4P58A

Crystal structure of mouse comt bound to an inhibitor
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
212
structure length
205
Chain Sequence
TKEQRILRYVQQNAKPGDPQSVLEAIDTYCSEGDAKGQIMDAVIREYSPSLVLELGAYCGYSAVRMARLLQPGARLLTMEINPDYAAITQQMLNFAGLQDKVTILIGASQDLIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVIVPGTPDFLAYVRGSSSFECTHYSSYLEYMKVVDGLEKAIYQGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Catechol O-methyltransferase
publication title A fragment-based approach to identifying S-adenosyl-l-methionine -competitive inhibitors of catechol O-methyl transferase (COMT).
pubmed doi rcsb
source organism Mus musculus
total genus 71
structure length 205
sequence length 212
ec nomenclature ec 2.1.1.6: Catechol O-methyltransferase.
pdb deposition date 2014-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01596 Methyltransf_3 O-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4p58A00
3HCBA 4H0NA 3EVFA 2UYOA 5DSTA 1M0EA 2BM9A 1VLMA 1QANA 2PLWA 5GINE 5CIYA 3TRKA 4QQNA 2YVLA 2ZFUA 1JQDA 3PLAE 3EVEA 3IYLW 3C3PA 3CJTA 4LG1A 5HOQA 5LSAA 4OQDA 5M5BA 1VP3A 1WY7A 2P3LA 3HA7A 3R6TA 4RVFA 3UJCA 4EKIA 2YXDA 4RTJA 4YUVA 2C7RA 3ANXA 4FP9A 1FBNA 1Q0SA 3BWCA 1SUSA 2XBMA 1TW2A 2IP2A 3JWJA 1WZNA 2VDVE 4NECA 3T7TA 4DF3A 3BKWA 4XCXA 3FUVA 1L3IA 1X1BA 3DULA 3P9CA 1XCLA 5ICEA 1VE3A 3FRHA 4DMGA 1RI3A 2I6GA 3LCUA 3P9NA 3TR6A 8MHTA 2P7IA 3EGEA 2PT6A 4Y30A 1P91A 3HA5A 3MTIA 5CVVA 2VZ9A 5DTQA 2AOUA 4GOLD 4GEKA 4PYKA 5DXJA 5IKMA 2EG5A 4OA8A 5EMKA 1QAMA 3AXSA 4BLWA 3K0BA 5FA5A 3BXOA 2C7QA 5E9WA 5LQUA 4BP3A 4C04A 1VPTA 2B78A 3EVGA 5EMMA 2PT9A 2QY6A 2O07A 2KW5A 3E7PA 1QZZA 2PX5A 1EJ6A 3CGGA 5BW4A 5CD1A 3M4XA 1XJ5A 5LQCA 5GIOE 2ESRA 3ELYA 3HVIA 4GUAA 5EG5A 3UA4A 5GM2A 4X1OA 3G8BA 1D2GA 1I4WA 3C6MA 5GM1A 4DQ0A 3HCDA 5DRYA 2QRVB 4E2YA 1JTEA 3GRYA 3HCCA 4RVGA 1JG4A 1KYWA 4E32A 1OR8A 3AY0A 5F2NA 1G6Q1 2R3SA 3DLCA 4HGZA 4EVIA 4IV8A 1FP2A 5H02A 3A25A 3ORHA 3FPFA 4V0QA 3DTNA 4C08A 1U2ZA 2DPMA 1IY9A 1TW3A 2WA2A 3EVDA 3FPJA 1XVAA 1VP9A 1T43A 3B89A 4OA5A 2DULA 3OCJA 2P8JA 2NXJA 1N2XA 3EPPA 2AVDA 3CJQA 3DMHA 4ISCA 5C0OE 3EMDA 1XXLA 1ZQ9A 3BGDA 3NJRA 1JG2A 1EQAA 1P39A 2JHCA 2PV0A 1F3LA 5U4XA 2B2CA 3V8VA 2ZZNA 4P7GA 1WG8A 1JG3A 1XDZA 5GOZA 1JQEA 2JHPA 4GC5A 3E8SA 3FZGA 1KR5A 3SSNA 2AOVA 3KPWA 1NV9A 3LPMA 4PYIA 4FSDA 4XUDA 2UZ4A 3HNRA 1DCTA 5LQAA 3ER9A 2B25A 3G2OA 3R9XB 1FJXA 2ZIGA 1HNNA 3B3GA 1X1CA 3DXXA 4RVDA 3S68A 3VSEA 4KIGA 2AOTB 4PINA 1BC5A 4DKJA 3P9KA 2XYQA 5BW5A 2I9KA 3MCTA 3GRZA 1Y8CA 5EEHA 5EZSA 1NW5A 3EVZA 3GRRA 3PX2A 4HG2A 2Y1XA 1NT2A 4DA4A 3OZSA 3X0DA 1VL5A 3RODA 3BWBA 3GIWA 5EHGA 3KPYA 2AN5A 5K09A 3NVMB 2N47A 1R6AA 3GJYA 3OPNA 4AZWA 4UOEA 5E1OA 4JXJA 5K0NA 3P2KA 4OBXA 5JUWA 3OZTA 3O31A 3KQVA 5DLYA 2IDJA 1Z3CA 3KPUA 2UYCA 2ERCA 1RI4A 1R74A 9MHTA 3Q7EA 5E2AA 2VDWA 1ORIA 3HCFA 1NW8A 2AN3A 3G2QA 3OZRA 3P71T 2FK7A 3PTAA 2C7PA 5EIWA 1NKVA 2AN4A 1WS6A 3UFBA 4CTKA 3ELWA 2O06A 3FRIA 3GRUA 3P2EA 2PX8A 3P2IA 1UFKA 1XTPA 3HVHA 2V7EA 5T6BA 4POOA 4ER6A 3KQMA 4CKBA 2CKDA 1X1AA 2V74B 3BWMA 3E23A 3PT9A 3B3FA 1KP9A 3KR9A 4P7JA 5HIIA 4MHTA 3CJRA 1HMYA 5K03A 3BKXA 4PIMA 1JTFA 2NP6A 1M6EX 2AOUB 4BP1A 3GU3A 1ZHFA 1L3BA 2F8LA 5HZMA 2BH2A 3DMFA 5EVJA 5FHQA 1P1CA 1EIZA 3NDJA 3BUSA 2HMYB 4LWPA 4AUKA 3FPGA 3OFKA 1VBFA 3LCVB 4E2XA 1NW7A 3FYDA 2OBFA 4KVZA 4FGZA 3DUWA 2O57A 2R6ZA 3HCAA 1Q0TA 3UJ7A 2Q41A 4GF5A 3KQPA 3CCFA 3SSOA 4M36A 2A14A 2PX4A 1RJFA 3C3YA 3G89A 2G72A 4CTJA 2P41A 3I5UA 5E9JA 2AR0A 3GGDA 3DMGA 3T7SA 5K05A 5FULA 3ER8A 4A6EA 3BGIA 4HSGA 5ICCA 2P40A 4DM3A 2ZZMA 2PWPA 4IKPA 3CBGA 3R3HA 3G7UA 1R8XA 2NYUA 2ONZA 3KU1A 3GXOA 3HEMA 1EG2A 3LKZA 3GRVA 5FTWA 2BZGA 3UJ9A 4CKEA 2IH2A 1XDUA 1NV8A 4PGHA 5E8JA 2BR3A 2BR4A 4KIFA 5K0JA 4M37A 5F2OA 4DZRA 2IFTA 2YR0A 3LDGA 4RWZA 3SSMA 4RV9A 4ATNA 1YFLA 4BLVA 3M70A 5DX1A 4AZTA 4RTRA 1BOOA 5MHTA 2OPBA 3NDIA 4P7KA 4MQ4A 3DXZA 2QM3A 3EGIA 10MHA 4F85A 5D1NA 2ZVJA 2JH8A 2XYVA 2E5WA 2IDKA 2PY6A 3I9FA 1DUSA 3LL7A 3MAGA 5DM0A 1YFJA 3SX0A 5ERGB 1TPYA 2ZBPA 1UIRA 3O7WA 4A6DA 4EMSA 5K0CA 2IH5A 2Z6AA 3M33A 5DM2A 1JG1A 3TLJA 2FHPA 2ZSUA 5EQJB 3B7PA 3D2LA 4HTFA 4FT4A 5ICFA 4PGGA 2AVNA 2H11A 4FS8A 2FYTA 3A27A 3IEIA 3M6WA 2P35A 4XUEA 5DT2A 5T64A 1INLA 1FPQA 3NMUF 3KPJA 3MERA 4KWCA 4P7FA 5EOVA 3PFGA 1JSXA 3A7DA 4LECA 4E2ZA 2ZCJA 4HC4A 4C03A 5LQRA 3LKDA 2OB1A 5CVJA 5DTRA 4MWZA 2ZWVA 3MGGA 4RTQA 2ZTHA 4E2WA 5EGSA 4F84A 5KS2A 5E1MA 2VS1A 1XCJA 5LQNA 1O54A 2PKWA 5EKXA 4CWAA 4PYJA 2I62A 1KPGA 3BGVA 2IPXA 1F38A 3I53A 2GH1A 2P3QA 1QAOA 3M6UA 5K0LA 5BP7A 3HVKA 5DX0A 3G5TA 3LDFA 3SGLA 5FUBA 3TFWA 1KPIA 1AF7A 1NBHA 7MHTA 2ZIEA 3DLIA 3KQYA 4QPPA 3A26A 3UJ8A 1X1DA 3FUXA 3MB5A 1D2HA 3P9IA 1L9KA 3DXYA 4RVHA 4X61A 3ERCA 3AXTA 1EJ0A 4RTNA 4OX9Y 2AS0A 4O29A 3EVCA 2ZULA 1ZG3A 4KRGA 4PYNA 3JWGA 1NE2A 4YUWA 4RTKA 3OFJA 4M7RA 3OU6A 3KQQA 3RW9A 1IM8A 3UBTA 3TKAA 4PWYA 1MJFA 3B5IA 5EEGA 3LDUA 4AZVA 1VQ1A 2IIPA 2IGTA 3KR1A 5KVAA 2BR5A 1G60A 5GP1A 3EVBA 2GS9A 1KYZA 4HRAA 5DWQA 1WXXA 1V39A 2PXCA 3CVOA 3GWZA 5DM1A 5CVDA 2OB2A 3EMBA 4HH4A 1JQ3A 2P3OA 5E8RA 3I58A 5EMLA 2HNKA 5HFJA 3NTVA 1SQFA 2VDUE 5CUQA 4WVLA 3F4KA 2PXAA 3FTCA 4U7PB 4QVKA 2P7HA 4E70A 2YX1A 2YXEA 4PYOA 4ER5A 1X19A 1YZ3A 2JJQA 5K0GA 1ZGAA 3FPHA 3KQTA 4GOND 1KHHA 4C4AA 3FTFA 2OXTA 4PCAA 2O0LA 2CWWA 3TKYA 4YV0A 4FZVA 2P1DA 1I9GA 2ZW9A 3H2BA 4QTUB 5CM2Z 3VC1A 2G1PA 3NVKI 2IBTA 4PYLA 1SG9A 4R8SA 1NBIA 1SUIA 2GB4A 3VYWA 2PWYA 2I7CA 3PFHA 5FQNA 3TPZA 1YB2A 1PRYA 2H1RA 2FK8A 3SMQA 2JG3A 4MTLA 4R6WA 5K0FA 2HV9A 5E1DA 1JSZA 1O9GA 4ER3A 5EIFA 5HIKA 4CXMA 4OQEA 1QYRA 3V97A 2YTZA 3Q87B 2NXEA 2JH9A 4FT2A 3KPVA 5CVUA 2OZVA 5FCDA 2Y1WA 4RTOA 2PXXA 3HP7A 1BKYA 2H00A 3LECA 3TMAA 5DPMA 3DR5A 5CCBA 2GAFA 5BXYA 2EX4A 5EC8A 4C07A 1AQJA 3G2PA 4E30A 3UA3A 1RJDA 3G88A 3REOA 3KQSA 3A4TA 2XVAA 1RJGA 3LSTA 3GNLA 3FPEA 1N7IA 3K6RA 3OU7A 4RSRA 2G71A 5E2BA 4ER7A 4RTLA 3FTEA 5HILA 1G55A 3E05A 3O4FA 1KXZA 2O05A 2YXLA 1IXKA 1L1EA 1ORHA 1RI2A 5C1IA 4KDRA 5FQOA 5KQSA 4GBED 2NP7A 3PX3A 1AQIA 5F2KA 3SXJA 5DTMA 5FA8A 5KQRA 4QPNA 2PGXA 5EPEA 2ORED 3R24A 1I1NA 1NW3A 4CKCA 3NWBA 4FSXA 4X63A 5ICGA 2GPYA 3T7RA 3UJAA 4X60A 3TM4A 3ELUA 3UJDA 3HTXA 1RI1A 5CCXA 4K6MA 1QAQA 2OY0A 4RTPA 3UJBA 3ELDA 3MCZA 5DX8A 3M6XA 4PCLA 3TM5A 4YMGA 5LQJA 4RYLA 1G38A 1WXWA 5E9QA 4GOOD 3KQWA 2LD4A 4AX8A 4OBWA 2UYHA 1N7JA 3QOXA 5DSXA 4AZSA 4YUXA 1R8YA 2B3TA 4F86A 2PSSA 2IBSA 2OKCA 3ME5A 3KQOA 2FPOA 3U81A 4QTTB 2UYQA 1SKMA 4FR0A 2G8NA 3FUWA 4YV1A 1VIDA 3DP7A 1ZKDA 3QOWA 3BWYA 2EFJA 1M6YA 2BM8A 4Y2HA 4PNEA 5GIPE 4KW7A 5DXAA 1AV6A 2ADMA 2EJUA 2ONYA 2AOWA 3IHTA 3CC8A 4YUYA 3UWPA 3ID6C 2NXNA 3L8DA 2B9EA 3BZBA 2HTEA 3PVCA 5D1HA 5FHRA 4L7VA 2K4MA 3LBYA 3LCCA 5KYGA 4MIKA 5K0BA 4YMHA 4GOMD 5HIJA 3VC2A 2ZZKA 3IV6A 4GC9A 1G8SA 2QYOA 5EMJA 5C9ZA 2GLUA 2IH4A 3AWIA 2FCAA 3T0IA 3KKZA 4BLUA 2PVCA 2PBFA 5LQKA 4RX1A 5K0EA 3AJDA 1O9HA 4QDJA 4DCMA 1JR4A 1B42A 2ZBRA 3KHKA 4QDKA 3P8ZA 4EQZA 4DCGA 4ZTBA 2XVMA 3BT7A 5FWAA 4YV2A 1SQGA 1NW6A 3GCZA 2JHAA 4KDCA 2HWKA 2WA1A 3TOSA 1ZGJA 3DOUA 2OO3A 2CL5A 1YZHA 2QE6A 3OU2A 1FP1D 2ZLBA 1DL5A 3HA3A 5HEKA 3LBFA 3NW9A 4BY9E 3MTEA 3R0QA 4R05A 3TQSA 1RI5A 1YUBA 2QRVA 3C0KA 4IV0A 4QQKA 3HM2A 3THSA 3G8AA 3EEOA 3LGAA 1EAMA 3SM3A 4M38A 1R18A 3MHTA 4R8RA 5P8WA 2CMHA 4U7TB 3UJ6A 3SR4A 4XUCA 3THRA 3FTDA 2AOXA 4PYMA 3PB3A 5JR3A 4C06A 3FUTA 2HR1A 2Z6QA 3KR2A 3JWIA 2YQZA 5EZQA 1BHJA 3LHDA 5HIMA 3UZUA 2Z6UA 1R00A 3LX6A 5B1SA 5DM4A 2NNWB 3G2MA 2NXCA 2VP3A 4QVGA 4C05A 4LWOA 4R6XA 2ZIFA 5G02A 1MHTA 1D2CA 5CVEA 4PIPA 3GO4A 2ZWAA 3B3JA 3JWHA 3KR0A 4PONA 5DRTA 4E31A 4ER0A 5GWXA 4GQBA 1SVUA 3CKKA 3G5LA 1H1DA 3GDHA 4EKGA 1RJEA 2YUIA 4RTSA 5EHIA 2PJDA 5IH3A 1PJZA 3C6KA 4IWNA 1UWVA 3EGVA 3M6VA 2PX2A 3FUUA 3WSTA 4E33A 5EKUA 3OE5A 5T67A 3QV2A 2EJTA 3RIEA 4HGYA 5K8VA 3NWEA 4PYQA 3FYCA 2AOTA 3P97A 3SVZA 2AZTA 3MQ2A 5E1BA 2CMGA 4P58A 1KIAA 2C7OA 1XDSA 2FRXA 3DH0A 5FADA 5FWDA 2WK1A 2GA9A 4X41A 3I64A 2OYRA 4Z2YA 2G70A 1YF3A 3EEYA 4V0RA 4RTMA 3A7EA 4HTFB 1KPHA 3EVAA 3PS9A 1G8AA 4EK9A 4WXHA 5LR6A 3HCEA 4YUZA 5K01A 2XYRA 3HVJA 3OE4A 1L3CA 1P1BA 4B17A 2ZBQA 4G56A
chains in the Genus database with same CATH superfamily
1C2TA 2O8EB 4Q15A 3DNMA 2VCEA 3O8OB 3QFSA 2D1FA 5DSTA 3WZ2A 2HF9A 4TXHA 3JQAA 3KE8A 3NB0A 4P0PB 2A9OA 3QJYA 4YAUA 1VPWA 3PLAE 4DYVA 4EO4A 4OHWA 4UHBA 1KSHA 3AFHA 5KYYB 5LSAA 5BSMA 1ULUA 3PDUA 3SC3A 4KE7A 1X1RA 3DVAB 1XG5A 4UC0A 4RTJA 4DR3B 3LWDA 5EZ5A 4BUCA 4QXMA 4JLSA 3A9SA 2XBMA 2O0KA 3KUDA 5JARA 3EZLA 4HFMA 3EQ6A 4IEEA 1OXMA 1I6MA 2CSXA 2PLNA 4ZOLF 3DCNA 1B76A 5B6IA 2DH6A 5AP9A 3OUTA 1KI7A 1C9KA 2I6GA 3DZHA 4RKEA 4MYDA 2GBLA 1RRGA 4UUNA 4HWKA 3V2GA 4ZVOA 3VX3A 3LLMA 3O9MA 4A15A 4F4CA 2BEUA 3AXSA 3K0BA 3A1FA 1DTWB 4POAA 4RZHA 1M6VA 2ISSD 3MT0A 3HU3A 1HORA 2AMYA 3K0FB 3N70A 5LQUA 2HM7A 1ENZA 3L8CA 2FEOA 2FFAA 1JKIA 1AKMA 2F1IA 3WRWA 1EXMA 4CBVA 6REQB 4DLYA 1TF7A 1UMBB 3B8EA 4RK4A 5DYYA 5IF3A 1O94D 4UJ5A 4RPIA 5F52A 1YS7A 4XA8A 3QX8A 1JDNA 4EHKA 2ZRBA 3CRQA 2H2HA 4HDRB 4HYTA 2HSZA 2Q4BA 3V33A 3UQZA 2Z56A 1J9GA 4HGZA 4R2XA 1QNLA 1OFTA 2QXUA 3OJ0A 3AK4A 2J4CA 3H16A 2GASA 1QRDA 5DT9A 4EB3A 3ZX5A 5U9CA 3PUWA 3PC8A 2PNJA 3X3HA 4RD4A 1DIGA 2I71A 3IKJA 2GA8A 3T99A 4IJ5A 1HO3A 3NBQA 3H1EA 2CZGA 3G02A 4RPLA 3SEQA 3TKLA 1N2XA 1UJ5A 4KGZA 1YT5A 4Q00A 2WIDA 2FR1A 2ZBEA 3IAM6 2EEPA 1RZVA 1YJXA 2PVPA 2R00C 3EQ8A 3K6SA 3M81A 2GM4A 2QVYX 1GP2A 3RUDA 4ZEMA 1IHYA 4TSFD 3S2GA 2UZ3A 1JXOA 4I4CA 2V9PA 1NBWB 3FZGA 4DY6A 2Q5CA 4FFLA 3KPWA 1NV9A 4J4TA 2I1VB 4KLNA 1MOSA 1Y9AA 3HNRA 4FHFA 3PEEA 3N6VA 4ZCPA 1X1CA 3KXKA 3S68A 1HZZC 1V47A 2JD0A 4LF7B 2YVUA 1PJQA 1DP4A 2BY4A 2VPPA 3ORYA 1FX0B 4DKJA 3K4PA 4EABA 4TYWA 3ROMA 3RASA 1EQ2A 3ZXIA 1OASA 3HXPA 3OA2A 1KE1A 5LYJB 3KQLA 3QLEA 1U63A 2YYYA 3KX2A 3MTJA 3PX2A 3L6UA 4NG5A 1NT2A 1XMVA 2ZI3A 4RU1A 3BD9A 3EIXA 5H3LA 4KGDA 4L7QA 4BO9A 2WFLB 4E88A 2CNWA 1L8QA 1KO5A 2A94A 1G5HA 4R84A 1R6AA 2HUPA 3GJYA 4AAYA 1IZZA 2C04A 1AKNA 3PIDA 4JXJA 5AI4A 1O95A 1YAHA 4OBXA 1QG6A 3AVQA 4UM7A 1AT1A 3H4TA 2CXOA 2L2QA 4R2HA 4R2WA 2DPHA 2X0DA 3TL2A 1Y5RA 2JJ1A 3L7JA 4G1CA 4OF4A 1YVPA 4ZDKA 1VKHA 5EIEA 5KYKA 3ZXYA 3WYGA 4OPMA 1LV7A 3JQ9C 3LVRE 5FO1A 3DPUA 5JDCC 1JJIA 4YWHA 3NC4A 3OJEA 4X1KA 1MQ9A 4PW0A 4IIVA 4CR7A 5CB6A 4ID3A 4B31A 1QUFA 2NT4A 1DELA 4KQMA 1PFVA 3QLVC 2GX6A 3PT9A 4RVHA 4CLHA 4NBLA 1HMYA 1VSVA 2EVWX 2HQSA 2B94A 2NW6A 2WHPB 3AF3A 3NT4A 2EP5A 4NE2A 4YXWA 3S3TA 4EA7A 3EPRA 1XEXB 1XKQA 4IJUA 1BA2A 1ZIOA 3JATB 4K3UA 4OFXA 4QARA 5IK2A 1XFDA 3MBIA 5A62A 2WF6A 3DO5A 3THXB 3QV1A 4R4JA 4AJJA 1VBFA 3L43A 3I1FA 4DE5A 2ZXEA 3ZCTA 2AFIB 2E55A 3JS5A 4KXXA 3MMSA 4QNNA 3M6IA 3UYKA 5JTUA 5TIIA 4G89A 2FPWA 3CCFA 4KKVA 4X71A 3C6BA 4MS3B 1NVVR 1YU6A 3AUAA 1DS6A 1DX4A 3H1AA 5CNKA 3ZDYB 5CG2A 4PQFA 5JQWA 3ZVMA 4LYEA 3QU5A 5ALUA 3QVUA 2P41A 4X93A 4D92A 3PITA 2ZPAA 1WHSA 2P40A 3QK7A 1B14A 1FXUA 5IDXA 4GM1A 4QYSA 3CEJA 2NZJA 1CSEE 4WBXC 4I9FA 5FV4A 3K15A 2XE4A 5AXBA 3RUAA 1NV8A 4ZVTA 1CQZA 2HDWA 1U3DA 5D87A 4KZKA 3M70A 4KN5A 1FFAA 3EXHB 3WLMA 4GPTA 4X92A 4BMPB 1E61A 1PLJA 1T1GA 4EFKA 2JGDA 3CWCA 3RTBA 2W42A 5DM0A 3ZWOA 4RQTA 3PEUA 1OLSA 4KRXA 3UW1A 3U62A 4WESA 2ZBPA 1DAOA 3Q9NA 3THYA 3GCGA 4JLVA 4DPMA 2YQ5A 3EF3A 2IYUA 4TV9B 1BDIA 1BCRA 4AY5A 4WFQA 2ZAYA 4HTFA 4OG2A 2VUSA 2WU3A 4ZMRA 5FNVA 1BXGA 1SHLA 3TIVA 4UFPA 4J6EA 3GMTA 2QUZA 3LYLA 3V2IA 5EE3A 5SY9A 1Z88A 5HZGA 2O7NA 5EOVA 1EGQA 1FYWA 2HK6A 3HL4A 3PFGA 1MZVA 4LECA 1NG1A 3B1XA 3H65A 3Q0IA 4LYJA 3ZIAD 4CMGA 4ESVA 1G3MA 1VJCA 3ANTA 4FINA 1B0UA 4UQOA 3SG0A 3TL6A 4CNQA 2CBZA 3F3YA 4AC9A 3B7WA 5KS2A 4HLCA 2PG3A 3RVKA 4J1TA 3OZEA 3LIPA 3T1NA 1L5FA 4OXNA 1MD9A 3FMPB 3E22B 1F38A 5DH9A 1V8ZA 3BQ9A 1QAOA 3M6UA 3O2SB 4MQLA 3UPTA 2JGJA 3AW8A 1GQOA 4PLPA 5FUMA 2FSUA 3CLTC 3TFWA 1KEPA 1YQTA 3ZLJA 2DBVO 4B3RB 3QKWA 4AURA 4QUDA 2BELA 4ZAZA 4GQIA 1GJRA 4MUBA 1VPEA 1LNQA 1T1RA 4DJJA 4L5AA 1UKCA 3MUOA 5D3KA 2F3PA 3F96A 3ZWMA 1BDJA 3AVOA 3DQQA 1LF5A 2E3JA 4KIUA 4L9RA 4PYNA 4NZNA 5SYMA 4M7RA 3RIHA 3WSVA 1ZEMA 2JA1A 1WNFA 1X7YA 2PRIA 4CKWA 3UK0A 2FX3A 2IYLD 4M9CA 4UBMA 2GILA 3TKAA 3T34A 5BWCA 3QVSA 3PGKA 3ZHCA 1VQ1A 1BH2A 1J42A 4Y1GA 4Z4QA 3S2ZA 1UT8A 4FZRA 3VR4A 1SBNE 1T4CB 2SCUA 4F1JA 4XAQA 2DSNA 4LOLA 3ZWYA 2IV2X 1SCAA 5IVKA 1OWPA 1LU9A 4R1UA 3WLLA 3OQBA 4G5GA 4NCJA 3ZGVA 4F3TA 4U7HA 3F4KA 3WLAA 1AE1A 3H11A 3HH8A 1H0KA 4RZIA 2YX1A 4N7BA 1CNMA 3NDPA 1KGDA 3NANA 3WRXA 4GOND 1F6DA 1G8GA 5E7MA 3K71B 3W6PA 1NLFA 5EQTA 3IX7A 4C4AA 3GEHA 1MEJA 3HYCA 4DCGA 3P2OA 5BN4A 3RYCA 2IX3A 3BSFA 3KIPA 3N1UA 4TROA 3ZGYA 2FSVA 2XCTB 1UM9B 1MVLA 2GB4A 3DMPA 2CKMA 2A7QA 3DKKA 3TMYA 4DMKA 2WQ7A 3LY7A 1PFGA 1YJQA 2ECKA 4TGLA 4TRMA 2W4IA 2FEMA 1UODA 4MTLA 4R6WA 2FZWA 3PPWA 2FPUA 3BG5A 3MFQA 3R41A 1ONNA 2Y76A 1JFVA 3Q15C 4PO1A 4IR7A 4MW1A 4QAJA 1QYRA 2GWHA 1X77A 3QXCA 3CPHA 3EDRA 3I52A 3KAJA 4JP1A 2LCQA 4D4KA 3ICEA 2IXGA 1GQFA 5AK0A 2VEDA 3K9BA 2VZ0A 3ETDA 1GZ4A 3TSZA 2GAAA 2QN3A 3RVJA 1IWPB 5EP1A 3IJRA 3O73A 8ABPA 3FZQA 1EEHA 2C9ZA 3MWGA 4U0JA 3W2HA 2N42A 1MO4A 4RY9A 2PDAA 2CYAA 4TRJA 1Q84A 3COYA 1VKOA 4AUNA 1KAEA 1UOQA 1AMOA 2AC2A 2EX1A 2O5CA 3FMVA 2X7JA 2KYRA 2NTEA 1CPYA 1P2TA 1WO8A 1QYCA 2R7KA 1JKFA 2P91A 3BIWA 4ZAXA 4BGVA 4HAVA 2O8CB 4M8KA 2GPAA 2V0NA 1Y3FE 4E4RA 1L1EA 2FRDA 2QF7A 1MA3A 3H5VA 1OZHA 4YJHB 5EXEA 4I1VA 2HCRA 3NAGA 4YUAA 1NFRA 1D1QA 2FI1A 1V6CA 2XGOA 4NI5A 3HCRA 5IN5A 2NV0A 3CZ9A 3D7KA 3RVRA 2SECE 1ZVMA 5I9MA 5EPEA 1WQ1R 3CO5A 4AJ9A 2R86A 5EVCA 1K08A 3T7RA 1G6HA 3UH1A 4LOKA 4WFJA 4EG0A 2MINA 3IOEA 1WD7A 2X3YA 2A5YB 3ZW7A 3HTXA 4D98A 3JQFC 1D4FA 3U44B 1KDOA 1KMIY 2HSDA 3W8RA 1W47A 1VRWA 1LFAA 1O6CA 3NATA 3O3CA 4MRMB 1JFFB 4PCLA 5LQJA 4B4KA 2B8JA 1A9XB 4GOOD 4C89A 4L0QA 3RVQA 1F14A 4Z9FA 1WUJS 1YS2X 3UUFA 4M0UA 3PGXA 5REQB 4B43A 3H2KA 4J76A 2AE1A 3JAKA 5K6AA 3DB2A 1UINA 4KE6A 1U9ZA 3SAJA 1MDFA 3TNDA 3D43A 3QUCA 2VK4A 1IZ7A 4HZUA 4KJZA 4R5MA 2VTKA 3GLHB 1LEHA 3LGXA 3ZNQA 4BB5A 3W9UA 1VJ5A 3FI9A 4B4UA 1JIIA 1PP4A 4LE2A 4LVCA 1Z0SA 2VPIA 4HNAB 1U9YA 1OCEA 4ZANA 1WP4A 1AZLA 3LUKA 2VP6A 1P7YA 4WFIA 1RCFA 3T9BA 5GIPE 4AN1A 1C0LA 1DBSA 3GF4A 2Q4DA 2MSDB 1WW3A 2IIVA 3FB4A 2Z1DA 4I50A 4LQDA 4LQLA 1UT6A 1OX5A 1ONBA 4HRXA 5AVVA 2O7VA 3KHUA 3DT8A 5HQ3B 3I76A 1YR2A 4I4IA 1KMHB 2XUOA 5HFNA 1H2XA 1NC3A 2K4MA 4ANFA 3ITKA 3WHKA 3WKDA 1A04A 3HE3A 5BMVA 2R2GA 3HY3A 1G8SA 2WWRA 1HV8A 1KY2A 1UQRA 3SDBA 3P4UA 1JP7A 1JR3D 4OSPA 5TJ9A 5IHXA 3FN4A 4XQGA 1O9HA 4M88A 4FPXA 1P3JA 2SICE 3I42A 3BGOS 3QA9A 1BMTA 4FMDF 3IIIA 5F3DA 2F3TA 3L0SA 3JYLA 3NJ8A 2W6OA 3JSXA 4EEKA 3VKGA 1ZZEA 3UM9A 2I4OA 1FBTA 2PZJA 4W9MC 2FUKA 3H1FA 3BXGA 5HEKA 4L4ZA 2DHQA 2C4MA 1HI9A 1KEEB 4O2BA 2V55B 3GLFE 2KE5A 3PTZA 2FAXA 1RI5A 1Y6ZA 3SM9A 3OIDA 4EPTA 4G1FA 4BNDB 4WCVA 1VRCA 3IA7A 4KUHA 4PFQA 3OZIA 3P0EA 3S8EA 1JHXA 1JR2A 3QXXA 4DJTA 3UBMA 4G36A 2RAFA 1X8LA 1U0GA 2GM3A 1D04A 1J2UA 1GG8A 2AZDA 2D5IA 1P2UA 4K9OA 4LXIA 4OATA 4E6PA 1G7TA 5T4BA 5A4DA 5LM3A 2FMKA 3EX7C 4LKRA 3ZJYA 4WX2B 3O3MB 5FAKA 5HBGA 3LX6A 3DZJA 3WIOA 5KNLA 4IMRA 4K2AA 2OORC 1OFUX 1G20E 5G02A 4M1QA 4R1MA 4ON9A 1AUQA 2XT0A 4GKAA 3REGA 5DRTA 3UANA 3ACBA 3C45A 5CGZA 4O4JF 1O0CA 3PQ3A 2H3HA 4CLOB 3OE1A 1YS1X 5LMZA 3RVBA 4EKGA 1HNZB 3ZWWA 5BOVA 2X8LA 3QHAA 2Q1XA 5FPYA 2IYYA 1I30A 4Y2QA 3E0QA 1AQYA 3C2QA 4BN0A 3QF4A 2EJTA 2GCIA 3DEKA 2AYZA 1VGRA 1W4RA 4JFRA 4XB1A 2A6PA 2GJ9A 3JR7A 3BF7A 3T7KA 3ZV7A 4LZLA 3P27A 3UJNA 3QVOA 1N3BA 2GAOA 5LB2A 5E1BA 1N6PA 1ZK4A 4LXXA 3DH0A 4YJDA 4AMBA 4ZQEA 2FJUA 3SCZA 4UAVA 1P31A 3NYRA 3M5PA 3IILA 1FDOA 3LUCA 1FYVA 3ONFA 4HJXA 4KE9A 2N0SA 5C81A 4KXWA 3DWEX 5IN4A 4LJAA 1IJFA 1J56A 2WZCA 3NBYC 3MT7A 3N9IA 3OOYA 5A6SB 3RQSA 4DDMA 3L0CA 4YRCA 1JHVA 2Q1WA 4EDFA 2DX7A 2VAXA 3DVSX 2QMQA 1M54A 1TA9A 1ZIDA 5GZ1A 3VR3D 3EXIB 2RI1A 5AMXA 3IMKA 4JAVC 4YH1A 4H4CA 2G17A 2QNRA 3FGPA 3MWYW 4WAUA 2ECQA 2OZLB 3O95A 5HSGA 1JEQA 2QRLA 2I33A 5JH7A 3TLBA 3C1OA 4QUEA 1H4VB 2FPPA 3ANXA 3O4GA 2HUNA 3BWCA 4S24A 3DLTA 3JWJA 3AR7A 1J99A 1VL1A 4Y6OA 3IIMA 3DFKA 3I1IA 1GXSA 3AF0A 2GDZA 3WB2A 3SHOA 4E15A 3KWJA 3W9BA 3C5HA 2VXCA 3CKMA 3JAWB 3LCUA 3QWFA 1J23A 4U2GA 3DAHA 1THGA 6LDHA 1SHTX 2G1JA 3ZHBA 2AOUA 1NJ2A 1EFVB 2HA5A 1HOTA 2F9FA 2OUKA 3BIOA 1Y8QB 4HZIA 5AKYA 3N8KA 1A9RA 4N0DA 5EMKA 1E89A 3L01A 1B6RA 3A1DA 3BXOA 1D8TA 5WRFA 2NXWA 1Q1EA 1R6VA 4EGCB 1SVKA 5BURA 1XJ5A 4X7BA 3O82A 4C2AA 2FZ4A 2J9YB 2D6FA 4F1WA 1XQYA 1Y5LA 2RH9B 4ID9A 5FUXA 4BNNA 1V8PA 1H2BA 4XDYA 3C6MA 4LFBB 1EX1A 5ADHA 3HCDA 3IO5A 1QKIA 2IY9A 1JTEA 1ZJ6A 4E2YA 1YMVA 3WLOA 2C2OA 2HRCA 2OCLA 2ZR8A 5F2NA 1JHYA 1BCSB 2C5GA 1THMA 3E9NA 1YTUA 4PNZA 2BF7A 1CDZA 3A25A 5IJZA 3ORHA 4RK6A 3DA8A 3FPFA 3EQ9A 1ZM9A 4V0QA 1C80A 2GUWA 3C4VA 3HMKA 4WINA 4A6PA 4GWLA 4NXNB 2W8BA 3TW8B 3RHSA 1YD7A 1HLDA 1T43A 2H1IA 3G23A 3HRKA 5F64A 2B0CA 2ENWA 3ZTYA 4B6QA 5HHTA 4UVGA 2IEZA 4ZYZA 3SQXA 1LBQA 1MB2A 4M0PA 3LU1A 4OHBA 5KOJA 2XUKA 4KXYA 1XXLA 2P6NA 1TVKB 5DMHA 4DV7B 4EENA 3H5WA 4H7EA 4J29A 2QGZA 1W93A 1J2JA 1Q74A 4NKRA 5D5PA 5GOZA 5IXJA 2F3RA 5JNLA 3V7FA 1B8PA 3B6IA 3ESDA 3O94A 1SCBA 2AOVA 3H05A 3GFQA 3MD9A 3MWKA 4FDTA 2W2PA 5G1PA 2BZ1A 4FLEA 3ZHQA 1HNNA 3GP8A 4BRWA 1QU3A 3DXXA 2FP4B 4D46A 1GT6A 1FU7A 1Q91A 3BN3A 4R01A 2GERA 2JAOA 3PUKA 3PA8A 1OZGA 3TBHA 1GL6A 1C8BA 1RM4A 4HXFB 4D45A 4F5DA 7GPBA 3D8TA 1VPVA 2C2XA 1X3LA 2IYOA 2ROQA 1U31A 3IDSA 5DLPA 3U39A 5GJWC 4I8XA 1J8FA 4ND8A 3GP5A 3TMKA 1XCGB 1ENPA 4Y6PA 5JISA 2IEBA 1IOLA 1II0A 1Q7TA 3UHPA 2CYBA 3VYSB 5HP4A 2RHDA 1ZSNA 3I8XA 3LYAA 2P2GA 5TEWA 1XZPA 3EXHC 4JQCA 5JSZB 2VA8A 3FMOB 5DN6A 5AVQA 1QVAA 3WBFA 4EFNA 4UU0A 4ZJPA 4M54A 4PV7A 1C30A 2BF4A 3UFXB 4DA9A 3H6HA 4PX2A 5EIBC 4CMAA 3X44A 4AD8A 2ZYVX 4HNGA 4HQOA 1ITZA 4UUQA 1FFDA 5IKXA 3P71T 2P9BA 2TRSB 1T9ZA 1AO3A 5ED4A 4OP1A 2D0DA 2D7JA 4BKOA 3PEFA 4V0NA 2FZGA 3DDHA 3QVGA 1KJJA 1LCIA 1RXIA 2E4AA 2WSSD 2JFZA 2EJBA 2JGFA 2ZSKA 4CI0B 4BUJA 3HB0A 2VTVA 2CJWB 3KQMA 4G24A 1NVMB 2YYSA 4E21A 4R1OA 1ZR4A 2XUAA 3F6PA 3NGXA 2VFAA 2II6A 4IDQA 1XLUA 5JSYA 3UT5B 4LAFA 2VPWA 3OCYA 2M6LA 1BGWA 5HZMA 5FEUA 1CG6A 1M83A 3PQ2A 5BNWA 4XWYA 4EHIA 1AK9A 4EHBA 2H65A 4XIYA 2X15A 2QN1A 4PYRA 2ZUCA 1KDYA 4Z4HA 1QHEA 2ZSIA 1RPAA 1V95A 3QX7A 4V0OA 2R751 2A14A 1P8JA 3WMEA 3ZHRA 2DHCA 2VBFA 2XB4A 2CDAA 2EHDA 3C8DA 3KZVA 3L7DA 4LXGA 4BRUA 2CLLB 4EI9A 2I3ZA 2GBPA 2PN1A 3DV0A 4B71A 1DO8A 4WZAE 2Q2QA 3ZK9A 2YDXA 4WPGA 5FPKA 1JFTA 3SNHA 2PE5A 1WHTA 3HEMA 2VKTA 1EFRD 3NBMA 2FSGA 1EK2A 1RLIA 2A8YA 2QM8A 4MV7A 5FEMA 4DDTA 5BN5B 2H0QA 4JKOA 1HDRA 3FROA 4GPEA 3MWEB 3LT5A 4NHEA 1RMQA 3TTYA 1RLMA 2EF0A 4RWZA 4CDMA 2QAIA 3AFGA 5CTAA 2FZVA 1OXUA 3LBHA 3U7QA 4FFOA 1NZDA 3CT4A 3AVPA 2VF4X 3KL2A 1Z13A 3L0ZA 5CNMA 1G5PA 2WHEA 2XYVA 4LK2A 3MAGA 2ZT8A 3T5PA 2V4UA 1AK1A 4B3MB 1XN4A 3GLIA 2BP7A 2CMDA 4MB0A 4URWR 5FI3A 3RVNA 4WBNA 5ALQA 3D7MA 2YJNA 3OPYB 4O4IB 2H1WA 3A31A 3FOCA 3OTHA 4PGGA 5AVWA 2VNAA 2FLWA 4FS8A 5JYEA 4CCAA 2WKQA 4D99A 3CPJB 4XUEA 3IEIA 3HKBB 3M6WA 1JJAA 1Q0UA 4JIGA 4DIFA 3FE2A 3NHMA 2N75A 1K0FA 1V45E 2F9LA 2A5GA 2EBUA 4H1HA 1Q11A 5KWSA 2DVMA 1NR7A 4GXTA 2FFRA 3HB5X 1J5EB 1V7ZA 3L8GA 4YT8A 3H75A 2BBOA 4P3OA 3IVRA 4KQHA 4HYEA 4LF8B 4BKUA 1NIPA 1U2GA 4MWZA 5JS6A 4OX9B 2PD4A 5JOQA 1T91A 1WETA 3F3KA 2VHCA 5KX5A 1WSWA 1E4EA 4QA9A 1KOGA 5GVSA 3BGVA 2HAEA 1NJFA 4YTEA 5AKKA 3RBVA 1QO0A 2IWRA 1SBTA 3AP2A 2QP9X 4BL5A 4EY3A 5KBYA 2BD0A 1SBQA 1SC6A 1UWLA 4Q9IA 2YIDA 1S0UA 3BREA 3WGLA 1R1DA 3JQRA 1G21A 4LRTB 4LY0A 2DWUA 1VSUA 3ROGA 5KZMB 2NQ2C 2WVGA 4F2DA 5AI9A 221PA 3BMOB 3CX4A 5HMMA 4NJEA 3OIWA 4W5HA 2XUDA 2FW9A 2O2ZA 1FU8A 2QDKA 4M7WA 1E63A 5HKAA 2RGGA 1U0NA 4V39A 1XZCA 5DYGA 4ZAYA 4IXTA 5DHFA 4MWTA 1QTQA 1KF0A 5GP1A 4HVLA 3IHLA 3OFSA 3U09A 1P18A 1GGKA 2QJWA 2CB9A 2C8KA 4MHOA 4DCVA 3OI7A 1MTOA 2JHGA 3EUWA 2IHJA 1JQ3A 4ZZIA 3CT6A 3I58A 3FJYA 3HGMA 1R5OA 3MC1A 4XYMA 3NTVA 5T4HA 5C5DA 5CUQA 3AEQB 3RYFA 4FZ5A 1Z62A 4MQBA 3COJA 1OX4B 1NYTA 2QVXX 1XVLA 1WZIA 3JSAA 4TVSA 3L41A 4BNVA 3G9TA 4WA7A 4EAAA 1IZYA 3CWQA 4GMFA 1KHHA 3ZU4A 3JQAB 3KZXA 4PCAA 1KO7A 2CWWA 3LNTA 2C31A 3NJ4A 2GF9A 4IHAA 2P1DA 2X5XA 4LC0A 4PSAA 4RJ2A 5AJYA 1M74A 2DHEA 3WDKA 4EITA 5ILOA 1QQ5A 3Q1LA 4WSOA 1XROA 2EKLA 2P30A 3IP8A 3LH5A 4R8SA 5F7ZA 3T8YA 3ZJ4A 1Y81A 1XLWA 1ZESA 2GT1A 5A2QA 1XQ9A 4PHGA 2P5UA 2JFQA 2R8EA 1Q1QA 4P33A 2BMAA 2Z3VA 4EX6A 1CEQA 1YZNA 2B36A 1RWVA 3EUAA 5E1DA 3JQ8B 4I7EA 4UVDA 2GK4A 1NURA 2F90A 2QNIA 1YR9A 1Z08A 1E2PA 5CJ2A 3DDNA 1ESDA 2HEIA 1PSWA 1SXJD 2NU7A 2RONA 3MJHA 4JJAA 1E3JA 4XEUA 1GTRA 1L4UA 1CEYA 1ISFA 4PHFA 3O8NA 1T8PA 3AWDA 4BDSA 5ADUS 2V58A 5CK5A 1YFZA 5CVUA 5EYPB 4BASA 4CLXA 2O5EA 5CD9A 2PXXA 3HP7A 3DHVA 4BCBA 4ZOBA 3MTBA 1R8JA 4JSRA 4YRAA 3W9SA 4CM8A 2C5BA 1M6VB 4NABA 4JGIA 5EJFA 1HLPA 4BX0A 5I8ZA 5EC8A 4Q4AA 1AQJA 4J75A 4EMUA 1H9BA 2G40A 4KG7A 2ILTA 5K3EA 1Y6FA 3W6OA 4TKVA 3MQFA 1KI6B 2VHEA 3MN1A 3REOA 3AKZA 4NJMA 1DBRA 4F4HA 2ON6A 3CG4A 4Y9DA 4B3CA 4DFDA 1YL6A 5DGIA 5C7OO 1LQUA 4FDLA 4CL3A 2WP8J 3T52A 4W5TA 4F2PA 2CXXA 1GRNA 2ZIUB 1UKAA 4GBED 4R41A 4CEJA 3HBLA 4N49A 4KI7A 1NN5A 1F60A 2JKYA 1BOFA 1PEAA 1VYHA 4JLOA 2JLZA 3D8UA 3A9CA 1ICEA 3F7NA 3WLNA 4Q4DA 1QRSA 3L4BA 4E11A 1QVRA 4IRXA 2W0MA 3W3AA 3LUPA 1Z28A 2I8AA 4H35A 1L6IA 4M1SA 3UJAA 1UFQA 1KI2A 1L5VA 4X60A 4D9KA 2FPLA 3K2IA 5IDWA 5AJXA 1XNJA 5FTMA 4CODB 5C8VA 3NBAA 3OBIA 3GPLA 1I13A 2J33A 1CETA 1NBMA 2QU8A 4BVGA 4D80A 2TSYB 1TPZA 4E09A 3KQWA 1DAHA 4GLBA 5EJ7A 1KS2A 3FNBA 3KLOA 4TKUB 5J63A 3UV7A 4BDTA 5AVSA 2UYHA 4BFUA 3A6EA 2EJWA 2H07A 4P3PA 5L7YA 5BUSA 4I3GA 2FPOA 2QWXA 2P77A 3HZZA 3I04A 2A58A 4K9PA 2DB3A 1XLVA 2EYUA 4NFSA 1KAGA 1CDDA 4E4TA 3PGJA 4LCEA 1NHGA 5AW5A 2Q0QA 4GP7A 5H3CA 1UH5A 5JAZA 1W36B 3M8KA 4DQKA 4IIEA 3E1KA 5CEJA 1E9SA 3USZA 1NONA 1GDTA 2Q3FA 3CC8A 4WZBB 3QUTA 2C0PA 2ZPUA 3UAOA 4O3MA 2B2NA 4S1OA 2AMJA 3FM9A 3K73O 2HTEA 3KYJB 5G3ZA 4H16A 2H5LA 4EATA 1PL0A 1GNPA 1CZOA 2I4MA 5E4FA 5T4EA 3VBCA 1IXRC 2I99A 1S2DA 2AW3A 2DFNA 2NZUG 3BL8A 4YR7A 3EPHA 4ND6A 1FY2A 4ZVKA 1JTVA 1Z2DA 1E32A 4RK5A 5BOSA 2EARA 4UQLA 1Z6GA 1NMXA 4IVNA 1B42A 1HTWA 1SKUA 2VLBA 2YOHA 1YQUA 5ADWA 2L17A 2XUFA 4EDHA 3BT7A 1AXRA 5KU1A 5JS1A 4A5OA 4M98A 3HUUA 2HWKA 2P90A 1QRRA 1RXUA 1GAQA 1P0MA 3BK1A 1R8QA 2B1RA 4UARA 1HR0B 5HCNA 5EJ5A 5IJAA 4F72A 4DJAA 3DOUA 4X1KB 3PFNA 1YDFA 4RHUA 4LDAA 3UV6A 1Y1KE 1G6OA 2OP1A 3X2EA 4QBIA 3B53X 3E82A 2ACVA 2IYRA 3I62A 1SM4A 4MKFA 1Q2XA 1T1IA 2RI6A 3L5KA 1RXEA 1FYEA 1P9LA 3F6RA 2EKPA 4GBJA 5KMGA 4BMYA 1V4BA 1SKYB 2CMHA 4XSVA 4MB2A 3VKUA 5EE9A 4A0QA 5ALSA 2QJRA 1C1XB 1QK3A 2C9DA 2O14A 5AM2A 1M6HA 1J2RA 1U1GA 2F64A 4HQNA 1YXMA 3I09A 3JWIA 4IHQA 2JANA 3MCWA 4B2LA 5ANRB 2JNWA 3IAUA 1G59A 1JDTA 1QHIA 4C05A 4GX0A 4LWOA 1QHYA 4WWHA 2QOEA 1PNTA 4JGBA 2ZIFA 3VR4H 3HXQA 5HKOA 3J7AC 4OYLA 3HDGA 3LL4A 1Q50A 3DWGA 1CEEA 3VOAA 1E5LA 1OHHD 2Y6UA 1H1LA 3KR0A 4HFNA 1SVMA 1XOIA 5AIAA 1H6DA 2VQ6A 4R2MA 1CZUA 1E69A 4L76A 3UXMA 1WHSB 5IWAB 1D3AA 4P0TA 1C0IA 2DBQA 4J16C 4M6WB 4CMEC 1XXHE 5A7FA 1L4HA 4FN4A 4D9MA 4F9FA 5FUVA 2QXYA 3U16A 1E7RA 1F8UA 2OFOA 1GFWA 4XTCS 5C46F 1KRHA 4WUTA 5T67A 3O0TA 1CF9A 4QNRA 5GONF 4DG9A 2HO5A 4X97A 4DLVA 1SD2A 2R6AA 5K8VA 1WM1A 3JRNA 1O5TA 2CD9A 4M8LA 4D3SA 2IYPA 3W77A 1ES9A 1NDUA 2C4VA 4JQOA 4JOCA 1VC2A 5MN5A 3D3WA 3AOGA 5IAEA 2CMGA 1OLSB 2HJSA 2C7OA 4C0HA 3P0RA 2EFDB 2CZQA 4WESB 2CXRA 3THYB 2FG6C 3D8RA 4IY1A 2OYRA 2VT6A 3E8XA 1BCRB 1EFKA 1XPUA 4HTFB 1E98A 3TXAA 5FNVB 1BXGB 1XL0A 1N2CE 1QF7A 1ZRHA 2WJ3A 2ZB2A 3FPLA 4TLMB 4C14A 2ZRNA 2V3WA 2PZEA 3IGFA 2FG5A 3ZCRA 1QFZA 1QF6A 1JV2B 1BNCA 4PSKA 3HCBA 2NWQA 4EHHA 3GRCA 4JWTA 3MBKA 4M1KA 2VJYA 2OECA 5TV2A 1KJNA 3UG7A 1U0LA 4HHEA 1H5QA 1TKBA 5G4KB 5JO0A 3MUNA 1DGQA 3FBWA 1ZJYA 2Q1SA 2ZRHA 5BN3B 4B73A 1LPMA 4LDJA 4PVCA 4ENRA 1GGVA 2V97A 3S2IA 1YRQA 4JQYA 2ZJFA 3QMMA 1S2LA 1FNCA 4OV6B 2M9MA 4JT4A 2IEAA 2KX7A 2LXNA 1YRWA 1TW2A 3QVJA 3KU4A 4D8TA 5CDTA 4N8DA 2VDVE 1UJMA 3NHSA 5TMEA 3K0SA 2ZJYA 3WYCA 1PFWA 2BAGA 3CLRD 2D2FA 4EUNA 3QITA 1QH8A 4DMGA 7ABPA 5KNCA 1K6IA 2JKZA 4KFSA 2V5UA 4YASA 1NC1A 1NDQA 4A8JA 3BWXA 3FBGA 3DVQX 5HX7A 4UTNA 5DXJA 3JZDA 4PG5A 4Q16A 3S6JA 5A5FA 4U7WA 3DFUA 2Z1NA 1NP7A 3N2IA 4IQ0A 4M49A 2DWPA 3SF8A 1KC3A 2C7QA 3VH1A 1JXAA 3QF7A 3VO2A 1NF3A 2W6IA 2VUUA 3MAJA 3TINA 3X2FA 2Q5FA 2PSDA 5BW4A 2RGWA 2VHTA 4G8JA 4YDHB 3LCJA 3KRTA 1SXGA 3CR8A 4LY6A 5G3YA 2PYIA 3L4KA 2G63A 1U0OC 3ZDEA 1XA4A 4O6VA 2GBCA 2YZKA 3KT6A 4D5EA 4I3FA 5F7OA 2IQIA 4BNWA 2R1ZA 2BKEA 4CF5A 2BI8A 4LJYA 5I5EA 1KMMA 1IAQA 1PHRA 1GV0A 2EV9A 3H11B 5CA1B 3KFXA 4EVIA 5CR9A 4N47A 2EKDA 2FZEA 4EHNA 4H7IA 1EVQA 5H02A 1HXHA 1LD3A 4Z9YA 2JI7A 1T6BY 5COAA 2VJOA 1NUHA 1YRHA 1EVIA 1F8XA 3RREA 5JI2E 5BR4A 2X23A 1YZKA 4L73A 4TTTS 3R7WA 3TZ6A 4N6GA 3RS3A 3NH9A 3D6HA 1DDGA 1U2RA 2M1XA 1EMDA 1T2NA 1T9GS 5HE8A 2HLDD 1GYPA 1U28A 4C4XA 1PHPA 4JL5A 2PSEA 4DSAA 3R5SA 2GYYA 4LXTA 3I34X 4RGYA 3V8VA 5U4XA 4H60A 5J2UA 1SHKA 3IXMA 5CXUA 1DRJA 5G41A 1U8YA 1WG8A 1XDZA 3A6PC 2J0VA 1HETA 1JQEA 3GGPA 3H2HA 3HVRA 2F55A 1HDYA 3CF4A 3OOJA 2K5UA 4V0MA 1Q83A 2NZ8A 2W6QA 3LQRA 3Q88A 1E6WA 1WTAA 4TWRA 3CUWA 1RWBA 3L0PA 3OTGA 3QWBA 5EWLB 3PCTA 3B3GA 1ISJA 1W2GA 3RD5A 1P5RA 2QK4A 4Z3DA 5YASA 4R0MA 3LOQA 2RBEA 4RSHA 3PUHA 5DCUA 3A6JA 3T4PA 4EG3A 2NQ8A 3M89A 3N7AA 4N82A 5F1KA 3CN7A 2FUNB 4B80A 5JAPA 1VB3A 1ECLA 1LLQA 2I1WA 2IEGA 2R1TB 4BXOA 1H0HA 5C53B 1RLUA 4LF5B 2Z43A 2P9TA 5J5VA 1JMKC 1Y4SA 1WDKA 4Q1CA 2QKYA 3BMCB 1V2HE 1W9MA 4I1RA 3PNPA 4YBRA 3SJBA 2GETA 4YP5A 3SQWA 4RLSA 1F2TA 3AONB 1GN9A 5A7HA 4M9QA 4Q3KA 5AK3A 3LDAA 5T4FA 1F8GA 2GFIA 1CUBA 2ZUBA 3ZS9A 4DBLE 3UENA 1GOTA 3NAMA 3UCEA 2CCJA 3Q85A 1N75A 2XCUA 3RJ9A 1WW8A 3DE4X 2C5HA 1VHWA 1X70A 2FJPA 1P29A 5E2IA 1ZCJA 3BHNA 3HN6A 3ZGLA 1EPUA 5AVTA 1W5AA 4KGVA 3F9IA 1PNVA 2RCYA 1JQBA 2VQ3A 1T5TA 1MG0A 1LFDB 4MWBA 2MINB 4ND3A 2O7RA 3DHEA 3CEAA 1J0XO 1DEAA 1USUA 5IZCC 2A9KA 4H2DA 1M2KA 1VHLA 5LN1A 3ZHXA 3DC7A 2JJ2A 1PGJA 2OAP1 2VAVA 4BJ3A 2V7EA 5KINB 2J6HA 4ER6A 2X9VA 1ZYUA 3EC2A 1QIMA 3QRWA 2VHZA 3BWMA 4TZTA 5ERXA 1VE5A 4TS1A 3RJTA 3JAKB 3AVWA 1T24A 3N74A 1LRKA 3KOXA 2O2IA 4WQMA 1E3EA 2VNHA 5AKXA 1FUKA 1K06A 5CDSA 1NG9A 1SRQA 2NO4A 4MV6A 3EDYA 1EG7A 1EIZA 2OG1A 2NU6A 3FPGA 4QWMA 3GJZA 1TU0A 4OQNA 2ATIA 4WOBA 2FZ5A 4FB4A 3DAGA 4PC2A 3FDXA 5AM1A 4CGYA 1Q7CA 4NEHB 3C6QA 1IUOA 4I50B 3QX9A 1ZVJA 4IIHA 2SBTA 3EGDA 4XQ0A 3T35A 3IXLA 4P34A 4MIOA 4FUQA 4HYQA 2VR1A 3EAGA 4URHA 4MUIA 1K6MA 3DC2A 4X00A 2FQXA 5BMVB 5C7LO 4LTDA 5IEJA 1SVNA 4XTRA 1XI2A 1H6AA 4DM3A 4Q21A 1YC2A 1O58A 2ZVDA 2E7ZA 4IDEA 3FCCA 3GRVA 1Q77A 5FTWA 3WMRA 4MUAA 1VXRA 3D31A 4PGHA 1E3QA 4C87A 3GPCA 3SXUA 3CVUA 2I0FA 5LOVF 1YFLA 5CA0A 1HH4A 3OAAA 5THQA 1Q1GA 3NHZA 4Z53A 4L6AA 4JVNA 5DCYA 5D85A 3D8SA 3DDOA 2E5WA 2EW8A 2OO5A 1W85B 5F1PA 1A9SA 1XMQB 1O3YA 1WKVA 4WECA 5EWMA 3LFUA 4C6SA 9ABPA 1QE5A 1U8CB 4YWJA 1JBEA 4OTZA 4DKXA 3LM8A 4GI3A 4AICA 2JLQA 4O2BB 2IH5A 3B6KA 2RGUA 4FCTA 3RSGA 3OPYI 3Q8WA 4GSYA 4A0FA 4YRLA 5A9SA 2E1PA 3EN0A 5ALLA 1RE1A 1KORA 2BEKA 3S2YA 3OIGA 1DBWA 5FPPA 4G8CA 3TF5A 5EAIA 4D4MA 4BCDA 3P20A 4PAGA 5EE5B 4FFPA 3PNKA 2AZ4A 3A4YA 4PLWA 2RG1A 1TYCA 1V0JA 2ZIAA 2ZWVA 3BMQA 4PM4A 3KOWA 1IHOA 2X6RA 1LBIA 4KUEA 4RV4A 5IYZF 3SYNA 4CV2A 3R44A 3GEPA 2BFOA 3NTRA 4IEIA 1KPGA 4D82A 2GN8A 1YUNA 1C9NA 2GBLC 3SP1A 5K0LA 3ZH9B 3KZNA 1XQWA 2VP0A 3H4MA 4ZI3A 2BDTA 3SS7X 2D2EA 1OBCA 2C8JA 3KQYA 3QW4B 2CUKA 4BVJA 3ICOA 1D2HA 3BSWA 4UHHA 1V3TA 2P1ZA 3JXEA 1CTQA 1N2JA 1USIA 2ACEA 4NE9A 4NK5A 4DIKA 1UCFA 3KDSE 1ZVVA 1HA3A 1T0HB 3J7TA 3OFJA 1G2PA 2G88A 3QF4B 2IXTA 4MI6A 2KMLA 1J09A 3BD8A 1UM8A 2BE7A 4FNAA 5ICMA 5KNDA 2AUMA 5IFLA 3PK0A 2Q07A 5B2ZA 4ESOA 5J4YA 2Q28A 4TT8A 3FLMA 1FYFA 4X6LA 3GJ8A 4KNWA 5F7XA 3BIXA 1PYGA 4QREA 4AWAA 3DF9A 5TLSA 4TMTA 3JQAD 2GS9A 2OGWA 1ODJA 2OHFA 4TKMA 3A36A 3DO6A 4R7GA 3WGJA 3AIMA 3ZV6A 3KVOA 1OWLA 1D07A 3RYIB 2IOFA 3HB9A 4HH4A 2A30A 3PC8C 4G81A 2VRCD 5FIUA 2EYQA 1GSHA 1LSOA 1SQFA 1IRIA 2EZTA 2QPOA 4JMLA 4U2EA 3SIRA 4BYGA 3EH1A 3KDPA 3TAUA 3GFGA 5LXTF 2IVFA 2J41A 4EPVA 3U6KA 2ZRLA 2F8TA 2EGUA 1KFBB 2XVZA 3GT3A 4IFIA 1FMCA 2O1XA 3IOCA 4FBGA 4NC9A 5I4IA 5JWOA 2OV3A 4C0BA 1P60A 3RK1A 1JJVA 4CM4A 2OBBA 4P1ZA 1TQHA 1N1DA 1YVDA 1SU6A 2XUIA 5DDIP 5JS2A 4S12A 2YQ4A 1GLNA 1TCAA 2C92A 5TQ2B 3B3AA 4U39A 1MJ5A 4G9GA 2WMOB 4YQZA 5FQNA 5KNBH 1M1YA 4ZHQF 2J7PA 2J9GA 4RVUA 2P5SA 3OQMA 4AUMA 4ARUA 3ML1A 3KXDA 4Q5IA 1XP8A 4Q7MB 3AHDA 3GZTB 5C8YF 4LNHA 2QG4A 5ALNA 5FOXA 2JCBA 3IO3A 1KI3A 3COSA 3VHLB 1SD1A 4FC7A 1JNXX 1HE2A 1RWOA 1U7ZA 2CVPA 1SU8A 2QQ5A 3FNQA 4BNZA 5L45A 2ZAMA 3LY8A 1ESMA 5DU2A 4G0YA 1URPA 3RYHB 1QCCA 1PQYA 3GARA 4MKRA 4OXXA 1RQGA 2WHXA 5HJ7A 3ZIUA 4RF3A 4AROA 1IHPA 2YBDA 2I78A 3D6AA 2VHQA 4EFLA 2VPTA 3C8ZA 1XQ1A 5FLKA 3DKPA 1O95C 2LWIA 4EJ6A 2NVUA 1N7IA 2Z83A 4JJ7A 4OXQA 3PEYA 3UAVA 2G71A 1TLFA 2BSXA 1EXWA 2IU4A 4GL4A 3M3DA 1A2KC 2CDBA 2VJBA 4HCJA 2XCSB 1CV2A 3K05A 2HXSA 1ORHA 4BZQA 3UN1A 2H9IA 2A2ZA 4B7CA 3IHWA 3OG9A 4R9VA 5JU6A 2AXQA 4D0NA 4LQCA 3EC7A 1RKUA 4WKBA 5FTLA 1RHQA 2OR3A 3TSYA 2YW2A 2VF8A 1P2GA 4V3BA 1D9ZA 1PDOA 2C2MA 2DLNA 2WWFA 5AHKA 1LDGA 4QATA 5G0WA 1ZN9A 4N0MA 1P1RA 3HACA 4P3YA 3NWBA 1I7SB 3JARA 1JWBB 5A02A 5EZYA 2J30A 1ECGA 4AJIA 3RU9A 1G5QA 2OY0A 3LY5A 2POQX 3KJQA 3LKBA 3RSQA 2ZE8A 3PQ5A 3WVNA 4DA7A 5KOJB 2OQ2A 4MGZR 2P9CA 4LRQA 4QOHA 1W36D 4R3UC 2PCLA 3VR6A 4Z3KA 4NZMA 3T7CA 3UC5A 3ZDDA 1GAXA 1JQKA 3WHLA 1W4ZA 2H63A 3AHFA 2E0IA 3FWHA 2Y92A 4G86A 4JUCA 3I5MA 4IOMA 4P83A 3TD2A 2IYVA 2P0AA 3GUUA 1J5PA 4UUOA 4RL6A 4FDUA 4D9HA 5IKPA 4KWEA 2OKCA 3NAZA 2JAWA 5AOVA 3VISA 1E2HA 1J07A 1YC5A 3BWEA 4QTTB 4XX0A 5FUYA 4M9SA 3PVZA 5FFNA 4O4LF 4C7MA 1I5OA 2JIPA 3W4IA 2DCUA 2O2CA 2DPXA 1MAWA 1IATA 3GX1A 1YJBA 4FUTA 3IHTA 1N8NA 4HVCA 4ND8B 1M0WA 2QY9A 3LY9A 1QG2A 3ASUA 1T2CA 3NH6A 1IN7A 2IK8A 3ZJ5A 4EPXA 3LCCA 4YP0A 1GU0A 2XCLA 3VC2A 5FYDA 4FEYA 5JJ5A 7AT1A 5JNWA 4RFVA 5JNUA 2QUKA 1UQTA 3QIAA 2ZG6A 3AR4A 1VHQA 3HUFA 1OH8A 4RPGA 3UAYA 2VJDA 1KVSA 1C30B 4EHLA 1RACA 4JCCA 4DIEA 4EI7A 1CVLA 4TLCA 1SUCA 1JAXA 4GZ6A 1W581 2JI6A 3IURA 1A3CA 1OKKD 3QEOA 1SJ9A 3R77A 2OHXA 3O9VA 4NMXB 1SQGA 5JROA 3T5DA 2R5WA 5I9IA 3ZYCA 1P0PA 1X7XA 1X1SA 4PAMA 3QVGB 2EATA 3FBTA 1CC1S 4EW1A 2CXUA 1FSPA 2DMRA 3UKJA 1PX2A 2SHKA 4O0MA 2M6KA 5CVCA 5EGNA 1G98A 3I2IA 3AL2A 4IVQA 4A10A 4Z8XA 4JXZA 1Y4AE 3A05A 3SIPA 1ISPA 4J1TC 4ILEA 4YYZA 1VZ3A 1IUPA 3EWNA 3I9OA 5B6PA 1ECJA 1NE7A 4FI3C 4ZI5A 4GBMA 4R8RA 2P4QA 3OWXA 5TR9A 4FE4A 4RL4A 1EA7A 3EIQA 4GO1A 1Y9DA 2AQHA 2VRNA 3AM5A 3PZRA 1GV1A 4ME6A 3DZFA 5IXSA 2UUBB 4G0UA 1BHJA 3SR0A 3LFTA 4HEQA 2G7MC 1QIIA 1VBNA 2GD0A 3BEOA 4B87A 4BMDA 1TD1A 4QUBA 3I2GA 5F5NA 3ZK8A 2CUTA 1MNQA 3TTTA 1MHTA 2IL1A 3N58A 1N25A 1U11A 3IB3A 5IMBA 4CN9A 2ZRCA 5CX4A 4L4XA 4DSTA 3CUUA 4PIPA 4HLUA 3ZVKA 5F5LA 3LVQE 4E31A 1U2PA 2Q5EA 3Q5GA 4Y18A 3PC7A 3KKQA 4BRZA 2NN3C 2ZI9A 2YUIA 4RTSA 2CLSA 3AHCA 2QLJA 3BL5A 1RBQA 3CBQA 4JLWA 4LVUA 2LDXA 3BIFA 3CRZA 4REOA 5DGHA 5FOQA 1YHYA 3HBFA 5BN1A 1ZOOA 1RT9A 1PTKA 4ZOLA 5KJFA 1PQPA 4PYQA 1ZOIA 3FPKA 1LGYA 3PDIA 5D5HA 4YCMA 1UC5B 3U7QB 4KQJA 2WB2A 5JJLA 1TYEB 2O3UA 1GKYA 3WRXC 4KXVA 5DW0A 2FRXA 4YN3A 2CFSA 3GLIB 4YJ2F 4JB3A 2CLCX 1U3TA 2GBGA 3B2NA 1DDOA 4RWEA 1CF2O 2NO7A 3LYUA 3OZVA 4TT3D 3RI3A 2P4UA 4WBNB 1Y9EA 2OXFA 3ZLTA 3RM3A 3CEPB 4K28A 3HYSA 4IFEA 2XCOA 2FSVC 1LDEA 3P1JA 1JA1A 4XARA 3WJ2A 1P5JA 1W96A 3PQCA 1SBCA 4BZZA 4YRMA 3W5AA 4E7PA 5HPYB 1Q22A 4CTOA 2PJZA 5FOVA 1QANA 2WWIA 1BXRA 2BCGY 1RLTA 4NV3A 3VC3A 4ZQHA 3S29A 2VP4A 1L4NA 3ED5A 3M2TA 1RNLA 3BC1A 4TLDA 2MCFA 1IEQA 1P0CA 3PNQA 1BWPA 4ZPXA 5FBZA 5HOQA 5KX5B 2V7PA 4TS4A 3L4JA 2F1OA 5G2OA 5JATA 2A1TR 4URYR 4C3VA 4PN3A 1NTOA 3EFHA 1X7HA 2FMHA 3C24A 4EHAA 1P3DA 1IMJA 4HLNA 1H66A 3OP1A 4N65A 4XVHA 1ETUA 3II6X 1DV2A 1SG0A 1W52X 4DLSA 5HWSA 2RI0A 2AG5A 3CE6A 4PQEA 3FUVA 3DEYX 4NPAA 2HU7A 1ZM4A 4Q9NA 1XR3A 1WBBA 1DG1G 4MVJA 2O7SA 1K9SA 3HLKA 8MHTA 2Q8QA 2P7IA 4B3TB 2PT6A 3DS8A 1I4TD 3HA5A 3N0VA 1JALA 4NJEB 4ZVRA 4LSWA 5FOUA 2QP3A 1S6YA 2EG5A 4ALMA 1IQPA 3NVAA 3K9FC 1P74A 1I33A 1ZUNB 2VNKA 3DTTA 1E96A 3F9RA 4CTMA 3B1VA 3I72A 2O2SA 2FRDC 1L4KA 2VUTA 2KW5A 1HDEA 3LT1A 3QFCA 1T35A 5CYGA 4QHYA 1AUVA 3D4OA 5ALYA 2CD7A 5FJIA 1PW5A 4KMSA 1IK6A 4MJLA 5G0UA 3U26A 4Q9DA 1PV1A 2X4GA 4RD3A 5LU8A 1KEKA 1L8LA 3OX2A 4LY9A 4OVKA 2YWXA 4MRPA 1T5HX 3B48A 1M6WA 4RCVA 5KDLA 1TZKA 4MW2A 3VSCA 2QD5A 2D4HA 1KJZA 2PQ6A 2ZUWA 2PUFA 2X1MA 5EUMA 4PZAA 3WYFA 3F71A 1WCIA 1HT1E 1N2OA 4CG2A 4IH9A 3IR5A 3IVXA 1RVV1 5KWJA 3KQNA 2C2WA 1QIKA 3H18A 3I8OA 3EYWA 3UNXA 1KYXA 1TW3A 5L51A 2WA2A 3JU3A 3OLZA 4ZYTA 2H1VA 4FD2A 1ODKA 1R5BA 3WP1B 2FDXA 2NYRA 1OWOA 1H93A 4HDNB 3QJ5A 4WGFA 5ISMA 3MSCA 3GYGA 4L5JA 5CFNA 3KKMA 5K6AC 1KS9A 2ENUA 1PDWA 1Z29A 4N7RA 1KFCB 2UXDB 3IKLA 2RK4A 1TAUA 3EZ7A 1GUBA 4ISCA 1Z63A 3KG2A 3WGKA 2JLVA 4DGQA 2FEXA 4IX1A 5CFOA 2XMZA 3AM3A 3O7MA 4HGQA 4QYTA 4RORA 4IGKA 4F56A 5BSWA 2WPDA 2J4DA 1EZZA 3GDGA 3HU5A 2IDMA 4K1XA 4PZ9A 4GC5A 3CM0A 1FOEB 3GLUA 4J94A 4UEWA 4BO3A 4P4LA 4TYYA 1KU0A 1QX3A 4WBSA 2RBGA 2HCTA 4UBLA 1BX1A 3X1DA 1KDRA 3CRW1 3B2QA 5M2QA 5FTKA 2CLOB 5AXDA 2Y71A 2FMTA 4YRKA 1J8QA 3PLRA 3CGWA 1BC5A 1XYGA 3FTNA 2FPMA 3HN2A 3I9V6 1GD1O 2GO1A 2OGTA 1CX9B 2V0CA 4U3JB 3P9KA 3RSHA 3EIFA 2C2ZA 4TKVB 3GG2A 5DP2A 3OJWA 2H2AA 3CA8A 1QV9A 3ILXA 2X2FA 3WNDA 1WU8A 2HA0A 4CIWA 2OHJA 4I55B 4QC2A 2B3DA 1UL1X 3Q12A 1IU9A 2R7AA 1H4TA 4ZYVA 5KYWA 1CJTC 4X1YB 3WI7A 2ORVA 3JQPA 3NVDA 4CEJB 4Q05A 4MR9A 4RZ2A 4BFLA 3WS7A 1LA2A 2ZP1A 5DBEX 4EG5A 4O02B 3AB7A 1NNEA 1HOXA 1BRMA 4HVTA 3PUJA 5GOTA 4CDRA 4BMNA 1T0UA 1JDUA 4RKWA 5IU6A 4ICIA 2WTAA 1A8QA 3ZWVA 2G9QA 1Q14A 3E7WA 2FK7A 4IOJA 3DO8A 3ZS8A 5ALVA 3EZ2A 2ZE5A 3TL3A 5C1OA 4WDQA 2ORIA 1GCAA 2PKYX 4BP9A 1KKLA 5I01A 1DG3A 4OP2A 1N2GA 3UB3A 4DQUA 3N2KA 2O06A 5LUAA 3JQDA 3MGAA 1R0ZA 5HQJA 2Q4EA 2VUIB 4HQLA 4HOYA 2YWDA 4MKIA 4N0QA 1W75A 4QDZA 5IT0A 5ECGC 3I6BA 1KARA 4E5KA 3TJMA 4C5CA 1YDMA 2H18A 3FPCA 3BVPA 2PS3A 3K0KA 2EP8A 4II2A 4E0BA 5K03A 4ZYUA 4FIDA 1JTFA 5IZ4A 1CR1A 1F2DA 1GPBA 1XRPA 1M6EX 1RM5A 3C16C 3ETHA 3TEFA 3WWCA 1L3BA 2PUAA 4YQEA 1R4ZA 4E3ZA 5EVJA 2CLHB 1P1CA 1IH8A 3JQGA 3BUSA 2HMYB 3RRMA 4AUKA 2GD2A 5A3SA 1NNUA 3IKMB 4LZOA 2O3TA 5CDFE 4URXR 1L5WA 1WE2A 4FGZA 5JQGA 1P80A 1SCQA 5ECDA 1PT7A 2C1EA 4DLKA 1J7KA 3N2ZB 5F21A 1H2WA 1KJWA 1Q12A 1ATZA 2KWIA 4I9GA 2QLMA 2Z2XA 4W5RA 1CXZA 3P32A 3IESA 4AJ1A 3GGDA 4JC8A 3H2IA 4S1VA 5FOWA 2WM8A 5GJVC 4E7OA 1J0EA 3PG5A 1C8KA 5A3RA 3OP4A 4CFYA 5HJ5A 3O8QA 5CLQA 16PKA 3KU1A 4YIKA 3LKZA 4KLCA 4ZCQA 2DFVA 4H6PA 4URUR 4DIMA 4YAIA 4UNRA 3M6MD 3WQQA 5TPWA 4RD1A 4M37A 4DR2B 2P65A 3B60A 3W8FA 4AK9A 1AQ6A 1JU9A 2DLDA 3U7EB 3RTGA 1XTJA 1NN0A 1RWWA 4R69A 5D86A 4L3OA 4WCFA 3RUHA 5ITZB 1KI1A 2W90A 3C3WA 5THXA 2PY6A 4O5AA 4ROTA 1GPH1 1F8FA 1N2IA 5TQ0B 3NNDA 2FSFA 1PJRA 4F12A 3TGLA 3ONWA 2ODBA 3IELA 4MLDA 2BIFA 2YIJA 3RANA 2Z6AA 3PPYA 1THTA 5JEDA 2QTGA 3NAQA 3WYEA 2QZPA 3OZXA 1MX3A 1Q1BA 4GLLA 2P35A 3S5JA 2YS7A 4HD8A 2V9CA 1KAHA 1JSXA 3VNAA 2JD1A 4BEVA 3KSDO 1TJYA 2Y0EA 1LK0A 3LXRA 4Q4HB 5FLEX 1E1LA 2QD2A 3KHTA 2YWEA 4G2NA 4C03A 1KIMA 5G0VA 1L5OA 5TF4A 3HJBA 2QR3A 2VS1A 2QEQA 2Z4SA 3ETLA 7REQA 5JXGA 3EG9A 1KSGA 3NU1A 4JDPA 1S2GA 3FCYA 2XOKA 3MS7A 3WLSA 1BMDA 2GMWA 2WZQA 1JE0A 5HCUA 2YV2A 2VJKA 2MHCA 3MB5A 2YXBA 4NY1A 4NOLA 4Z7NB 4G5XA 5C52B 1W2WB 1GA6A 1Z74A 1U4SA 2ZOSA 3JWGA 3WK4A 4YUWA 1UPXA 2V3VA 3SLRA 4IYJA 1IOVA 1NHWA 1KO1A 2D2VA 3RW9A 4DDHA 1UPFA 1U1FA 1Y7PA 4YROA 3RRJA 3TIXB 4AYTA 1XCBA 4BMOB 3P2YA 4W7IA 3I23A 1NYRA 2BR5A 4PNPA 1KYZA 3L40A 4EBBA 4BLTA 4RNCA 4Q1VA 5DISB 3RBXA 3PIRA 2YHSA 2Q6LA 3OY7A 4TM8A 4US0R 1EFAA 1GPDG 1HL3A 1HYBA 1RW4A 2AFIE 3O93A 1JDSA 3TQQA 3K4QA 4BB9A 1Q6YA 1T9AA 3GGCA 1OBOA 1PK9A 3FTCA 3RNLA 5I7UA 2HFJA 3L07A 4AMGA 5BUQA 1U8TA 5LA6F 1UDXA 5K0GA 3KQTA 4XI9A 3QNMA 1WSDA 3N2EA 3DAFA 1QG0A 1SA0A 2PMWB 4J4BA 5DBIA 1PJBA 1U8UA 2J3IA 3OF2A 1UXJA 4AY6A 1QWOA 4DDWA 5F76A 3ECCA 2QZSA 1KAMA 1SG9A 3SKVA 2Y1CA 2J3LA 3NXSA 5J5CA 2QRMA 1MJGM 4LKOA 3SC6A 1XYVA 2JDID 2VTDA 3CVYA 4OOFA 1XF9A 1MGOA 4OAOA 1R0SA 4KB5A 4RV5A 5KHLB 2FK8A 4J3JA 2H2WA 1PJCA 2PKRA 1A7KA 3CUKA 3R8FA 3OMLA 5A4KA 2P9EA 1HG1A 5DBFA 5HIKA 1BDMA 2BTQA 5EHZA 1SVLA 1JMVA 3HDHA 1QH8B 3F9CA 1OOEA 4M55A 3HR8A 2B8TA 3ZYZA 4E07A 5CH8A 5CDGA 2Q9BA 2BMVA 2V6IA 2WUVA 3NX4A 4FWTA 1BIFA 2X3FA 5FCDA 5E6UA 3L5OA 4BKPA 1FVFA 3GH1A 1EP3B 2EDCA 2H00A 2VAMA 2VNJA 3LUGA 4MCAA 1HYEA 1L8AA 1USGA 1OAKA 5FWXA 3TMAA 2IS6A 1AB5A 1F9AA 2JATA 1L7AA 3SR3A 2VCHA 2XUHA 2WZDA 3GLRA 1TMOA 4NMMA 1RE0A 3G2PA 4Y0NA 1TGYA 3HPRA 4BHTA 2O2DA 2YOFA 3VPAA 1RPZA 4EA9A 1L1QA 4D0LB 3LSTA 1TO2E 4DY4A 1KQFA 1IMOA 1VZ2A 5I9BA 4JBHA 5JG7A 1D4AA 1DG9A 1V6AA 1DXQA 5JFTA 2HSJA 3W05A 3S0JA 4IOKA 3HR4A 3F73A 3AR3A 5KOHB 1ZNQO 5DNAA 4MQUA 3PR1A 3VSAA 3UT0A 1Z8HA 2HEGA 2YNMD 4HX5A 4PZLA 3AESA 3AETB 3U4QA 3BERA 4R9NA 4B4VA 5LU9A 2EWVA 1DT3A 4E46A 4BTLA 2E89A 3CZPA 3E3AA 3WK9A 3EXAA 4CDGA 3MZ0A 4MRVA 4WK6A 1DIAA 4CKCA 2QAGB 1NY6A 1WZEA 3CFYA 5KSZA 5DYTA 2ADOA 2OV2A 3ABOB 1VDZA 1KKMA 1V5EA 5AUQA 3GLSA 4I4TA 1LC0A 1D09A 1M2OA 2A0FA 4L6CA 2HLNA 2I6TA 1BQ3A 5FKJA 3B85A 4M76B 3UK1A 1J8DA 2HWWA 2QLBA 4IVPA 1P2BA 3CLHA 4GYWA 4IRMA 4N9WA 3M83A 3AGPA 3TCXB 4J0GA 3VX4A 3JPWA 3C3AA 4ZEVA 1QP7A 1Z2EA 4JELA 5CLHA 2X0NA 3EBOA 3LA6A 2GK3A 3FDIA 4FDVA 3LUHA 4G0QA 5DK4A 3RHFA 3UG6A 2Q27A 1YDEA 1B00A 1M2NA 4ZGGA 3AHJA 2QRKA 4R2KA 4N5LA 5GADl 1Z5WA 2GFQA 5ENZA 3UXEA 2FN4A 4UNNA 2QVLA 1H65A 4WXRA 3R4VA 3MOIA 3S5UA 2BTOA 3G2LA 2ONYA 3OZAA 2HRBA 4UQPA 3ZOZA 3PCXA 4BKQA 1A27A 1GKUB 1XDDA 3F6EX 5K51A 3L9XA 1F2TB 1ZLXA 2R66A 1Y1RA 1X1TA 2J48A 2Y1GA 3OFNA 4JVSB 4PRLA 3M4JA 3IMCA 3IUPA 4MQFB 4OI0A 1RRMA 1E9DA 2BEVA 2WBLC 2WJYA 2PVCA 2H51A 3AUJB 3DEFA 2GHTA 4WIAA 4NQRA 4J0JA 1MEEA 2GEJA 4O4JA 1YOVB 1ZQ1A 2I67A 1N7GA 4DNQA 1VIYA 2RC6A 2UU9B 1TK9A 4K9NA 4YV2A 2WF8A 4N6OA 5A2GA 1X2EA 1KNXA 3STXA 1M76A 1NFQA 3DFZA 1HX7A 1WPXA 1KOJA 1XZLA 3G3EA 4F96A 3NOXA 5E3IA 1G42A 1OXKB 3OU2A 4YGYA 4AZ3A 1S7CA 3Q5EA 3ISVA 2VXOA 3R20A 1C7QA 4ESEA 1NSYA 2FQYA 3IPCA 1U2GC 4REQB 1XDBA 3NS7A 2JGKA 5JE8A 5FBVB 4W82A 4D9FA 4MITA 3B82A 5AO9A 3FD8A 4P5EA 4G85A 4EW6A 1K89A 2LUOA 4P93A 1R18A 1QWSA 2UDPA 1E58A 4MAMA 1E2EA 5JVDF 4IBOA 3ZZTA 3OO0A 3N87A 3EMVA 2UYYA 2AK2A 2C77A 4QU9A 4AMVA 4D6PA 4C2UA 5MGBA 4YVFA 1RCTE 1X87A 2YQZA 2PA3A 3F74A 3ONEA 4QEDA 5E7IA 4JR1A 1QZUA 1LLFA 1QTRA 3ZE7A 3T38A 1J70A 1CIJA 4GR9A 3GCXA 1V5FA 3FNRA 3WDLA 1CY1A 2JJ8A 2VJPA 3C5WP 4CFSA 4D6YA 3UT6A 5JAUA 1TA0A 4TZ6A 1H2HA 1IUKA 5EINA 2HD4A 2R87A 3JWHA 2WOOA 5HRUA 4YPFA 4LXYA 3UHJA 1QP8A 5J59A 3G5LA 5TT1A 2Y0DA 2WC1A 3HZOA 4H0CA 2JLBA 5JJBA 2IRWA 3M2PA 5JWHA 3EEIA 2ZWMA 2Q5IA 3FX2A 4AY3A 1HTBA 2BGUA 5EERA 3TI7A 3LQQA 1FMLA 2NAFA 3V4PB 3OIYA 4MPPA 5KWEA 5HKBA 2CNOA 3T3GA 5J58A 2V8BA 4A1FA 4TWZA 1Z35A 2JRLA 4X1IA 1ZUHA 1A8SA 3PDCA 3MQ2A 8ADHA 3SHTA 1MX5A 2D4AA 3GLHE 5EWMB 1E7MA 3IEKA 1X38A 3GN1A 5E0OA 2ZUDA 3CV3A 1OAOA 4XH9B 4BWFB 1KVQA 3WTBA 4S0ZA 1RRKA 5CFZA 3D4BA 5JZMA 1QPBA 1UJBA 4QPCA 2XUGA 5A9SB 3K0HA 4RVNA 2X9LA 4YACA 2X41A 5HQTA 3ENZA 821PA 4MAAA 3WK8A 4F4UA 3L2OB 2KB0A 3NKVA 1LPAB 3WGUA 4BOYA 2ODQA 3O4JA 4TQGA 4YX9A 1SZPA 2IEIA 4W1RA 5JAQA 3R5HA 3D6MA 2J0UB 4R68A 3QE4A 4NMWA 4FWIB 4C7BA 1WABA 1B6TA 3BMQB 3ROFA 3F6BX 1ADBA 4HFRA 3EVEA 2R4TA 2WE7A 4YECA 5K6RA 1QGUA 1C81A 1S3FA 2IKSA 4OQDA 5AKGA 1LBTA 2DUMA 4LI3X 4LW8A 4IIUA 1WB5A 5EXPA 3WNVA 2Q1TA 3D6JA 3ZH2A 3OE7D 2PKCA 4RKYA 4A2QA 3ISTA 3LF2A 5AW3A 1EZ4A 1HM5A 4OFZA 4MH0R 4C22A 2AMVA 4Q24A 1KEVA 2WIAA 4MMYB 3UOAB 5F1YA 3DULA 1LJLA 1NXVA 2NO0A 2ZBDA 4D9IA 3KSMA 3MEQA 1NQVA 1UFVA 2AN9A 3DWIA 1Y8ZA 3O83A 5JNRA 4HV4A 3CPSA 4PYKA 5J40A 2YXNA 4AJ4A 3C3JA 1N6LA 1OV4A 1H0RA 1FZQA 2YJGA 1C9YA 4LX8A 5TX7A 4LJ4A 1SU4A 1FJ2A 4PTZA 4KO1S 3BMXA 5HJ2A 3SJ7A 5EIHA 1PT6A 3A0UA 5CFLA 3WWDA 3EW9A 3M4XA 3PJDA 2YH2A 5BVGA 1JRLA 2VHUA 1CUVA 1ODFA 2W6ZA 3ELYA 3HVIA 2D06A 3OCZA 2XRZA 1IDN1 1T9KA 1XAJA 3EODA 3GDOA 1WMEA 3IBFA 4D56A 3DLHA 3VR6H 3I2KA 4QPZA 3L4BC 5ALKA 5KYUB 5DRYA 2QRVB 3Q41A 5JTTA 2P5YA 1BVHA 1JG4A 3LLUA 5E95A 3HDYA 3TZQA 4JI4B 2HMUA 2Z5LA 4EG1A 3U80A 2HRDA 1GL9B 3R5FA 4J91A 1XHFA 4EL5A 2D74A 3CVJA 3EDCA 3NUZA 1JKMA 2GZAA 4OJYA 3RG8A 1C7IA 1DE0A 3FDZB 1IY9A 1UBMS 4MW4A 3H4VA 4CM4B 2Q2WA 1PZXA 3FPJA 4UTVA 1XTVA 3AM1A 3SQLA 3UC9A 3TG8A 1CJCA 1HRKA 1AUOA 5CBPA 3K70C 5B4UA 5AK4A 1PJAA 2VYND 1QCDA 5AW4A 1UJCA 2PMBA 1WF6A 4GGOA 4YAFA 5JSKA 4ASUA 3KTAA 4EPRA 3BXFA 3QVWA 1XQXA 4GX2A 4OLJA 5SYNA 1RQPA 1Y4DE 1KR5A 2UZ0A 1YOBA 1ZGGA 3UGKA 2XTMA 1MAUA 3WK6A 4Z1MA 3SJZA 5SZKB 4BEJA 4X54A 1QHSA 1VBMA 2BGKA 2ZIGA 4NBSA 2C2YA 4BQIA 1IFXA 3IODA 4HX2A 1PJ3A 3Q3GE 4J0FA 4YPOA 1JN0A 1ORTA 3JZMA 4EY5A 1GZVA 1TGVA 1V8DA 5EP2A 4IHKA 1TQ8A 4S1TA 1CE8A 3AY3A 1FQKA 2NV2B 3FWYA 2ZRPA 2V5AA 2YN4A 2ATCA 3DBOB 3RRXA 3ODPA 3K1ZA 4R1TA 2TMYA 1US8B 1GNVA 2OGUA 4N0EA 5K8UA 2Z57A 3QIVA 4L51A 1KMCA 2NVUB 4BNXA 3WLTA 1FP4A 4NNJA 4DANA 5AJZA 4NCIA 4NEQA 1DRVA 1MQAA 4LC9A 4R7ZA 1LTKA 2OQIA 4ZRDA 3T3HA 1SUDA 4BO5A 1OWMA 5EJ4A 2AN5A 2J4FA 2ODWA 3R3WA 2PAFA 4ITUA 3FCEA 5JCJD 3IBSA 1ZC4A 2QT9A 1FL9A 1XZQA 2AE2A 2EWWA 3PA6A 4Y6SA 4YAEA 1K27A 3PGA1 5JUWA 2PTGA 5DLYA 3BJIC 1HT0A 3QX3A 2ERCA 3ZE2B 1Z26A 3VH3A 3JARB 1QIGA 3CZQA 1DIHA 2N46A 4HO1X 4KQKA 4KP7A 1J0DA 5EZYB 3VKHA 1UDAA 5DTIA 1F0KA 1KBQA 3KTFA 3OZFA 2PPLA 1LTQA 1P9RA 3IH5A 3Q8XB 4GM4A 3SFTA 4PBSA 1RLJA 2GLTA 4YLGA 4QJBA 3A6LA 3SBXA 1PGOA 2F3UA 2DFTA 3MJDA 3QMVA 4JBNA 4P53A 1E0AA 1LW6E 5CDYA 2FRVA 4GMHA 3PP8A 3FPBA 3ZV4A 1E2LA 3RRFA 2ZUFA 5ESDA 1R5NA 1CFJA 2ZJAA 4NK4A 2VH1A 5JCZA 4PCVA