJXB 3JV6A 3QA3B 2VZ3A 3QQ4A 2A83B 43CAA 4EN3C 3CDGA 2Z8WC 1S9YA 2Z91B 4OLYH 5I6XC 1DLFH 4LDOB 5DVOA 4LLVB 1V5JA 2J88H 3QH3B 1SJXA 2MKLC 3VFMB 4XP5L 4KU1A 3BIKA 4M48L 3CK0L 2V2XB 1T5XA 3WIHH 5IFAH 2FWOA 2O5ZH 2NR6D 3ULVE 4LGRB 4CVXA 3U0WL 1M71B 1NAML 1U6AL 2DKUA 4OF8A 2VDPH 4OCNC 4NYLB 4OZHF 3JWOL 1YMHA 4KUZH 4NKIH 1MRDL 3UJJH 3GJEB 3MTRA 4OTXH 2LVEA 3MLRL 4MVBD 5EOCL 1KOAA 4RISH 3CZFB 3H9HA 5C08A 2HVJA 5SWSE 2OP4L 3MV11 2QQNH 43C9A 2ZSWA 4D9LL 1G6RL 1WFTA 3CFDA 4GJTB 2P44B 1ZLSH 4U1NB 5MEPA 3RIAF 1WT5C 5EBWA 1F3RB 4G8GD 3O6LL 1ZA3A 5DR5H 2EDQA 1NC2D 3B9AA 2DM2A 1A3RH 4M5YH 4NKOA 4E41D 2EXYD 4JFHD 5KVDL 5EPMA 5MI0C 1SEQH 4PJ9C 2VLJE 3BXNA 1UKSA 1QP1A 3EIFA 2DKSA 2R56H 2GKIA 4LF3A 3K8KA 4Y8DC 1BHGA 5GZND 4J1UA 4JQXC 5JA8B 1EFXA 3ZE1E 2UZIL 5DUBB 3I3DA 1GXEA 4LVOC 2H6PB 2GAZA 1T0MB 4WI3A 1A1MB 4PJ9B 5IMKA 2R0LL 1U3HA 5GXBB 5JW3L 3T4YB 5ESQB 3NFNB 2DQEH 2P5EB 4I3RH 1B4JH 3LKSA 4YIQB 5H35B 4DVRH 4U0RB 3BYTA 3O4OC 5I16B 2R56L 2NY1B 1LE9B 3HZVA 3L5XL 5BW7A 1MWAA 2Z9TA 1LDSA 3CFJB 2VERN 5KS9F 2E7BA 1XGRA 4QTIH 3MBED 3UTQB 1RUQL 1FL6B 5ALBL 3W39B 4D9RD 4YFLI 1XGYL 5GHWL 4H25B 3QJHA 4MCZA 2DAVA 1A3LL 1JN6B 1AHWA 4XNXH 1KCRL 3CDFA 4TULL 4MMZC 4O9HL 4F3FB 1NMBH 3SGDH 1AKJA 4WFGE 3X17A 1HXYB 1B0RB 1K85A 4BZYA 3SKMB 1AXSA 2FEDC 5BRZD 4YDIH 3MREB 2EH8L 3HNVL 1U8MB 2DM3A 3VD4A 4R0LC 4XCEA 1CGWA 3PWLA 1J11A 3LQZA 5EU4B 1IEBA 3V0WL 1GIGH 3DGGB 3HAEA 4TTGA 4OCSL 3C60A 5HHPA 5BXFA 1GL4B 3QQ3A 4DJMA 2BNQD 1XZ0B 1K4DB 1DQQB 4Y5XA 2LFGA 4JM2B 1J88A 3VXSE 3BQUB 4ODSH 3K2MC 4R9HA 1XF2B 1B6UA 2YUZA 4UV7L 4JY6B 1NFDE 4OLVL 5FV2A 4NO0D 1YDPB 3UX9B 3ZE1F 4PJFF 5B8CA 1MQ8A 1XF3B 1P7KA 1KENH 3FO1A 1G7PA 3QG6B 3V0WH 4KWUA 2P5ED 1ZXQA 3PIQB 2GYSA 2R2EA 2GK0A 3WIFB 1ACZA 3VXME 1MJ8L 1J8HB 5JO5B 3V4VH 1T83A 3B8YA 1CG9A 1WBZA 4P2OB 5CHNB 1KACB 2B1HH 1FFPA 3REVB 4PG9B 5EBLB 1A7RL 4HT1L 4GRLC 1FZOA 1OGAB 4IRSC 4QXTB 3V4UH 4EJ1C 3OGCA 3QNYB 3GMNA 5C07D 3VXRA 2DMBA 1LEGB 4GW1B 3LD8B 5C0BB 1C7SA 1F5WA 4I0PB 3QHZH 4JFFB 2HG5B 3K46A 4MS8D 4JN2B 1PG7X 3UDWA 4URTB 2NY6B 1KIRB 4O4YH 1HIML 1JPTL 4NQEE 4FQXB 3D85B 5ICZA 3D39D 1FSKC 4L1HA 5EIQA 5FGRA 5ITBL 3WNPA 4ZPVA 3UBXG 3TBSB 5CILH 4F9LA 5CJOL 1ZE3C 1FL3A 3PHOB 1X5GA 3FONA 5H8DA 2F8OA 2C3XA 2ARJA 3TH2T 1A7BA 2BOCB 1BBDL 1JWUB 3EOYG 5BMFL 1BJ1H 3Q2CA 4OLYL 1N59B 3OKMA 4KHXH 4JRYD 2X7LB 1GYAA 5C0CB 2PR4L 5EU7C 4I5BA 4HXBH 5FGSA 3H3BC 3MCLL 3K4AA 4JDVB 4PLJC 4X6CA 2UWEB 4HF5L 3Q5YA 5EUOB 4XVSL 3FB6B 5CZVH 4PLJD 4OV5A 1A7QH 1FFOA 4GRWE 4ODHH 5HI5C 3SBWC 1UCTA 4MDJA 2NX5E 5GJSH 2IALA 1CICD 1G7MB 1DQML 4HUKB 2VDRH 2VXSH 1A6ZB 3HFMH 5CCKL 3WJLA 1OOAA 4MQXC 4MB5A 1TJHL 5DD1H 4NQSB 2MHAA 4OGZA 4K7PL 1R3KB 3QWOA 5I1AB 3MUHL 4QHLB 3MJ9A 5GISH 3QDMB 3U0PB 1MRDH 5IROA 5I1LB 3LEXA 5HHNA 5D5MA 4LBEB 2EYSA 4OLEA 5J6HA 3QIBC 1UZ6E 4WNQA 2X4SA 2FIRT 3B6SA 4H1LG 5DQ9A 4DKEH 2ZG2A 4M4RA 2W07A 4YFDB 2ADJB 1T21B 4YHPB 3FCTB 4MD0A 2NY3C 1QPXA 3QEHB 3KHQA 5IVZA 1UJ3C 5B4MD 5E4EB 5DJ0B 2Y07H 4OCWL 1X5ZA 5ICZB 1CFTA 3N1MC 1N64H 4ZUVA 4I0PA 5C0CD 5CHNA 5HYEA 2OMNA 3OKNB 3LKSB 4M7ZC 2BVTA 2UUDK 4YIQA 1ZGLB 2XZQL 4J3SA 1B4JL 3MRBB 4U6YA 2DJ4A 3PIQA 4PG2C 3X3GH 1TVDA 3V52H 3FO9A 3P30H 5KJRH 1DQJB 3DROB 5I1DB 4N0CC 1UJ3B 2LV4A 4ZXBA 3LQAH 1A6VH 4U3CA 4NC0B 1CD1B 1C12A 1RZFL 2BMKA 2YWYA 3CVHB 3MLYH 1JGVH 4N8VB 3ARWA 4AQ1B 5B3JE 2VH5H 3MLWH 4LSTH 4DCQB 4LRIA 3PGCB 3QXTA 1MQKH 2VKXA 4H0GA 1YMMA 5F6IB 3CPLB 3IFLH 1RUML 2Y36L 3E3QC 4G5ZH 2GTZA 4S1QH 4YGAB 1T83C 1V3LA 3T1FB 2CRMA 3TO4B 1TVBB 4LPYA 2XY1A 4AJ0A 5DO2D 1KXQE 3C5JA 1RHFA 2DLTA 4WJ5B 3GHEH 1OAYH 2C1PA 1BWMA 2W0FA 3MV9D 3OKEB 1MFCL 3BSZL 1UWXH 4K3DH 3OG6B 3HE7C 1CE6B 1DBKL 3V4PL 1JK8B 2YD1A 5KSAD 4WRLA 3D9AL 3IDIB 1AKJB 1A47A 5HHVH 5GJTH 3P3YA 1A6AA 5EOQL 1RHHA 5I1IL 1KFAL 3BYYA 3ZKNC 2YKLH 4Q0XH 1TENA 2VDPL 1OQOA 2AGJH 3CXHJ 4PS4L 1AI1L 1J8HE 5D8JL 3W81A 1F02I 12E8L 3IFPA 4U1HB 4M61A 3P4OA 1NLBH 4IOSD 4KMQA 3NA9L 3I3EA 4RWYH 5A3IC 3T1WA 2Z91A 5IBUG 5I1GL 1Q9WA 5DURB 3PXJA 2I60L 5ADPL 1YYMH 2HLFD 5GJTL 1QHOA 4KRPD 3VWJB 4F2MB 2GJZB 1T1YA 5E2WL 4W6YB 1NFKA 3T4YA 4NHCL 1FYTE 1RUKL 1NGXA 1VADA 2QHRH 2DQJH 3T0EB 2BVPB 1MRCL 5H37G 5JW5A 3QHZL 1R3IH 3DVFA 1HDMB 2Y4SA 4WFED 4M5YL 1CR9H 1KB9K 5DUBA 2ORBH 5HHOB 3SDAA 4MNGE 3RZWA 3RZCA 4UDUA 4AMKH 1A9EA 2PN5A 1UQSB 2ZOKA 5MENB 3BP7A 4XC1H 4JKKA 2J8HA 4FMKA 3JXAA 1G9NH 3Q48A 2Z35A 5DJAA 2XACC 5E2WH 1TQCB 3B43A 2BP3A 4UAOC 4S1DC 3HLAA 4Q9QH 3EZJB 3N50A 4BQ6A 3HE6D 4I0KA 2ARJQ 2DM4A 3QUMH 2YD2A 4PJAE 3BGFC 2NTSP 1OGTA 2A6JB 2WIMA 1E0OB 2Z93B 2J4WL 4PJGB 5F8QC 5F88B 4NKIL 1J18A 4A2MA 5KG9B 2DYPD 3UJJL 2H2SC 5FIEA 1Z5LB 2PO6C 3TYGH 3VRLF 4NQDE 5FKPB 4O2CA 4JFPB 4FFWD 1I1AA 3D3VA 2X05A 3FQRB 4OQTH 4HCRA 3W0WD 1NGWB 1EAJA 1OP5K 2FWOB 3RL1A 5JA9A 1IKFL 2DDQL 4H88L 4QHMA 5E8PA 1JF1A 2FDBP 3T2NH 2VLJA 1F3JA 4NUJA 3X3FH 1A7QL 5IGXL 4TULH 3BO8B 2H8PB 4WHTB 3FO0L 3RWEA 4ZQKA 1MVFA 2B4CC 1T5XB 4Y4FD 1JP5A 3QWQB 4P5KB 1CDJA 2NY5L 3RX7A 4HZLB 2FO1A 3RU8L 4JRYA 4KDTA 1S7SB 1TZGH 4YZFF 1HWGB 1A6TB 5C9JA 4M1CC 3BD5A 4LLQA 5AUMA 2H9GA 1IGJA 3R06B 1WWCA 2KL6A 1DBMH 2GY7B 3KXFD 3EYUL 2Z31B 2Q1EA 1F4XH 2R0ZH 1TTFA 2FJGB 4QRTA 5D1QC 3D0VA 2C3VB 5MERB 2P24A 1FJ1A 5IVOA 3HNSH 4JPIA 3BZFB 1LE5B 5J0BA 2VISB 3EYFA 3OB0H 1A6PA 2PCPB 5F7DB 3SQOL 4MXVE 5EORL 2D31B 2OL3L 3S6CA 3HZKA 4U0RC 4BQBA 1IC7L 2ADIB 3O6ML 4XCNB 1U42A 1B2WL 2IFGA 4MAUL 1JWSA 1C5BL 4MDIB 4TOYL 3I6LD 1OSPH 2IPKA 3O3AB 1RZ8A 3DBXB 3TVMC 2JELL 3SDDA 4HIJB 3CSBA 1INQA 1DQJA 4FQCL 5F7EH 5GS1B 2XKUA 4IDLA 5ETUA 1OHQA 4MA3A 5ID0A 4OZGB 5BOZG 5CD5C 2XZCL 2DWDA 3WDJA 2YXMA 1HHHA 5HDLA 3MLVH 4JO4L 5D1XD 5F9DC 4LL9A 2DMKA 3QR2A 4JZNB 4PTTB 5MI0B 4NM4L 3DWTA 2FJHB 1H0DA 2Y5EA 3JWDC 5T5NF 3PWNA 3BEWA 4PJ7A 3S88L 2V2TB 3BP6A 1V8HA 5EO1B 1RZFH 4PD4J 5ITBH 4E42A 4PJIE 3UYRL 4LRNH 2N4IA 3CDCA 3SBWA 3WCYA 3BDXA 4H20H 5IWLC 3G5VB 3SGDI 3ZKXB 4Z7NF 1VESA 1JK8A 4PJBE 4HUVB 4Z95H 3SDYL 1NAMB 2R0KL 1MLBB 4K3DL 4GG6B 1J12A 1I1YB 1UT9A 2A6KB 3L3KB 1NL0L 4HIIB 1R5WB 3O8XC 5JZ7D 3RVXC 5HHPB 1HKLL 3F12B 4R4FH 1QACA 5HGAB 4OV6F 3TO4A 1FN4A 3HUJF 1JV5A 4HFWA 3VWJA 4M7LT 1MJUL 3BKCH 4X99A 4L3EB 4ELMA 3UP1A 4WU7A 1PG7W 4Z95L 1C08B 2GY5A 2VLRB 3ROLB 5F3HB 1HEZA 3VXUD 2FHCA 2VLRE 4FQ2L 3FB6A 1NL0H 5DK2A 5KSAC 3MGAA 1MFEH 3AS1A 2F8XC 3RY4A 1A1OA 2Y7QB 5C6TH 5FECB 5EH1A 3I6KA 4CJ0A 1NLDH 3KPNA 1F8TH 2VQUA 3RWGB 2EXYC 3ARFC 3FN0L 4BQCA 3L3HB 2NZ9C 3BZEB 4NQDD 3LIZL 1SM3H 4IOFC 3H0TB 3LRSA 4HGWB 5HGBB 3HE7A 4PRPB 4PLKC 4KTEL 1EUUA 3O6KL 1LP9A 1DDHA 3KYKL 3VFSA 3NFSL 1S7WB 1MHHA 1CGSH 4PJ7E 5C6TL 3L3IB 4CAGA 2LU4A 4MNQD 3WHE0 5IB1A 5CZVL 4Z7UA 3Q1SL 1T0MA 4UT7L 3IDYB 3KG5A 1LVEA 5T1MB 4HKJA 2VZSA 4AMKL 3PQYB 5C86A 5GJSL 4H0IA 4O58L 4Z0BL 4KKAC 5J89A 1JGUL 5AZ2L 1WWBX 1I3UA 5DQ9B 3KPRA 2APXA 3MV8E 4NOBA 3CVHA 4GW4B 5JDJA 4P2OA 2J8UE 3U7YL 3RQ3A 1EBPA 1LQSR 5DEFA 3MNVA 1FC1A 4Q9RL 3QO0A 1RZJL 1R5VB 1OT1A 1FIGH 1I7RB 1CICC 3G6JA 4HCRL 3UTPE 1NCDL 4OI8A 4JG0H 4NO2A 2Z31C 3GBML 4ELME 5FK9A 5GGSA 3EJZD 3RUGF 3RVVC 3RWFB 4JANB 2IBBA 5AD0B 3VMOA 3OKEA 1UXSB 1KBGH 1CL7I 1MELA 3G6JB 1XZ0A 4YC2C 1HCVA 1QBML 1MREH 5KVGH 5MEOA 2W92A 1YMHB 5JR1L 4IHOA 5GGTA 4U7MA 2JF1A 1V3JA 4PRPD 1R5WA 4MB3A 3WN5A 3CU1A 4GKSB 1FCCA 4L29A 5CIPA 4L4TA 1WICA 1SEBA 1MCQA 4AIZB 1WBYA 1BFOB 2FJFB 4LDEB 4XMKH 1X9QA 2G2RB 3GMLA 4U6XA 4OZHA 3HN3A 3PQYD 3OKYA 5JXEC 5I75B 2PO6B 1KC5L 2VAJA 5L88L 1JHTA 1L7TL 4C55A 1CGTA 1I8LC 3MLSL 2GW5A 3F7RA 3OGCB 3QNYA 4LHUG 2BVQB 1U36A 2IBZX 3QUZA 2YKLL 2Q86A 4Q0XL 4LSSL 2AI0H 4JREC 2AK4A 2R2HA 1NPUA 3F7VB 3OJVC 5LQBH 1YEDB 1BAFH 3FHQA 1YN7A 5C6PB 1FVDB 3MO1B 5CBAA 3T04D 4NQXA 3TO2A 1BFVL 1YJDL 2VN4A 4GH7B 4LLDB 3QT2A 4GG8B 4FZEH 3MLSH 2X4UB 5JIHA 4FQJL 5DUML 3FFCA 3S5LG 3T0EC 1JMZA 1RUKH 4N8VG 5D7JA 1MFCH 3BSZH 2W0PA 5DA4A 4BZ1H 4X6BB 3SKOB 3H7BB 4JFEA 2ZG3A 1JPGB 3K8LA 3QG6A 4LAQH 1KN4H 3FONB 5H94B 3EUUA 1S9VA 2R4SL 4LASH 3VFGL 4JVPA 4NKOB 4Z77B 5ICXB 1ETZA 1S9WB 5IF0A 2VDLL 1IKNC 4HK3J 3O0RL 3BESR 4Z8FL 1NDMB 1WEJH 2GJ6B 5DUMH 1Y6KR 1BVKB 3B2UD 5T33L 3OB8A 4DGYL 1ITCA 3G5YB 1K8IB 1FO0B 3F12A 2F53D 3TYGL 3NZ8B 5DJ8B 1MI5E 4IMKC 1PQZB 1T3FB 1FORL 2EDNA 3PWLB 4J4PD 3STZA 3O8XD 3B2UC 1HHKB 4PUBL 4MJ5B 3MGOA 3D25B 5D1QD 1T7XA 5GIRA 4CGTA 1B3JA 2HN7A 1RJLA 3BIAX 4W81A 5FYLH 4PRHA 4CMMB 4L1DA 1YA5A 4F7CB 4ZOEA 1Q0YH 1WC7B 4HS8H 4QRRE 3O4LD 3MV01 4V1DD 2P5WD 2V9QA 2O5XL 3VRLE 4EDWL 5AYUL 4QHMB 2QHLA 1WT5A 2GI7A 3UO1L 3L5IA 3W82A 2NPLX 1J0HA 1NDGA 4TVPL 4WVRA 2COQA 4UQ3A 1I9RL 1I1AB 4BSJA 3QG7L 4ESKA 2F54D 4IOIA 1YC7A 2JLLA 1S7TA 2P8PA 4GRWF 1Q0YL 3NCFB 4L3EE 5IM7B 1N0XL 3S37X 2EIZA 3DRQB 3MJ8B 3WL9B 1N2RA 5KW9H 2HJLA 4NO0B 2CMRH 3SPVB 3SE9L 4GSDL 2UUDH 2XRAH 3FZUC 1LEGA 2IGFL 3AGVA 4LSRH 3CLEL 4ZUTB 3LVEA 1BJMA 1CDGA 5L8LB 1FG2B 4YXLH 5GISL 2X89A 5D7KD 2K7QA 4F37K 4OKVA 1B0GB 2MSPA 4RIRA 5C09D 4JVWA 4GQ9L 4QOKD 3MJ8A 3WL9A 3EOTH 1FAIH 1YY9D 4XHJC 1P7QA 1QKZL 4XXCA 4OM1H 1JZ5A 2X2YA 1YEKH 3DJ9A 4EUPA 5F96H 1S5HB 4F2MA 4QHKJ 5CEZD 4JFFD 4NPYB 3TWCH 1FC2D 4P9HL 5C3LD 2J8OA 4WW2B 4YBQD 1BQUA 4KKLC 4Z78B 5EU3B 2DWDB 2AS5M 3B9EA 5DHYB 4JKPH 1L0QA 4GQ9H 1FN4B 1CD9B 1BQLL 2XI9A 5C0AD 2Y5TB 4OI9A 3MRPB 1I1AD 5F93C 2Y6SD 4WHTA 1NGWA 1U3HC 4JFDA 4OBSA 5I18H 2A2QT 1N8ZB 5EORH 3SO3B 3UDWC 1I1YA 1X5KA 1TJGH 3QUZC 1J1XH 2HN7B 4WU5A 3CDGB 1D5XA 4KPHL 3RVWD 3OX8A 4Q2ZA 3UTTE 1XCQA 1KLGA 4K3HA 2EO9A 3WD5L 5C8JA 5JW4M 1SMAA 2VLLB 3S9DB 5EO9B 3QCUH 3MRQA 5TDPB 1L7IH 3RL2B 4HWZB 4H25A 1KJMA 4BUHA 2VC2H 1FO0A 4QRQA