4P58A

Crystal structure of mouse comt bound to an inhibitor
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
212
structure length
205
Chain Sequence
b'TKEQRILRYVQQNAKPGDPQSVLEAIDTYCSEGDAKGQIMDAVIREYSPSLVLELGAYCGYSAVRMARLLQPGARLLTMEINPDYAAITQQMLNFAGLQDKVTILIGASQDLIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVIVPGTPDFLAYVRGSSSFECTHYSSYLEYMKVVDGLEKAIYQGP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Catechol O-methyltransferase
publication title A fragment-based approach to identifying S-adenosyl-l-methionine -competitive inhibitors of catechol O-methyl transferase (COMT).
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase/transferase inhibitor
total genus 71
structure length 205
sequence length 212
ec nomenclature ec 2.1.1.6: Catechol O-methyltransferase.
pdb deposition date 2014-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01596 Methyltransf_3 O-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4p58A00
1TW2A 3IYLW 1XCJA 5CVEA 5MHTA 2ZZNA 1XCLA 5KVAA 3GIWA 1SVUA 3O4FA 1VPTA 3HVHA 5D1HA 4AZTA 5K0BA 2JJQA 2PGXA 2EG5A 1TW3A 2ONZA 3AXSA 4DCMA 3FPGA 2NP7A 5CCBA 2CWWA 2YXLA 1IM8A 3MB5A 1HNNA 1Y8CA 2C7QA 2IDJA 3SVZA 3MAGA 3FUWA 4A6DA 4EK9A 2IH5A 3BWBA 4PNEA 3GCZA 3GU3A 1RI3A 4RWZA 2UYQA 3EPPA 3DOUA 3GRVA 3L8DA 3LDFA 4DF3A 3E23A 1ZHFA 1RI5A 2BZGA 3FUVA 5EZSA 3V8VA 5FQOA 4F84A 5DSXA 1M6EX 4BLWA 1VL5A 4RTSA 1NE2A 2OO3A 3IV6A 3P9CA 2FPOA 3PX2A 4QTUB 5DT2A 3TPZA 4RTJA 1FPQA 1X1AA 3NW9A 2AOXA 1NW3A 5DPMA 4RVHA 5K0GA 3TFWA 2IGTA 5E8JA 4RVDA 5CVDA 5EG5A 3THRA 3M6WA 4AX8A 5IKMA 3NVKI 4R8RA 1P1CA 5DRYA 3PFGA 5E9QA 3AWIA 5EMMA 2ZTHA 4GOOD 3BKWA 2JH9A 3R6TA 4QVGA 1BOOA 4GC9A 3X0DA 4BLUA 2AZTA 1L1EA 5K05A 3NDJA 4U7PB 2XVAA 2HNKA 4ATNA 2EJTA 2WK1A 4KRGA 2NXCA 2P7IA 3JWIA 4C04A 5EMLA 5FHQA 3E7PA 4QQKA 4HG2A 1AQIA 4CTJA 3KR1A 3ER8A 5DX1A 3CGGA 1WXXA 4E2YA 2NXJA 3TOSA 1KPGA 4P7KA 3LL7A 3P97A 1Q0TA 2F8LA 5K0JA 4CKCA 1FBNA 3KQOA 2KW5A 3FPEA 3RW9A 3G7UA 2YX1A 2BR3A 4C07A 1PJZA 2HTEA 5LQJA 5CCXA 5D1NA 4B17A 1NBIA 3VC2A 2R6ZA 5LQNA 4XUDA 2B25A 3HVJA 2G8NA 2GB4A 5GP1A 3LBYA 2IDKA 1RJGA 3FYDA 3OPNA 3KPJA 1ZGAA 5HIIA 3BT7A 3E8SA 3FRIA 3SM3A 4HGZA 5KS2A 3FUXA 1Q0SA 3OU7A 1G8SA 1VP9A 1I1NA 3PX3A 1JG4A 4X60A 5BP7A 3TMAA 2NYUA 2V7EA 4QTTB 3QOXA 1H1DA 3HA3A 3FZGA 3OFJA 1NV9A 4FT2A 5HFJA 3V97A 2FHPA 5K0CA 2IBTA 3G2PA 5DWQA 5BW5A 2N47A 3UJBA 2AOTA 3GRUA 1X1BA 1EIZA 4RTLA 2BH2A 1O54A 3PS9A 4KVZA 5KQRA 1JQDA 4QVKA 1EG2A 4NECA 3VSEA 2ZULA 3KQMA 4EKGA 5E9WA 1ZKDA 4H0NA 3B7PA 1R8YA 1DUSA 4R8SA 2EX4A 3M6UA 3G8BA 1AV6A 3P9NA 4MQ4A 1BC5A 2ZZKA 3AXTA 3K0BA 1NW8A 3KPUA 4LECA 2AN5A 1KHHA 1F3LA 3DP7A 3HA7A 4OBXA 1O9HA 4PYNA 2ZZMA 4K6MA 3A4TA 1TPYA 2G1PA 3MTIA 4FP9A 4HC4A 3P2KA 3EGVA 3PVCA 3ELUA 3SR4A 4R05A 2ZBPA 1JSXA 2ZVJA 4IWNA 3A25A 3SXJA 3KR9A 2VZ9A 1SQGA 4GC5A 2AVDA 5F2OA 3OZTA 4DM3A 4YUZA 4HTFA 3DH0A 2PWPA 4GOND 3I53A 4F85A 2H00A 3F4KA 1YUBA 5ICCA 5EQJB 3JWHA 2P3OA 3TR6A 3HVKA 2YQZA 3HP7A 3MERA 5K8VA 1QAOA 1I4WA 5K0NA 3U81A 1R00A 1FP2A 3EEYA 5M5BA 3AY0A 2QE6A 3UJ6A 5GINE 3B89A 3OU2A 2IH2A 1P1BA 1T43A 3RIEA 4POOA 5CVJA 2EJUA 3EVCA 2GH1A 1DL5A 3KPWA 3LDGA 4GUAA 5CM2Z 4E33A 3G2OA 5GIOE 2P1DA 1JG1A 1XTPA 2GA9A 3NTVA 2IH4A 5F2KA 3IHTA 4UOEA 4EKIA 2FK7A 2ADMA 3DTNA 3FTCA 2O06A 3PFHA 3LX6A 4QDKA 3ID6C 4C06A 5DM2A 3G2QA 5G02A 4PYMA 1I9GA 3P71T 2UYCA 4KDCA 3Q87B 1XJ5A 3BZBA 5EIFA 3DR5A 3KQSA 1NW6A 1EQAA 1BKYA 1ZQ9A 2VS1A 4KIGA 2BR5A 2OPBA 5ERGB 3UJ8A 3T0IA 3UJCA 4PYOA 5E9JA 2Z6AA 5U4XA 1SQFA 2O07A 4C03A 4ER0A 1QAMA 3EGIA 1X19A 3DLIA 2UYOA 3O31A 2PLWA 5K0EA 5LQRA 2ONYA 2G70A 1YZ3A 5EEHA 4E2ZA 3MQ2A 4P58A 2PXXA 2WA1A 3B3JA 2NNWB 3UFBA 1HMYA 4M37A 1EJ6A 4C05A 4RTPA 1KPIA 1MHTA 1RI4A 1XDZA 2AN3A 4MWZA 1EAMA 3HM2A 5K03A 1D2CA 3EVBA 3TKYA 3PLAE 5FA8A 4RTQA 3HCBA 3BWCA 3LBFA 3I64A 2GPYA 2H1RA 3FYCA 3Q7EA 2ZIFA 3UBTA 1X1CA 2IPXA 2YUIA 5CVVA 3REOA 3WSTA 5FWDA 2JHAA 4YUWA 3M6VA 3CC8A 4E70A 3OE4A 1VE3A 4Z2YA 2ZWVA 2P40A 4YUYA 1G55A 1KYWA 4DZRA 1VBFA 3I5UA 3S68A 5E2AA 4YV0A 3P2IA 1VLMA 2YVLA 5HZMA 2LD4A 4YMGA 3BGDA 4PIMA 2P41A 3HCCA 3KPYA 3BXOA 1XDSA 4FGZA 5C0OE 1D2GA 5K0FA 3R9XB 3GRRA 4LWOA 4ER3A 1U2ZA 3FPFA 2ZSUA 3AJDA 3NWEA 1YFLA 3ER9A 1SUSA 1ZGJA 3LECA 5KQSA 1KIAA 3CJQA 5JUWA 3O7WA 3BKXA 3UJ7A 1KP9A 5FA5A 8MHTA 2I7CA 2P3QA 5E8RA 2GLUA 3FPJA 3MTEA 2DPMA 2QY6A 3T7RA 2HR1A 2ZCJA 4P7JA 5GM1A 4GQBA 2DULA 2PBFA 3GO4A 2JG3A 5E1OA 5K09A 5GIPE 2V74B 3UA4A 1P39A 2PX8A 3MCTA 2NXNA 2P7HA 3R0QA 4LG1A 3SSMA 1QZZA 4PYKA 3B3GA 5LQUA 1N7JA 4Y30A 1AF7A 2B9EA 1NW5A 3CCFA 3OFKA 3KQQA 4R6WA 2OB1A 3P9KA 4AUKA 4RTMA 1JR4A 2PXAA 2Y1WA 4FSDA 4O29A 1QYRA 2XVMA 1ORHA 3CVOA 2Y1XA 3GRZA 5F2NA 1F38A 2XYVA 5GWXA 1VP3A 2Z6QA 4RV9A 3OZRA 2P8JA 3M4XA 2BM9A 4FZVA 3M70A 2XBMA 2HMYB 4OQEA 1QANA 5EKUA 3D2LA 3BUSA 3EMBA 3UJDA 4E31A 5DTMA 3I58A 4OA5A 4ER5A 4GBED 4XUEA 3HEMA 1N2XA 1L3IA 4KWCA 4M36A 5DLYA 2YR0A 5HEKA 3LDUA 4YV1A 3BGIA 2PT9A 4PCAA 3TM5A 4GOLD 2AOUB 3HVIA 1WZNA 3LSTA 1X1DA 3UJ9A 3MGGA 3I9FA 2AN4A 5EMJA 3SMQA 1WY7A 3EVDA 4X61A 4DMGA 1SKMA 5EHIA 2R3SA 1EJ0A 1PRYA 4QDJA 4RTRA 4E32A 3C0KA 3OU6A 5EZQA 5K01A 2ZBQA 1FP1D 4OQDA 3UJAA 2C7RA 4PWYA 1DCTA 2CL5A 1SUIA 2GS9A 1R8XA 1IXKA 4WVLA 4V0RA 1RJFA 3EMDA 5LSAA 3EEOA 1ZG3A 5ICGA 3DXXA 4RYLA 3TRKA 4PIPA 4MHTA 3IEIA 3SX0A 1UFKA 2UYHA 1JSZA 2ZWAA 4RTOA 3A26A 4P7GA 3ELDA 5FUBA 5E2BA 3RODA 4CWAA 5CD1A 3UZUA 2O57A 3BWMA 4HRAA 3HCFA 3OCJA 4FR0A 1RJDA 3VYWA 4M38A 4CKEA 2I9KA 2FCAA 3DMHA 2IFTA 3SSOA 4RVFA 2C7PA 3HA5A 2WA2A 4RX1A 4BP1A 3ELWA 2AOVA 3EVFA 3TLJA 1JQEA 3SGLA 4C08A 5ICFA 3FTDA 2OBFA 3C6MA 3EGEA 2I6GA 3LCCA 3H2BA 1P91A 2PVCA 4QPPA 5EMKA 4OBWA 2PXCA 3CJRA 4M7RA 2AR0A 2O0LA 3C6KA 4YV2A 1UIRA 5FULA 4GEKA 3DXZA 4MTLA 4RTKA 3C3PA 1G60A 2E5WA 3GXOA 3EVZA 4BLVA 4XUCA 1N7IA 3EVEA 5EC8A 2JHPA 4E2WA 2ZFUA 4CXMA 2ZIGA 4AZWA 4E30A 3GWZA 1R18A 3KQPA 4X41A 1JQ3A 2Q41A 1L3CA 5E1DA 2HV9A 2JHCA 5FCDA 3G5LA 1NV8A 3G89A 3GDHA 2YXDA 4XCXA 2JH8A 3JWGA 5DXJA 4OX9Y 2AOWA 2CKDA 3ANXA 3QV2A 2AOUA 2ORED 3DLCA 3FUUA 3NVMB 4ZTBA 2Z6UA 2PJDA 2G72A 2P35A 3TQSA 2IP2A 10MHA 5C1IA 3NMUF 4DKJA 3DMGA 2EFJA 3SSNA 4FS8A 4A6EA 9MHTA 4PCLA 1XDUA 2FYTA 2OZVA 2IIPA 5FTWA 4AZVA 4ISCA 3KR0A 3LCUA 3GGDA 4EMSA 3B5IA 3B3FA 5CUQA 3JWJA 3CKKA 3GJYA 2G71A 5IH3A 5GM2A 3PTAA 3P8ZA 5HILA 3BGVA 2ZBRA 2I62A 3KQTA 2NP6A 4PYIA 4L7VA 5DX0A 5EEGA 1NW7A 2AOTB 3M33A 3G2MA 1G6Q1 5DM1A 4ER6A 5LQCA 3LGAA 2CMGA 4PYJA 5T64A 3G88A 5HIMA 4E2XA 2IBSA 1QAQA 4IKPA 2PWYA 2OYRA 4EQZA 2YTZA 1UWVA 3HTXA 1ORIA 3C3YA 2ZLBA 2AS0A 3M6XA 4IV0A 2VDVE 3HNRA 3K6RA 4PONA 5FWAA 2PV0A 3TM4A 3UWPA 1RI1A 3A27A 3ELYA 1YF3A 2BM8A 4X63A 2PSSA 7MHTA 4PGGA 4HGYA 4RSRA 3BWYA 3R3HA 3T7SA 5ICEA 5DSTA 3CJTA 3GNLA 3KHKA 4R6XA 1RI2A 2QRVB 4LWPA 3PT9A 4FT4A 4WXHA 5LR6A 2ZW9A 3G5TA 5DM0A 4PYQA 3KQYA 3NJRA 5E1BA 5LQAA 1MJFA 1JG2A 3ORHA 1YB2A 5BW4A 5HIJA 1JTFA 3LKDA 4YUVA 4Y2HA 2O05A 4JXJA 3T7TA 4YUXA 3MHTA 4AZSA 1SG9A 1V39A 4HTFB 3MCZA 4BP3A 3LCVB 4HH4A 3QOWA 5FQNA 4G56A 1XXLA 3EVAA 1JG3A 3FUTA 1BHJA 2OKCA 5DX8A 4ER7A 5JR3A 3UA3A 1WXWA 3HCEA 1KR5A 3FTEA 1FJXA 2H11A 1WG8A 4EVIA 2VDUE 5T67A 1IY9A 2UZ4A 2BR4A 2K4MA 4KDRA 4DCGA 1G8AA 5KYGA 3GRYA 2NXEA 5HOQA 4PYLA 1L3BA 3DUWA 4U7TB 5EPEA 3EVGA 4MIKA 3THSA 1M0EA 5DRTA 1RJEA 2YXEA 1Z3CA 3TKAA 5DTQA 5HIKA 1R6AA 2CMHA 2B78A 3KR2A 1NT2A 2VDWA 3NDIA 2ESRA 1NKVA 4X1OA 5LQKA 4RTNA 2XYQA 3P9IA 3LKZA 4PGHA 2B2CA 2A14A 1D2HA 4IV8A 3FRHA 4P7FA 5DTRA 4DQ0A 4YMHA 3DXYA 1KXZA 2QM3A 5FHRA 2PX2A 1YFJA 3LHDA 1NBHA 1JTEA 5EHGA 5E1MA 2OY0A 3KKZA 2XYRA 5FADA 3DMFA 3HCAA 3KU1A 4KW7A 4QPNA 5GOZA 4QQNA 5C9ZA 4C4AA 3R24A 5P8WA 4GOMD 1VQ1A 1KYZA 2QRVA 5DM4A 5EGSA 3ERCA 2P3LA 3NWBA 2VP3A 1L9KA 2ERCA 1R74A 5CVUA 2GAFA 2FRXA 1M6YA 3KPVA 5EOVA 4OA8A 2FK8A 3OZSA 3E05A 1G38A 4V0QA 5CIYA 5EKXA 1YZHA 4KIFA 2OXTA 2QYOA 4BY9E 1KPHA 3OE5A 5H02A 3FPHA 4FSXA 4GF5A 2B3TA 2PKWA 2PT6A 1INLA 3A7DA 5DXAA 2PX5A 5B1SA 4CTKA 4F86A 1B42A 3PB3A 2PX4A 2HWKA 3CBGA 4RVGA 5T6BA 3P2EA 1O9GA 3KQWA 3HCDA 5EIWA 2OB2A 1WS6A 3LPMA 1OR8A 3G8AA 4PINA 5EVJA 4DA4A 3ME5A 3FTFA 5BXYA 1VIDA 3A7EA 4CKBA 2ZIEA 3DULA 2C7OA 1XVAA 2PY6A 3KQVA 3VC1A 5K0LA 4HSGA 2AVNA 1AQJA
chains in the Genus database with same CATH superfamily
1NOIA 3E9ZA 5BUCA 2IQIA 3SR0A 1X77A 3QPUA 4AZTA 4IDQA 2WSYB 3DV2A 1OE0A 4RA9A 2D4AA 4OCZA 2OGSA 4FFOA 4LCJA 2D7CA 3WIDA 3TSZA 4IBOA 4JT2A 4M9RA 5F5NA 1J39A 4YV7A 5BNWA 5CEEA 1DINA 2QAGB 3TZHA 4TVSA 1XC7A 3STWA 1MGOA 3WL8A 1LRKA 4B83A 4IZHA 2ZK7A 4QU0A 4LQDA 5BOVA 3FM9A 4DJJA 3EPPA 2OHFA 2RGRA 3GFFA 1KMIY 1RI5A 3WYAA 4NP6A 5EZSA 1JDBB 5CAEB 2GZDA 3JR3A 4L4SA 5DYGA 4DZZA 3IULA 1AGRA 3ROZA 3PICA 1C9DB 2YC4C 1ZW1A 3KOZA 2O2EA 2V55B 1UK7A 5JDIA 3TLZA 4Q05A 4UAVA 1AX9A 5E8JA 5CVDA 5ADVA 4XTRA 4Q4AA 1RJ9B 5L45A 1KZ7B 3A3PA 1A1SA 5DLDA 4YEDA 3HVRA 2LZ0A 3SJAA 2C4WA 4BJ3A 2GJSA 5I7WA 3B20A 3CNOA 4U63A 1Q1NA 3QXJA 2JI7A 2IXGA 5SZKB 1F0NA 1KBZA 1DT3A 3T12A 4D4JA 1I3CA 4B4UA 2EJTA 1D1TA 3DDCA 1BZYA 2P7IA 1X8JA 4OGGA 2F3QA 4NCIA 2I5PO 4PGAA 2IITA 1JLMA 1SVKA 4JQOA 2Q6TA 2DT5A 1UQUA 2UZ1B 4Z51A 1SZJG 2FWNA 5HKKA 3K9WA 3STUA 1ZMXA 2I78A 3ORRA 3AOEC 4P7KA 1JH9A 4EQ6B 4JEHA 1FDIA 5JPCA 1DJNA 1K4YA 1SO8A 3T1QA 3EK2A 2VXOA 3ZZTA 1LLDA 2RB5A 3HYSA 3E3AA 3JARA 3BHJA 1HKHA 1EX1A 1NBIA 1YWGO 3QKRB 3ZJYA 4B17A 3I62A 4OB6A 2XMRA 3RGWS 4HAYA 1I14A 5JIBA 2JGRA 3EIWA 4E14A 1UBSB 3RC1A 4G0WA 4P3PA 3GFRA 4MB0A 2WM9B 3TOXA 2GYWA 2I65A 2QTCA 4E07A 2OK8A 2IODA 3PHCA 3Q3CA 2WPDD 2HGZA 4ZARA 2XTNA 5DWQA 3DOOA 3INYA 1SA0B 1QS0A 3I2GA 5ECYA 1PR0A 3BGWA 3G0BA 2C94A 2XCIA 3ABOB 3LUDA 3QU5A 5C37A 1BMQA 2XTAA 4K9KA 4MYSA 2EQAA 1IXZA 4B2YA 3JRXA 1HE2A 4LRQA 1J2JA 5IJ9B 2KBEA 3INGA 3E58A 1TADA 2QGNA 2XSZD 5E9WA 3V8PA 5A5DA 3GGSA 1MPXA 3E53A 3SIXA 1C9KA 4HEA1 1V11A 4X95A 1I7NA 2A94A 2ZZKA 2D5CA 1AY0A 3FLEA 4X0EA 1OH6A 4RFSA 1TJ3A 1EX6A 1G7SA 3GMTA 3JWPA 3O8QA 3Q72A 3EDYA 4RD0A 5TC4A 1JU4A 4MEBA 4BNKA 5KSYA 4K9RA 1ZBDA 1RW4A 1LDNA 1SM4A 4IPTA 4UDNA 2VQFB 1VYTA 5B4TA 4F4CA 1B93A 1ZXXA 3AM4A 1DAEA 1WZUA 1UKEA 3B3QA 2B94A 2RJ3A 3SC4A 3ZV3A 3BA1A 1A5SB 5JSFA 1S2LA 3CMMA 4GC5A 2Q99A 4KE9A 4N82A 4QM7A 4HTFA 2VHVA 3KYJB 1E96A 2KM1A 3HBNA 3MWDB 2H00A 1AUVA 2VT7A 4FHZA 1AQUA 1J90A 2XT0A 3WG9A 4ZJZA 4EB6A 2RK6A 1GG5A 4RDHA 1W59A 4YCNA 4G81A 5B55A 3TEMA 2M1ZA 4PLTA 2FEPA 1I3LA 5JCPA 1G1MA 2R6AA 1M34B 4LZPA 4GGPA 3F7MA 4B3JA 3UWMA 2DJ5A 2RCYA 3OMLA 4R9UC 1T6XA 1XMPA 1AJEA 1NR5A 2WR8A 2XXJA 5GIOE 1Y9EA 3O3OB 5TGZA 4BWGA 5JQGA 2C5EA 4HPJB 2BTQB 3BD7A 4DA6A 4ZHQF 3DTVB 3B2QA 5F2KA 3GFPA 4ARUA 1FUEA 2AB0A 1TMOA 2AN9A 2PAAA 3FSJX 3L7NA 3LX6A 3HEBA 4KLAA 3WWOA 4C06A 2QLFA 4QYXA 1RPTA 1I9GA 4AZ0A 1Q83A 2XGOA 4P4SA 1XTSA 5NULA 5MN4A 1MC8A 1KKLA 4FYWA 4OYHA 4BKMA 1IBSA 2W0MA 3C7TA 5ERGB 4BWYA 1RM3A 5BT8A 5CNIA 4RJKA 2X23A 1I2AA 1L5WA 3DPSA 3PU6A 1TX4B 5D01A 4IIJF 4QPDA 4TQAA 2C54A 2B7LA 2HN9A 4U7GA 3JQDA 3N86A 4FW8A 1HDXA 3I3SR 6YASA 2Q8PA 5J2TA 2HHAA 1SOMA 1VMIA 2H5IA 5KTOA 1P1HA 1ZD9A 1YE8A 2QQ0A 1JBQA 2IXFA 1ZXBA 1JX6A 1VMKA 1YQTA 2XYGA 2VNSA 2VBCA 3FPBA 3HP1A 5KVCA 3B78A 4G5HA 3BORA 3M89A 2IYTA 4MYUA 1I4EB 3S2YA 4KYUA 1L5HA 4D9IA 5JS2A 3T5PA 1QGUA 1AKUA 4PLHA 1QIDA 2ZIFA 1D6MA 3ZTWA 4CT0A 4Y7CA 4JELA 3WMWA 4MVJI 2VCEA 4Q1VA 3ZNOA 1XD8A 5FWYB 5JVDF 3GLGA 3L0IB 3RTAA 3TXXA 4YUWA 1T5BA 3VR1A 5HBGA 1RQGA 2ZWVA 4I99A 5IVKA 3D02A 4DZRA 4F12A 5K7SA 2CL7X 5FTKA 1GM5A 1W5TA 2P6UA 3M34A 2CJYA 5GGXA 2WWVD 1RBYA 2ZWIA 1WUIS 5CDFA 1OTYA 1HWYA 3FCYA 5CMLA 1ZCBA 4FOPA 4NCHA 4Q7QA 5I6DA 1R6UA 1RZUA 3JW8A 3UUGA 1D2GA 4AMUA 5FUYA 4EFDA 3T0FA 4II2A 3BQMB 2ZYAA 3JQAB 5JI2E 5PGMA 1TKRA 3F9IA 1UBGA 1DC4A 1TAHA 5UKDA 3JVEA 3BKXA 3OCXA 4NZNA 5TIIA 2WZBA 4LJRA 2H85A 4KGVA 3KM0A 1BQ3A 4AKEA 4IOJA 4YDSA 4Y1EA 1T26A 4MZDA 4J1QA 3MPUA 4BVJA 4XJVA 4LYEA 5E1OA 3W8RA 1PYDA 2OWDA 3EC2A 2I6XA 2NXWA 3RVSA 5MGBA 1AF7A 2VT2A 1IJEA 3WYEA 3C5CA 3EWSA 3ZWYA 2PWBA 5D51S 4W6ZA 4RTMA 5BRJA 1QIEA 3WE7A 1H42A 1T5TA 3L1HA 4C0WA 2PUAA 4XRRA 4L95C 3HMQA 2PBZA 4WH0A 2KS6A 1POWA 1VIAA 2HDNB 2MR6A 2C8VA 2YRWA 3AW9A 3ONWA 3Q9SA 1C4WA 3C4VA 2BM9A 2NYAA 3HWSA 4Q9KA 2CXUA 3AR7A 4HNVA 1ONPA 1OZ0A 3ROPA 5CFRA 3BB3A 4NC9A 4YR7A 2AFHE 1CNMA 2HA4A 1SHKA 2HSDA 4KTVE 4YV1A 2CYBA 5IXSA 3TECE 4UHDA 1LBQA 4EHIA 1R0RE 5TEVA 4CM9D 3LSTA 5B1EA 3ZHTA 5EGNA 2IELA 5FOXA 3QU9A 3WKAA 4E88A 1Z4IA 2DUUA 1QV7A 2R3SA 4H3KB 4LW8A 3SN6A 2GVDC 3TQTA 4K26A 3UK0A 4MXDA 3C48A 1JIIA 2YJ6A 4KVFA 1E62A 1D5WA 1R5BA 2LIPA 5ADHA 3DDUA 4EHAA 4IO1A 2WWTA 2KLBA 3GOQA 3K8OE 2BFDA 3TX2A 3R6GA 2BC9A 2I71A 2X76A 1E1LA 1WQ1R 4U2DA 2PL3A 2YV2A 1WDTA 1K8XB 1BH2A 4MUEA 3DNPA 4BUJA 1WUJS 4MYCA 1TM4E 1TC1A 2E82A 2ZXUA 4UASA 2BHSA 3PXUA 1BGXT 2B4AA 2GK6A 2VUIB 2XA1A 2D1QA 3M1LA 4IY1A 2IV7A 2C00A 2O7VA 2E4AA 3AHGA 5BSVA 3FDZA 1VBKA 2Z4SA 4RX1A 2GMWA 2O14A 1M2JA 5GZ1A 4BO4A 1NUAA 2AF3C 1SGWA 3KOYA 1Z83A 5ICFA 5CB6A 2R1TB 2B7BA 1GR0A 1P91A 2GAAA 1VL1A 3BRCA 3OPXA 4NESA 4WY2A 4M7RA 4CI9A 1U90A 1X7GA 4OMCA 5DWDA 1CUXA 2KI5A 4YQEA 3U9LA 1XMIA 4NZYA 1JT9A 4OXQA 2IXEA 2JHPA 4GQIA 3KJEA 2V03A 3EXHA 5TMEA 5JDCA 3U4QB 1N5IA 5AT1A 4OSOA 4P83A 2AXPA 1E6CA 3ZOKA 5FTJA 4ZI2A 4B6SA 1Q74A 1ISSA 5ENZA 3GHYA 1N57A 3DB2A 4BEJA 2EIHA 5FBHA 1SEVA 1HQKA 1TTHA 2PPVA 2WVGA 2ZE8A 1Z5UA 4DFDA 4HUQA 1J2RA 2ATXA 2FUKA 3LIPA 3B1JA 3S2UA 1KQGA 3K0SA 3JAMA 5DB4A 1YIAA 1D4FA 4CCSA 1IIRA 3WL6A 2CLOB 1WHSB 2HSJA 3FJYA 5IUNC 2NZYA 2I4RA 4B73A 2Q0HA 3DEJA 1KZGB 4N7BA 3I6IA 3O74A 5GINE 4QU9A 3CURA 1BMTA 5F9HA 2FETA 4BQPA 1EFLA 4R2XA 2IW1A 3PPWA 4AQDA 3WDKA 3L7YA 3BGOS 1CW2B 1CJCA 2UXCB 3GLFA 1OAAA 1WMAA 3F5MA 3ZYCA 1M76A 1J9GA 4PYIA 2OQRA 1PS8A 6Q21A 4HQLA 3R7WA 3VHXB 5JPDA 3BSWA 4CKZA 2H18A 2O8BA 3M33A 1WO8A 2F43B 4WBSA 5ARCA 3T3IA 4EVSA 6LDHA 4WPGA 1JEEA 1PQUA 2RGUA 4KB5A 5ELMA 5LN1A 1SOWA 2OOKA 2CMGA 2OT3B 2VDWB 1DQRA 5T64A 1Q20A 3ZDAA 4OQQA 5GGYA 2BFBA 3EA5A 2DUMA 5IAKA 3AETA 4JZKA 2Y1EA 2HCTA 1LDBA 2VDVE 2EBHX 2BELA 1Y1TA 1CFZA 5GPBA 2OZLA 3UBMA 2QT1A 2WZCA 1OLUA 4HGYA 1AMNA 1W4ZA 2R48A 3IEKA 5F98A 2IUUA 1R0LA 4PS0A 2JZCA 3EAQA 2GHIA 2C4MA 4KE7A 4N65A 4NAHA 3FWZA 4IJ6A 3HR8A 5EVCA 4UTNA 3RRJA 4LYJA 3SF8B 1U8TA 5TRTA 1TMYA 1ZD4A 4ZPJA 2GM3A 2BJWA 4PRZA 1UJBA 1T1SA 4NZ9A 4XM1A 2QM0A 1V5IA 4BUCA 3U44B 1D0IA 4YUXA 1NAIA 4K9SA 4DV4B 1V39A 4BP3A 2C1EA 3PENA 4IHQA 4MMZB 1X9IA 2C7VA 4N5IX 4XTCS 1Q0UA 4WLFA 4GWKA 3HWWA 3QPBA 2KLHA 2DTDA 2AZDA 4Y6LA 1BMFA 2GFQA 3MINB 5HF8A 4NPAA 4BNDB 3QLUA 5DBEX 3U17A 5EP2A 4GHWA 4GDFA 2OG2A 2FQYA 1XVLA 3W2IA 5T8KA 3OQNA 3SR3A 4AUNA 4KFCA 4KODA 4OHPA 1TAQA 1CPYA 4YUAA 3M2TA 2QJRA 2W11A 2QAIA 2ZE6A 1CS0A 3BRWA 4IDBA 4NFLA 2DTEA 4CKBB 1W19A 2ZXFA 4YJGA 4TLEA 2EL9A 1JV2B 2QMHA 4I3GA 3DL0A 3GJ6A 4NCXA 4G25A 2A1IA 3ZDCA 1ZK4A 4Q9DA 3TSOA 5G0UA 3RSSA 3B53X 4J2HA 2YIJA 1N5RA 4JI5B 3L6OO 1A9SA 1Z4QA 3D6VA 2YWRA 1IK6A 5HK9A 3VOAA 3OICA 4BFXA 1H8HD 1U1EA 3GEIA 2VYFA 1EGAA 4E22A 3AUSA 4IV8A 3K8QA 3PI6A 1F0KA 4J1NA 4L9SA 4X3CA 4MW9A 4UXIA 1JYEA 5AM0A 4ZWNA 4ENVA 1JB9A 4ADSG 2HUPA 2J3DA 5ALVA 2CJPA 1YFKA 2OO7A 1GJRA 2QLTA 1GCIA 5J4VA 3KT6A 5MN5A 4D9CA 2BJHA 2FQXA 4TMVA 2E4WA 1OBFO 2FRDA 1Y8RA 1W0KD 2QAJA 4GOMD 4PQRA 1DC8A 5CA0A 4C4AA 3KIPA 3BL5A 1VCIA 5AP9A 3ZNNA 4DHEA 5DM4A 4FBMA 2PS1A 2YDYA 3K0FB 4RM3A 1VE6A 4WNAA 4E5YA 3VU9A 2A78A 5CVUA 3GGJA 3PPVA 5F3DA 4ES6A 1GGJA 2FRXA 1M6YA 4HT3B 1YQWA 2FW1A 3E22A 3I45A 1IFXA 3AF5A 5BVGA 4AX4A 3IVCA 5AJTA 4GP9A 5HOEA 1GZDA 1Y9ZA 4GSLA 5KYNA 1K9SA 3M83A 2X4IA 3OE7A 5C52B 1CRQA 1SQ0A 5B1SA 3RYCA 4FXPA 3A3KA 3FOAA 5DH9A 3CEPB 5CJJA 2FY8A 3T1OA 3COSA 4C30A 3W7AA 3WMEA 1BCSB 3CZAA 1TAGA 5AIAA 3W8FA 4UU0A 1QWSA 4OATA 2OV4A 3D0OA 5DNYB 1VHTA 1XZNA 4INOA 4D7AA 3SOPA 3JALB 1CY8A 5EHQA 5HTKA 4BU0A 5IT5A 1PJ2A 1PZXA 4OJKA 5SZHB 3I5AA 5AXDA 2OXEA 1JR3E 2NU6B 2I67A 4JDUA 5HCNA 1F0YA 1VMDA 2FDRA 3X1YA 3RU9A 5DHSA 4PEVA 5DGCA 1VJCA 1M2GA 2ODWA 3I83A 1PUIA 5B57C 1E9RA 2R84A 2J1LA 2ZRQA 1L8QA 4KYIB 4ZPXA 1TKAA 1P7ZA 1QQ5A 4HB3A 3GNSA 3WQQA 4IH9A 3OE1A 1XJWA 3FZYA 1N8KA 4RKEA 4F1WA 2FW6A 4NV0A 4GEGA 4GWLA 4A6DA 4EK9A 4X45A 4EGAA 2L17A 4NJMB 4Q1AA 2I3GA 1BN6A 5K51A 3GDWA 2P0AA 4E5NA 1XDBA 4TL9A 4JA2A 3VR0A 2AZMA 4ZC1A 5JCXA 1IMOA 1ONOA 4CL3A 1DTEA 1NL3A 4UZFA 2RCNA 3USCS 3ZDQA 2HJSA 2E5LB 1X3SA 3PKIA 1ZD3A 4ITRC 5JZVA 3Q5DA 2FPOA 2JGDA 2IVFA 1DIGA 2VXCA 3T41A 6ADHA 3CM0A 5EWLB 1WDMA 1OWPA 2BFPA 3ACBA 3M5PA 4JKOA 4U2KA 3GJ5A 3L8YA 5EG5A 5F73A 5CX1A 2O8CB 2A88A 4I4TA 4D8YA 4DCSA 3PFGA 1XTQA 2QLBA 4RMIA 3AF3A 4IIDA 4CG1A 2CW5A 4PLCA 2MOKA 5AVSA 1ZUD1 3LLUA 2Y0BA 5BVHB 3G9XA 2WTUA 1LX7A 1T25A 4BMYA 2E18A 2OV1A 2R6GA 3NOXA 2ZRBA 2FPXA 2JEZA 3KJIA 3R0ZA 4HN2A 4LZZA 2OESA 4ATNA 3SS7X 4AWXA 1ZIDA 4EG3A 4QQKA 1CZUA 4C7BA 4H0CA 2YHSA 1E3WB 4KLRA 2LVBA 4PC7A 1QR6A 1U3DA 1ZK0A 2D2IA 2FW0A 3JYNA 2R1VA 3TOSA 3ZU4A 1H93A 3P97A 5K0JA 4TKLA 1Z7BA 1RMTA 3FPEA 3OJCA 4DA7A 5LMCA 3U5ZB 1PN3A 2GYVA 2VHQA 3EEIA 2KX7A 1NF3A 1RYYA 2ZT8A 1RWOA 4FGJA 4C07A 5KPDA 4BNHA 2V5AA 2EQ5A 2R6JA 1KZYC 2J9ZB 1XRSB 3MCAA 4I1SA 2Q2WA 4OM8A 3MQ4A 4RUKA 5G3ZA 4MX8A 4TMKA 1JQJC 2Y93A 2ZDGA 3MXTA 4GZ3A 3RYIA 3ZCVA 2XAUA 3FRIA 3S55A 1Y9AA 2WSSA 1PT5A 2O48X 3FUXA 1U0JA 1X38A 3HACA 2GF0A 4TRJA 1OXXK 1QLWA 1R4NB 1E4EB 4WLEA 3NU1A 4MB6A 1NXSA 1LF5A 1QZTA 3I1IA 2C8LA 4Q16A 4UXJA 4WE3A 4CM1A 1HTTA 2M32A 4FTWA 2FHPA 1I7PA 4OHUA 3VH4A 4DLUA 2VDQB 1SR8A 4LZAA 1MAVA 4JK3A 4M22A 1PJRA 1A8SA 4I0WB 1FX1A 4ESEA 3KVYA 2Z57A 1JNYA 5C3UA 5CA1F 3IAM1 5FBKA 1V7PC 5K5EA 3ETLA 1CD5A 2AE2A 3PR2B 1LPPA 4TLDA 3UB4A 3A37A 3OCVA 4QU5A 1FFCA 4LF8B 2CE2X 1ILWA 1CX9B 5CH8A 5EUQB 4X65B 1JDVA 1GOTA 1NG1A 3RFCA 3B9RA 2AKYA 1U7DA 3C70A 3PF9A 4L8LA 4PV7A 4WA8A 4ZCMA 4Q34A 1IG3A 4OBXA 2XNJA 2R2GA 3MUFA 1RBZA 1U7ZA 1TPYA 1EA5A 1PF7E 2A67A 2E6KA 2PZKA 1MCZA 2REBA 3BXZA 3MELA 4NULA 2RC5A 4P84A 4R1OA 1LWNA 4WDQA 1Y3IA 1UJ4A 2ONCA 2V6JA 5F78A 1Y34E 2A0YA 3SR4A 2G63A 4ZOQI 3FMVA 4YP7A 4HPWA 1O8BA 1P18A 3ZJVA 2VZ9A 3ZX4A 2IKSA 1JHQA 2XRYA 4XKJA 5BXQC 4LF4B 2CXSA 1YL5A 2KWIA 4GOND 1GNQA 4EI7A 3ZW7A 3VV3A 3ZH9B 3FB4A 3CYFA 3F4KA 4QBIA 3RKUA 2IHZA 3IDSA 3OOJA 2WIAA 4YWHA 3UQZA 4LZWA 3VKGA 1WU8A 4MR7A 1G5IA 4ZD6A 1NBWB 5IBCA 3LT1A 1MH9A 4I55B 4ZZIA 1E2PA 1M2KA 4KSYA 1KO8A 4RCYA 3I9V1 4LJSA 4NJOA 3HA2A 1S3GA 2B6NA 3L84A 3VZQA 1GL7A 1XQWA 3VA7A 3DKPA 1IN1A 4EKEA 4C87A 3W5VA 5KNCA 2VBFA 3CLTC 3AK4A 4UCFA 5E6SB 1ZRHA 1WTAA 2BP7B 4QPZA 4Q48A 5EUCA 1DTWB 3Q8XB 4MITA 1APBA 3CONA 1UDWA 3RJ5A 1RZRD 5GOTA 1BWQA 2NO7A 1WKVA 3CW8X 3NNNA 5DHFA 4DMMA 4NYJR 1X42A 2H63A 1M1UA 2QV7A 4IMJB 1FFSA 4Q0MA 3TXYA 3HP4A 2ETVA 2GNPA 5AVRA 2XB8A 1ZQ9A 2JFVA 1XL1A 3I3OA 4JMLA 4NVRA 4KSCA 2HZ7A 1NUHA 5AO9A 2FTKE 4YP6A 3VDNB 2R8BA 5AVQA 2Z6AA 2ZT5A 1YT5A 5A4DA 1MIOA 2ETXA 3RTGA 1QAMA 4EPYA 3ZGZA 2GKOA 3OP1A 2NVOA 2PLWA 1RKXA 2VJDA 3LPDA 8LDHA 3C6ZA 4GX5A 1TT7A 4FFWA 3IT2A 1W6UA 1A5TA 3USZA 3ZXIA 4MJ7A 4ND7A 2UYGA 1HZJA 3EE6A 3OLQA 4WKNA 3IT1A 1T8TA 3MRXA 3O9MA 3R3YA 2WKWA 4Z9XA 4QRDA 4TL8A 3FTQA 1OROA 1CR1A 1IVNA 4NFSA 3GEMA 4PFJA 1SC9A 5H68A 2R8OA 2DY0A 3RKRA 3Q7EA 3SQMA 4NL4H 4P4NA 1ILEA 3R5SA 1XNJA 2FVYA 3GBSA 4C5CA 1IQPA 5CVVA 1SUFA 3SEQA 3Q9NA 1COZA 1Q7RA 3CC8A 2CSUA 4OOEA 2P2CA 3UV6A 2XUQA 1LC0A 4E5VA 3JQQA 3ZUGA 3C3KA 4ZU3A 4QGHA 1BMFD 4MNTA 4F04A 1R0SA 5JDIC 4YMUA 1MENA 4FGZA 4BFVA 1MVNA 1XUOA 2B5VA 4F9GA 4BLSA 2X19A 4LRSB 3O4VA 4BASA 5K0FA 3CLSC 4MW2A 4NYIQ 1EDBA 2I2AA 2AKEA 1ZGJA 4YQZA 1YJCA 4TM7A 1GZHB 4MKIA 4RPIA 3H16A 3DZDA 3V5NA 1T5SA 3BRWD 4Q7KA 1GUDA 1TF2A 1KP9A 3BF7A 5FA5A 3GXBA 3QMWA 5F77A 1NYTA 3L77A 1P4AA 3MM4A 2J48A 2B69A 1KH3A 2A0WA 4DZTA 4F91B 4L07A 5TGDA 1H2RS 3ZCRA 1LU9A 1OBHA 2NU9B 2GOYA 3D4IA 2NUAA 4JQYA 5J47A 5FRDA 1RXWA 2ZUVA 3BREA 4NAUA 3IJRA 3GCXA 1ZNYA 1P4JA 3BL8A 1WJGA 4BLOA 3ZDBA 3WKCA 2AN1A 4CHGA 3ZGNA 2BMFA 1ORHA 4G8JA 5B12A 2YYZA 4XJXA 3LFTA 4LOIA 4RV9A 2QVBA 4LFBB 3CCBA 4MRSA 3QWBA 4BQOA 2Y0DA 3V6MA 5C53B 4K1XA 2C2KA 3IP5A 3BUSA 2H2AA 5CCDA 4B45A 3WNDA 1FMJA 5AW2A 5KKCA 3OIDA 2QORA 4QOSA 4BO9A 4BQEA 4LGVA 3R7SA 3NXKA 2O50A 1W8IA 3HYTA 4JEIA 4P9NA 2O4CA 4R98A 1PGNA 4HJXA 3RRNA 1GFZA 3DOHA 4TYYA 3SY8A 4M9SA 3SBOA 3SMQA 4O6VA 4DTIA 3EA4A 3A2KA 3P9ZA 2VHJA 3S2EA 3WLNA 4YAGA 5AW3A 2B8TA 1KDPA 1SIOA 4DADA 2W22A 1NJ2A 2CNOA 1FFWA 4X54A 3DG9A 4B87A 1WL8A 5EEHA 2C42A 4C3VA 3NTXA 1WB9A 4A0GA 1GGFA 1K6JA 4U4AA 2TECE 1O9BA 3HJGA 2F55A 5CLHA 1MUUA 1RZ3A 2QZZA 2BGRA 1IBMB 2XITA 4JB8A 3ROTA 4OHXA 2Q4RA 3OOEA 2VF8A 1AKWA 1EQ2A 3H5IA 5AFSA 4RCZA 1M1YB 4L08A 3OEWA 1TU3A 1GA1A 5BT9A 2EF0A 4LC9A 3I61A 4CKWB 3ZU5A 1VJGA 3LC7O 3OZIA 1TE2A 4Q1FA 1IZ0A 4XYLA 5B6JA 1GQSA 1LEHA 2DBRA 3DHYA 4F60A 4YDQA 2XGJA 2OCGA 2CVHA 4XWAA 5REQB 4L22A 1R8QA 1UPCA 3D7SA 2OGWA 3NJ4A 1BS2A 1XTBA 5E95A 2GPWA 3GXOA 2FPKA 4O1HA 4BLVA 1N7IA 2YV5A 5AW5A 3EPJA 2PZEA 4PZ9A 2ZFUA 3S2ZA 3R09A 1U2GA 2AKAB 4YBZA 3GUHA 4BGIA 2J3JA 3S6JA 1MA0A 2XRFA 3OM1A 3VO8A 4C22A 3RVMA 2PRSA 1XZFA 2HRQA 2JH8A 4TROA 1KJ9A 3S4YA 4IOKA 3TAHA 3CNHA 1G98A 3TS1A 1A0OA 2IL1A 3HB1A 5B64A 4GPBA 3GQBB 1OF1A 3QXGA 4ZTBA 3RIYA 2WFAA 2Y68A 1U0RA 3KBOA 3QBTA 1I6WA 2IYNA 3DL4A 3WL4A 4D9FA 4ARVA 4L3VA 2P5SA 5HVNA 5LVAA 3DMGA 4UKDA 3F4BA 5TE9A 1KJ8A 4B3RB 2ZYVX 4M6WB 2L69A 1C0PA 1EWKA 2BFEA 2OZVA 3HE3A 3KVOA 4NCBA 3LH5A 4CVNA 2V7QA 2XPCA 3DEFA 3LCUA 4R1TA 4B76A 7GPBA 2WG2A 4N8DA 4QFBA 3GJYA 4P93A 2FFBA 2H4FA 3GNTA 2NSHA 2VWHA 2YDXA 3PXEA 2OL4A 4XVQA 2VP9A 1NN0A 1G59A 3GLHE 2FMHA 2VSXA 1E6KA 2J46A 4S1OA 5A4KA 2OCDA 2EERA 3K70B 3EAGA 3TXAA 4P36A 1E7SA 4Y1RA 1GGHA 3LRPA 5FBQB 3M7IA 3U4AA 3IIJA 1BXRB 1QF6A 3BK7A 1I2MA 2BEWA 3KJHA 1YASA 4IV0A 5DLQC 3V4ZA 1NFRA 1XFAA 3KTOA 4DM4A 1CU1A 2WYWA 2CNLA 5G4KB 3L4JA 1Y80A 1YJBA 1YZTA 2WHPB 4PZ0A 4JP5A 5HCIA 2G0NA 2XE4A 4CW7A 5JFTA 3FHTA 1T8RA 4BTEA 1OCEA 2NPOA 3CH6A 1WUYA 3IILA 4MRNA 4ZZ0A 3D7RA 4OHMA 4R6XA 4PCUA 1GZ7A 1RPNA 2PS3A 4HH0A 1XMSA 4Z86A 2QSZA 1QPZA 1P29A 1UFRA 1N7HA 2IUYA 4G4IA 4GR4A 1VRCA 1RPZA 4ZYWA 2VJPA 3BYZA 1MJFA 3H19A 1N2SA 1YVEI 4POAA 1C1YA 1W35A 3TQIA 1IHUA 3R9KA 4YRCA 3RBVA 4O5OA 5JXGA 2BM1A 3IHLA 4EPXA 3NIWA 3NTRA 1N32B 1XZPA 4GZ5A 1OFVA 4TS3A 3HU3A 1UK8A 1VPEA 2ZB7A 2ENUA 3NJ8A 3PGMA 2G6BA 2GPAA 3A0UA 4G0ZA 4QYSA 4I9UA 5JEEA 1NTOA 4I4NA 3SKXA 1ZR4A 2C7GA 1VFNA 2Z1DA 3HR7A 4J16A 2IK8A 1XRNA 2PMWB 4HQ0A 5A7HA 3N3AC 4LDAA 5CK5A 5BW6B 5BSKA 4GVPA 1PR6A 4KDRA 1SKYB 2IYXA 1G8AA 2Q1WA 1U8XX 3FPAA 3W34A 4YRSA 1PNVA 3OZBA 1K3UB 1ZOLA 4GDMA 3PXXA 4FFVA 5ALSA 4C4ZA 1KY3A 1WP4A 3S40A 1ZC3A 1PL8A 3AV3A 3AUJB 4ZHQA 1H4SA 2YXEA 3N0RA 1Z3CA 3EN0A 1KDZA 3FVRA 4PG8A 3R44A 3DMYA 3RLIA 3U7RA 2OKGA 2ZCVA 3EMKA 4FX2A 4G5OA 2UZIR 3R0JA 4BNYA 1DMRA 4D25A 1JDTA 1SKAA 4I8IA 3E9CA 3JYQA 4RZXA 4F45A 1XJCA 5JY1A 4P7FA 1J7KA 2K87A 3QZUA 4KLCA 4J9VA 3LXMA 4QBFA 4KJZA 2KPOA 3L4KA 1UJCA 3NVAA 3PC7A 4LYHA 5FADA 2OLKA 1MG5A 4BB0A 2GZ1A 4LXIA 3CR7A 5P8WA 2IOFA 2WSMA 2FB9A 4BMZA 4BCBA 1A3CA 3U39A 5JRZA 4Q9AA 2GBFA 1KSGA 4JLOA 4E4RA 4F9TA 3HY3A 3T9EA 3CLHA 1P6XA 1WSBA 1R3UA 4J8PA 2HA7A 3VMFA 1I0IA 1LLFA 4FKMA 2VLIA 2FPIA 3IUYA 5EKXA 3RJTA 4L57A 1H0SA 1T9GS 2OXTA 1P7YA 4U6SA 4DJEC 4DCNA 3KV1A 4P33A 4RW0A 3IE1A 5BMVF 1W47A 2OBYA 1KDVA 2Z6VA 3HJBA 3NHLA 3MAJA 4GOXA 4AG5A 4IVQA 1TEVA 1BH6A 3HKBA 2VRBA 1W29A 5EIWA 3GJ4A 1XXHA 5HF5A 5SICE 2PRJA 3G8AA 3AB7A 1GTMA 1J33A 1NZFA 3FTFA 2W37A 3G13A 3L6EA 5BXYA 4FN4A 4FYIA 4G1EB 3NPMA 4US0R 1KDOA 3DWEX 4WACA 3K09A 4QDTA 1Y82A 1WE2A 3SS8A 3CUSA 3KQVA 4P54A 3EAFA 3RSQA 4GPIB 3TQQA 2DP4E 5CVEA 1H9BA 3IEVA 1DCMA 2DPGA 4H77A 5JDCC 1JG7A 5IANA 4XW2A 3EXHC 2ONZA 3AUUA 4L5BA 1CUVA 2D0IA 1RYEA 3HNOA 4JUCA 1IHOA 5JTTA 4YP0A 3BH0A 2C7QA 3CPSA 4NDAA 1G1AA 4FOSA 1YVPA 3B9BA 3CF4G 1F4PA 2XXAB 4MRMA 4JLSA 2JB9A 3I09A 5IDWA 3BJEA 3VJRA 1DVRA 4YRLA 4H7EA 5ED4A 4L4ZA 1UXIA 4CCYB 5DSZA 4DF3A 1ZHFA 5M04A 2BZGA 4KBYA 4YJFB 1LW7A 1GNTA 2W6CX 1E3DA 2GJKA 3AEUA 1FFDA 2QR5A 3QHQA 3H3JA 3LVRE 4HDKA 4N6GA 4JNCA 5DSXA 3TTVA 4R1UA 4DYDA 3TZQA 5DHQA 5BMOA 4LDNA 2QRJA 5DZSA 1KGSA 3L0PA 4PANA 1Z7YA 4RVHA 2ZRLA 4Y6QA 3DLBA 1SK9A 4H7FA 5BPFA 1YKSA 2FPGB 3IR5A 3QU2A 4BNWA 4R8RA 1RRMA 3EUWA 1P1CA 3QKSB 2FN3A 4CODB 5DRYA 4D0GA 3V2IA 4MTCA 4PSUA 4FBGA 1GT91 3GZNA 3V8MA 2QLLA 1G20A 4BLUA 1Y0BA 1E9FA 2WJHA 3ONVA 3PR1A 4S2EA 4WXYB 3F74A 1KMNA 4XCQA 4F6RB 3BD6A 3KOOA 5CLIA 2F00A 3QVVA 5AOAA 1GFWA 4HB4A 5EMLA 5JI3E 4MV9A 1ZI8A 3E5RA 4F8EA 3QU4A 1ODSA 3V55A 4MR9B 1RHRA 5DX1A 5IYZA 1CY0A 5JNSA 2AMLA 2OCYC 3PBKA 1GTG1 5EHXA 1WCYA 5KYTA 2W48A 4FC7A 4Y1FA 2CMFA 1CRZA 1I1OA 1UXGA 3ECSA 3QEJA 4RA6B 1QKIA 1RHUA 1Z8HA 3L7JA 2VZ0A 4QIHA 5IABA 5JAPA 3MMNA 1IHYA 3H04A 5BWOA 4YP9A 2QMOA 4MI9A 5CB4F 4ACAA 4FFBA 3AUTA 3RRXA 2CLHB 6REQA 4MQLA 3FYDA 5HJEA 1ZAKA 3KPJA 4JBNA 4ZOLA 2R6HA 1GGMA 1U3CA 1VA5A 1UKZA 4MW4A 1QDLB 1Z8NA 3WB1A 4UHEA 4E30A 1DQNA 3WIBA 3OKPA 3MTJA 3ND5A 1T3ZA 2VF5X 3HA3A 4V03A 2GHRA 1FDWA 1NV9A 2CNDA 1E5LA 2C3UA 3RK4A 5JO0A 3JRWA 1VGRA 4MS3A 2OE2A 1T2DA 2B4YA 3TD2A 1X1BA 4FEEA 4R0MA 3LUGA 5B7PA 4YXWD 5FX2A 2NV2B 4LZJA 4V3BA 3QYJA 5ALUA 1YB7A 3QTTA 3F9RA 4KVZA 2ZM5A 821PA 4NECA 3QLUC 1VE1A 4EKGA 2SHKA 1T0HB 3ORYA 2AX4A 3DGFC 4IXDA 5T8KC 3H1TA 2WG1A 3PEVA 1V5EA 5C8XA 2A58A 5DEIA 1P7VA 3P9YA 4C1BA 1XNRB 3JYOA 1YDHA 1PZFA 2RGGA 3CZ9A 3KEQA 3HA7A 5LKAA 1OWMA 4IIGA 3WB9A 2P6OA 2CUKA 1YGPA 2GEJA 4RFLA 1JU9A 2X1HA 2FHSA 3H86A 5KMGB 2QX7A 4HC4A 1UDCA 3T38A 1JN0A 2ZREA 2XB4A 1K06A 3A25A 4ZMSA 1DRVA 4PPGA 4HDQB 1F6BA 4KQWA 1SQGA 5AHWA 1X92A 3D6UA 1ABBA 3A1WA 2XZOA 1VI5A 2EFEB 2ORIA 1RLTA 1DV2A 3IURA 5JC1A 5AQEA 3UAOA 4QUDA 1SUPA 2K7FA 5I8ZA 5JD5A 2X5JO 1UOEA 3HVKA 3LPLA 1EZ1A 3VKWA 2Q6OA 1PKXA 2FRDC 1LLUA 2DHRA 4YX9A 4R81A 5FJIA 4Z7NB 4KK3A 2ALJA 4P3XA 3OPYI 5HR5A 1P2BA 2WFLA 1FW8A 2CN1A 2Q0XA 2H1VA 3FGNA 4GUAA 5JASA 5LFAA 1NSTA 3WGTA 4AJOA 4LHXA 1EZ4A 4UE6A 3ZV7A 2IH4A 2OCKA 1V7ZA 2V7QD 2NTYC 2ODBA 3BFXA 2YWXA 3RSGA 3IVAA 5B1DA 1XX6A 1JFSA 1P5HA 3EYAA 4WZAE 2X6TA 1N2IA 1Z06A 2CMDA 3Q87B 1XJ5A 3DNFA 3ESYA 4RK7A 5EIFA 4Q7MB 1PU2A 2B1IA 2VS1A 1S7GA 4W9RA 4BZPA 1Y6QA 3IAAA 2X8JB 4I4IA 4B7UA 3CHYA 4ER0A 1C7JA 1QQBA 3DLIA 2UYOA 2ZYDA 2DSNA 2PU7A 3AU8A 5H70A 3S0JA 4D9EA 2XJ9A 5CB0A 3A6KA 3D8UA 3R0IA 4OXNA 1D3AA 2WVJA 3LVFO 4HVTA 2OSBA 1WDWB 1J2EA 2FFQA 1E5XA 4P58A 4R84A 3TLCA 4EZEA 2PE5A 2BEVB 4NZPA 5AW7A 2AEMA 2P62A 3DV9A 1MF7A 4QXRA 1T3SA 3ZHYA 4L9AA 1AURA 1CDDA 1NNLA 3WGHA 3EVBA 1DKLA 4YACA 3PLAE 1ODJA 5FA8A 1JXOA 5C46F 3VHRA 1FVXA 3L1KA 2GYUA 4DIEA 3ZGLA 1JEQA 5IT0A 1THMA 2FZKA 1AKRA 1Z39A 1DKUA 3H6HA 3S3TA 1KS2A 4LJAA 3ZGOA 1G55A 1UIMA 2GZSA 1XI2A 1KNXA 4IIFA 3ZQ6A 3DF9A 5K3FB 4IEIA 3A32A 5IVIA 3IUPA 4GE3A 4P4LA 3LQYA 1F5NA 4K46A 2R86A 1XCMA 3T5MA 4JEUA 4WOPA 4GL2A 1MR3F 2JAHA 1MJGM 1JVSA 4BFZA 4EAQA 3AHFA 3H9UA 1I9CA 1ULHA 3ANYB 1ISIA 4MP8A 2CCGA 2X14A 3N0WA 1GRNA 1UKAA 4Z4CA 4IW3B 5E8RA 2QTHA 3PDIA 3PUVA 3I8OA 3E2IA 1L7NA 4EJSA 1GZ5A 3E81A 5FPKA 2D0OB 3UMSA 5KX5A 1FUIA 3ZGYA 5H1YA 4KWTA 3VNAA 1ZLXA 2COKA 4MKHA 2O20A 2QRUA 4WLOA 2WUGA 3KLOA 4HGPA 4Q47A 3OPMA 1CB7A 1FS6A 4L0DA 2P0EA 1E61A 4A15A 3ZHBA 3H83A 2O23A 5B3KA 5A06A 1I3OA 4A6XA 2YHIA 4Z4GA 1A82A 3HR4A 4W9MC 5A3QA 4RH3A 4WLVA 3BMOA 1KIMA 4B6FA 1QYRA 1JBKA 1O4VA 2FKNA 3U0VA 1PGOA 2R47A 4DMUB 4P2BA 3AW8A 3VSAA 1XU4A 3P19A 4MH0R 1XKTA 4NBTA 2QW1A 1T2NA 1WMDA 3MOSA 1XTIA 2JHGA 3M70A 1I7DA 2ID7A 3D2AA 1SCUB 4FOOA 1Z07A 2ZDHA 1CERA 4QTZA 1DCFA 5EKUA 4A91A 4ER5A 2ASEA 3IKVA 3O92A 3IAXA 3FUCA 1SJ9A 3PNKA 4W5HA 4F21A 5KJ1A 2X4DA 5KYYB 1QTQA 1CEYA 4UE3S 2QVCA 4OLJA 3ZG6A 3TL3A 5EMJA 3D6HA 3EVDA 4YLEA 2YZ7A 1YK0A 4MULA 5FWNA 3VR5A 1X7ZB 1Y7PA 5AD1A 1M9NA 2BMDA 2IZ5A 2ZBQA 5HIAA 4UHKA 4F2WA 1O4WA 2GS9A 3JZIA 1R8XA 1WCV1 3M1YA 3ANTA 1CNEA 1E2NA 4YPFA 3SYLA 4EMUA 2YXNA 4NAVA 3E8XA 1PFVA 2AMVA 3IEIA 4JL8A 5K20A 4FMBB 4NARA 4XYEA 4NK5A 1C1DB 2DXIA 4DDMA 3PJDA 3DA8A 4Y9DA 1TCCA 2ATVA 2ZYSA 4A7PA 4DAEA 1PR9A 2ZITA 5AM2A 3JQ7A 3KB2A 1JRLA 3IBFA 3DMHA 3TLGB 2ZUTA 1NI5A 4EHBA 4F5ZA 4MRAA 2QTBA 5FUMA 3V3KA 4O2BA 2I4TA 1M2VA 2INGX 4BX0A 3PKJA 4HQFA 1WR8A 3WO1A 5JXJA 3H9GA 1BW9A 5DU2A 5G0VA 1P5ZB 3I8XA 1O95D 4JJEA 4DT1B 1H6CA 4Z0PA 1VGVA 1DX4A 3D8BA 2IV2X 4YMLA 3OTOB 5L3QB 3E1GA 2O3RA 1GTL1 1ST2A 2WP8J 4GW3A 2HSEA 3GWZA 5BSUA 5MF6A 1E79A 1MRZA 2W2MA 1U5BB 3LHIA 1VMAA 2WBLC 1OZGA 2RH5A 3CMCO 4X64B 4YRNA 1M2OB 1JFFA 2OAGA 2BMEA 4EVRA 1LJ8A 3Q5EA 4EPTA 1YS4A 5CFMA 4J94A 4CG3A 3ANXA 3DMTA 3GJQA 3IVGA 1TM3E 2AOUA 2X0KA 1BJTA 3QOYA 1QLJA 4RJIA 5KB3A 1D8TA 4TMWA 4UUAA 3V80A 5IJXA 1NC3A 2P35A 1K5HA 2QL9A 3I23A 4AS2A 3HN2A 1DLJA 2EZTA 3F8TA 1SBHA 1VYUA 4A6EA 1SPBS 2PKYX 1TCUA 3F8WA 4DXHA 3LYAA 4YT4A 4YMSA 3S1AB 3D6FA 3LY7A 3GGDA 3AVPA 4ICIA 4D9JA 1T2VA 4MWGA 5FBZA 2NSDA 4W6QA 4AJ2A 3KKPA 3H8WA 1KEEB 3RHFA 4AIIA 2ZSKA 4B85A 2J87A 2X2FA 3DFKA 1RYZA 4JL5A 4Z9YA 4RMGA 3WRYA 1IH8A 1VPWA 1NW7A 2P0YA 1AKMA 2VVTA 3G6KA 1ZD1A 4E09A 1U7TA 4BQRA 5DHTA 3ZDRA 4BLPA 4B7ZA 1YK1A 5JAOA 4KN5A 5LQCA 3QEBZ 4OLFA 4X1KA 3RE1A 1K7XB 5LYJA 3EIXA 1NDQA 1WB6A 2QZ4A 3UW3A 4GS5A 1UJMA 4UXHA 5CA1A 1VHQA 3ICPA 4UDXX 1Y3HA 2O8VA 5COBA 2HQ1A 4OY3A 5IARA 1T9AA 1YE3A 3ZD9A 3CUEF 2KYRA 1VHLA 4WBXC 3L41A 4HFNA 3LOPA 4UUOA 4TZTA 3C1AA 2D6FA 1WDLA 4X85A 4V0MA 3WBFA 3CJTA 4OXKA 4M1OA 4C43A 4XGNA 4UE2A 4TKVA 4KNWA 1H9CA 3D6NB 2B99A 3G5TA 1IE3A 3A1CA 3Q3JB 4X9XA 3BFJA 1T1IA 1RAIA 4B79A 4CEIB 2O1XA 3C5WP 2NUBA 2QUZA 3D8NA 4CRWB 3U3DA 4A0QA 2IWHA 5C8DA 1W85A 2FE1A 1H3FA 1X70A 5HUHA 5B4UA 3CW2A 3AFHA 3C3DA 3B12A 5FTNA 1JG3A 3AVQA 1V1RB 3GZ4A 2WLSA 3ITEA 2C2MA 1DARA 4OEHA 3UFXA 3ZDZB 3FTEA 1FVFA 1XDWA 3KETA 1N6OA 2J4FA 1JB1A 3H6KA 4LTNA 1NQAO 3KLMX 3S7TA 4MGHA 4GMHA 1HEIA 3B1ZA 1L3BA 2B35A 3Q0TA 1SC3A 5PNTA 3TW8B 3PD0A 5DI9A 4DNQA 4QOEA 5ITZB 2C5GA 2H5JA 3ROEA 2X5KO 3TKAA 2IKQA 1R6AA 2G5TA 4L5IA 1RNLA 2F1JA 4PAOA 4MVJG 1O57A 3AFMA 3NQ41 3DW1X 4URZR 4CMKA 2JCVA 1J2TA 2OP0A 1E7YA 4I4CA 4N54A 1YHYA 2H3EA 4LDJA 1UPXA 2VXYA 4X71A 1SU6A 1RD4A 5J23A 3T3PB 4M4SA 2AUNA 3AF4A 3ZQJA 2NVBA 5LP6F 3FOCA 3FAKA 3M3HA 2VYCA 3H5OA 3OZUA 1AVTA 4G67A 4EF4A 5GQSA 4YCSA 4J75A 4BJHB 1A8PA 5CRIA 1XZCA 1IB6A 4K7JA 1W9MA 2WB2A 2WP0A 3EGDA 1N3LA 3K0CA 3NCHA 4JOQA 2ORWA 4OKNA 1WSAA 1TQ4A 1U0LA 1BN7A 3HI4A 1DZ3A 1E3SA 2YJ4A 1SXGA 1TZ2A 2ZWMA 3OZVA 1P1IA 3W5AA 1DDIA 5DCWA 2OZEA 4W5OA 3L6CA 1Z73A 1AKNA 1YAHA 1PLJA 4QUBA 2EC5A 1QOQB 5DT9A 3WWCA 3KSUA 5GMOA 3Q3HA 5KU7A 4U1RA 1NUSA 2NN3C 1PZHA 3AR5A 1RXSA 3DEIA 3PNYA 4ONEA 1HKUA 4UEOA 2Y1KA 1E9CA 4RENA 4DDUA 2G6TA 4HDRA 2G9VA 2PX4A 1SNYA 2WU1A 1Z2DA 2ZIAA 2Q5IA 3F78A 1BYUA 2J07A 5KVSA 3KL2A 1ZRNA 2DE0X 3VPBA 3WGGA 5CFPA 1TMKA 1UMBA 3BE8A 1F1BA 5LBUA 1U63A 5IS2A 3MWGA 3FTPA 2EOAA 3FZQA 5K0LA 2AVNA 2PKQO 3EVTA 1TW2A 1U2SA 1YA4A 1VG8A 4RZUA 4YJ2B 2CXQA 5D1HA 5LLTA 4MI6A 5IBPA 1Z4NA 4O8CA 1UMKA 2V96A 1Q6ZA 5I9SA 1U28A 1U2GC 2UVDA 4G97A 4IEEA 1IM8A 3SEAA 3T0GA 4BCDA 1Y8CA 4ZZ3A 2AJ8A 2CUTA 2HREA 5IKOA 3BE4A 2E85A 3FUWA 2E21A 3NC0C 1ZD5A 2ZRJA 4ALMA 4B2PA 4BNGA 2ZE7A 4W4TA 1RI3A 1YBAA 3IAHA 1B0UA 1II8B 1ZC4A 2D59A 1KQ3A 3GRVA 5H9WA 1C9NA 1MNAA 1G4UR 3GLUA 3QPAA 2IQ5A 3IUSA 1J5EB 1RRCA 1XJ0A 5KOHA 3T15A 2WF6A 2Q2OA 4Q9NA 3PE6A 1C80A 2I7DA 1EXDA 3PWTA 4FKZA 3SBDA 2RAFA 3ECAA 5G0SA 4V1CA 4W5NA 1PBNA 2O9JA 3H4IA 3H1AA 3GPBA 1VYVA 2BTOA 4DGQA 5JNWA 1QVWA 2Z8YA 3E48A 3HEAA 4QAQA 1OLXB 1U2EA 5A9SA 5K99A 1A8UA 4LXHA 4WJKB 4ZMRA 3F46A 3H7AA 3PLNA 4UOQA 1AQLA 3X0DA 1LPMA 2ZPUA 3H0CA 4JC5A 2BRUA 4JLMA 4QATA 1XA3A 3JATB 1OYYA 3L8GA 4QREA 4UCXA 5AVOA 4OHYA 4GT1A 4CG0A 2YWJA 1RYNA 3GFOA 1UT8A 2C3MA 1KFCB 4U7HA 2VK2A 3PNOA 4Z0NA 2VNHA 2HMTA 4CM6A 1DIAA 3FD8A 1K3TA 1QYVA 3EDMA 1G7RA 4YRBA 1ZD2P 2FV8A 3RQIA 1VJ1A 4YCDA 4W7IA 1W2HA 3ZWDA 3V8EA 3FPLA 1J0BA 1T1EA 2ODPA 3B82A 2UV8A 1W4AA 4F4JA 2PCLA 4Q3BA 2D0DA 4J43A 2CLDX 1E4YA 1G9TA 4JY7A 4M7OA 3M6FA 5CG2A 4OG2A 1DKMA 1PJZA 1FTQA 2CB0A 4FQ5A 4DMRA 4AYTA 1H69A 2XOXA 3LK6A 3ZX5A 3UMGA 3SDZA 1UBLS 4RF4A 4QG3A 3ZXSA 3C43A 4YRAA 4BNTA 2E6UX 4ARZB 3EQ8A 5DCUA 4HGZA 4Y6RA 1HR0B 4JBYA 2VPXA 3WMXA 3HWRA 4NFYA 2HPZA 1YJQA 1Y3BE 1D7OA 2K7ZA 2ZOSA 4M88A 2CDRA 1UWKA 1Z5OA 3A0RB 3WK8A 4NFHA 3ZWWA 2Z83A 4EW1A 2IYQA 3GGGA 5FPPA 1W88B 1R8SA 1E2KA 3PUHA 5C7LO 3HS3A 2X42A 5B30A 1DXYA 5AK0A 4Z4HA 1P3Y1 3D3WB 4TS1A 2ACVA 5LMUB 2P9TA 2FR8A 1KKUA 3OJLA 1A9TA 3FYUA 3OKFA 1ULTA 2XUJA 4V0SA 4LE2A 3UICA 2G04A 4EWLA 4YT2A 2W00A 3RWBA 4J16C 4QNNA 1U0TA 3ZCQA 5A5EA 2LBPA 4H0NA 1YD7A 1R8YA 2HMVA 2IUEA 1BVYF 2Q50A 3QVSA 2C3PA 2QTWB 4IZOA 4MW7A 2AC2A 4QZVA 2LV8A 4WBNA 1AHPA 2PX6A 3PDWA 4IHJA 5I8WA 4YRJA 1GL3A 2JLQA 3DP7A 3DUFB 1O9HA 3Q1KA 1QHGA 8ADHA 2YZNA 5BWNA 2BUCA 2DCMA 1R64A 2OFXA 2YC2C 4RD2A 4A73A 1NXWA 4C3ZA 2CUNA 3T7AA 1E79D 1PNQA 3EOAI 4IWNA 3PTZA 3CLUD 4FFDA 1DTSA 2AVDA 2JCXA 1HL7A 2XOEA 1FDRA 3ENKA 3NBXX 2BFWA 1Z6AA 4QECA 3STYA 3L01A 3UPDA 3PD1A 3OZCA 5EQJB 2A84A 1CUUA 3ESDA 1WZEA 3RUFA 4HMQA 1PGQA 3C16C 4OFWA 4S3MA 4HQOA 4XSGA 3TLXA 2X4GA 3WWDA 5CDFE 3P0FA 1LJUA 2XBLA 3LUKA 4FJ2A 1HSOA 2H5LA 1M1NA 3BXPA 4TVKA 2C92A 5LA6F 4GRDA 2FZEA 1KSFX 3OIWA 1EDEA 4MW5A 5LWQA 3LUJA 1WM1A 3HBAA 4NI5A 1DL5A 4PAGA 1EH5A 2HV8A 3LJKA 2BBSA 2A4MA 3F6SA 2FLKA 1ULUA 3OCWA 5THQA 5JECA 2YYYA 3R0XA 4OHKA 2CFCA 1Z9BA 2CYAA 5J9FA 1JDUA 5DI3B 2CD7A 1JHDA 1V16B 2H1IA 4LXXA 2JLSA 2D3TA 1GZ6A 4HZIA 5F64A 3ASZA 4PZDA 4Q01A 4KQ9A 2NO9A 3MSXA 4EG6A 2AYXA 2BGMA 3C4JA 3DR5A 1NQ5A 1WVGA 4TTQA 2LDXA 3IDQA 2R85A 4YECA 5AJVB 2PZFA 5DGDA 3LY8A 3LYLA 4HMOA 4LVUA 2C2ZA 4P82A 1G6HA 2NNLD 4RHUA 4WDRA 3TSAA 5JJKA 2VPZA 5U4XA 3AY3A 4NR0A 3RSOA 2EX1A 3BMNB 3TDNA 5C7OO 4D43A 4AJ4A 4RKWA 4G5GA 1UPFA 1ZUWA 3BZWA 5A6VA 1KO4A 2BKEA 3ZE6A 1RHMA 2KJQA 2WF5A 1YZ3A 5J5AA 5BNIA 4K5QA 4UPDA 4IIHA 1RQPA 4QUEA 3V2GA 4AJHA 1HRDA 2WQZA 2NOAA 4K03A 9GPBA 2WMOB 4MP6A 5IJ0B 2YV3A 4ZAVA 3SVLA 3THWA 4JWTA 3M6MD 1WY5A 1KKMA 5IAOA 4W7HA 3QY9A 1FYWA 2P11A 1C7FA 3Q2IA 4S1TA 3TKYA 1AO0A 2C5BA 3GFTA 1QGOA 2FF7A 5DV9A 4N41A 4L5JA 3NS7A 2BLLA 2X2PA 1X1CA 3WSTA 3MBOA 5FWDA 3FDIA 4ZFNA 2ZAYA 4GVXA 1FYXA 3EZ7A 4FB5A 1Z13A 3GMIA 2NWQA 5HZKA 2FR1A 1M7GA 5GZ3A 1HNZB 1L5KA 2I2XB 2YVLA 1AHIA 3PQ8A 5E9AA 4R0VA 4YI5A 5J5VA 4AJLA 4F0JA 3BGDA 3OCYA 3TVYA 5A4MS 2P41A 3IOMA 3RAEC 3DAFA 1HE5A 4Q6BA 2SICE 4PQGA 3AHIA 1KK0A 4RQAA 4BAZA 4RPKA 4F4HA 1ORTA 3LBHA 4ER3A 4ZIRB 1NASA 4XCVA 3HZZA 5KQSA 2WJVA 1F8GA 3QE9Y 2BI8A 1F60A 2H9AA 2PBRA 1L7EA 3KUUA 4K2HA 1L1FA 1C30B 1CQJB 2OCIA 3GDFA 4IDGA 2FWPA 2GM9A 3WWEA 2H3HA 4H1UA 3ZIAA 4C4SA 2I4OA 2PGIA 3IEUA 4RVCA 1KAQA 3QI7A 3VRHA 3WNCA 2GERA 4CEHB 2GBLA 3DBRA 1S2MA 3R23A 2V8OA 3TNFA 3EPLA 4HQKA 3F6CA 1NR7A 2C31A 1UM8A 3DMRA 4KFTA 3V7UA 2IYAA 4BNUA 2ZSDA 3UA4A 4DQDA 2ZT6A 1WABA 1DADA 4KR2A 1P4RA 3PA8A 5BQ3A 1MQAA 5IDYA 3U31A 4FX5A 4ZYXA 4O29A 2O52A 4HQ6A 4FXOA 1J0AA 1LPOA 2XYVA 3ZWQA 5JMOA 1JHOA 4ITUA 4BZWA 1TM2A 1SHJA 2OD9A 5IDXA 4M2LA 4CQNA 1L0BA 2VJBA 1QANA 3QYPA 2DG2A 5KTSA 1IY2A 4O2AB 4A8JA 4ZYLA 2FG6C 2R7AA 2NV0A 1Z6ZA 1RE1A 2HC9A 3OY7A 2A6PA 1NJ8A 3I6ZA 4ZCLA 4N5LA 5FI0B 3LUBA 4FWBA 3VOTA 5MDHA 1W93A 3OEYA 3P2OA 3TM5A 1RMYA 2Z3WA 4YTEA 3ZZ0A 4EENA 1NNI1 3IV9A 2PUJA 4YIHA 3VPDA 3URMA 3I9FA 4ROSA 4FE7A 4RE5A 2WYIA 2JPDA 2Q9AA 3JVDA 2VHZA 1WCIB 1WW2A 3OU6A 1A9OA 3R6LA 5CGZA 2CHFA 1I80A 2JBHA 5EZQA 4C0LA 4Z0HO 1DCTA 2GN0A 5E0KB 5SY4A 3X44A 2XUPA 3PUYA 3QW2A 1WD5A 2D13A 4GMGA 5IM5A 4GX1A 4CMHA 1CYDA 3LLCA 3DXXA 1FTGA 1YB4A 4PM4A 3P9XA 2WKQA 2RHOA 2WJZB 4PX9A 1NA5A 4E46A 4EUKA 1UM9A 1GQFA 1UKVY 1ZCZA 3OCJA 2RGWA 1TZBA 1O6BA 4CCAA 1U3UA 4WAUA 1Q14A 1X9GA 2FEKA 3DEZA 1UP7A 3JV7A 3OEHA 2P9GA 2QZSA 3QEMA 1X2BA 3VNQA 2E1PA 4RAQA 3MCWA 5C4IA 1DBWA 1MJ5A 2FP4B 4GD3Q 2QP9X 4OSEA 4QRHA 1QFSA 4MUBA 2J45A 3UYLA 4CV3A 3H2YA 2W0SA 4HNQA 3OC6A 2WSIA 1Y89A 4MKFA 3UMBA 1PQYA 3VO1A 3NBKA 2VDRB 5CT6A 1JSLA 1KC3A 3EVEA 4PZCA 4E2WA 3LF2A 1T2FA 1UPBA 2ZIGA 2XB2A 4FWTA 3RYHA 3EF0A 1OZHA 2R97A 4EGCB 1LCIA 5E1DA 1YQQA 2PQ0A 5IC5A 3CA8A 5EL0A 2BPOA 3KHTA 4OXXA 4Y2YA 1UAYA 1NR1A 5CD9A 4EYGA 1MDBA 1OFIA 3VGJA 4LISA 3RFFA 2ECKA 4DPLA 2HK9A 1IZZA 3K1YA 1WSWA 4MYHA 1J9ZA 1NBMA 3MMXA 3RT7A 4D9MA 3FUUA 1Y8QA 3ZKWA 5HZGA 4LF6B 2J59A 1OFUX 1U8AA 4DC0A 4IVPA 1OHHD 2OCXA 2BCJQ 2V8BA 2YIDA 2HA3A 1SCDA 1FSFA 4GYJA 5J5CA 5A71A 3OQIB 4AT1A 1JHRA 2BGJA 5B6PA 1QFMA 4PC2A 1SPXA 3AJRA 1JDNA 4HWKA 3LM8A 3NAQA 4ARSA 5AVXA 1V4VA 1A9XA 2Q4EA 3KLBA 4D2IA 2HF9A 2J4DA 2Y0PA 3HY6A 4B75A 1JWLA 2BF7A 4CCWA 3ELBA 4BN5A 1QCCA 2BEUB 4JZYA 3W04A 4DYHA 4EL5A 4K28A 2HH9A 2WJPA 5FO1A 2EBWA 3LX4A 3QTLA 1NYRA 5J40A 5BV2P 2IHYA 3LRXA 2Q6IA 3MT9A 3K2IA 1P75A 5F7XA 1QBKC 2B92A 4JLAA 3ETJA 3PK0A 5EKDA 5BN5A 1QCDA 1C0EA 2TSYB 3QXHA 5I7AA 3UB2A 2HWWA 1HBJA 1ORIA 3UXEA 3CE6A 3X2SA 2C3OA 1BE8A 3NHFA 3GCGA 1YKGA 1Z88A 2NQTA 4IDEA 2FMXA 2X9QA 4F4UA 4PNZA 4M1KA 4ARBA 1ULZA 1Y5LA 1XU9A 1YHZA 2H2WA 3N5CA 1QWOA 3T7SA 1EUDA 3HXQA 4KO4S 3SYKA 1NVGA 1RHQA 3HKEB 3ZJTA 1KY5A 5KOJA 2ZQZA 1NXOA 4XYMA 4DRXA 3N2KB 3M4ZA 4GX0A 1WSDA 1WXDA 2AMYA 1N0WA 3B1VA 4EG8A 2XV1A 1E2MA 1QHSA 3EW7A 3HLKA 5HM8A 4TX1A 1EGHA 3CRRA 1IONA 1L4NA 4YHBA 1I51A 4U2FA 4OI2A 3MHTA 4F5WA 1QRTA 1XTUA 2A57A 2WD9A 4JXKA 3U4DA 5A9RA 4JSRA 4KPUA 3RD5A 4NZZA 2PUHA 3LW8A 4TMXA 4EJSC 2GAIA 4JJ7A 4Q3DA 4QJ3A 3S2FA 3LE8A 4AU1A 1ZHOA 2Y71A 1P73A 1NWCA 2VI5A 1XNQB 4N8EA 1PV2A 4XH9B 4DCGA 1M67A 1JBEA 2XX3A 3L1IA 1CY2A 3H17A 4NOLA 4R8VA 4F8YA 2H1LA 3IA2A 2BFFA 4RIFA 4R8KA 4D0SA 2FPPB 4MJ3A 3ZR4B 1H1LA 1N6KA 1GAWA 2QXUA 1KARA 2IIQA 4UUMA 1PDWA 2YXBA 4MUYA 3NZEA 4FM9A 3LDHA 4RGYA 1BE1A 1ECJA 4Y2VA 1LH0A 3ABIA 4C7JA 4ZOBA 5EYPA 1CZOA 4BZXA 3OZDA 2OTCA 4PVCA 1S3FA 5SY6A 3WFJA 4KFUA 1QR2A 4YMHA 4DB2A 1BKSB 1AU9A 4Q15A 3ZLTA 2EZ8A 2GZHA 4Q00A 4E5KA 3QFSA 2VZ8A 2KMLA 4FYKA 3W2GA 2ZUSA 1L4GA 3H2ZA 3QBEA 1DBRA 5LZ2A 3R24A 5GY7A 3EFOA 1JIUA 4HAUA 3VO2A 1Z0AA 4RESA 1M73E 2C4KA 2QN2A 4ML3A 4U0KA 5SYAA 3V4SA 1ARZA 1XKLA 1XK7A 4Q3AA 4QELA 1Z6GA 1G21E 1KI8A 2FK8A 2YY6A 3E05A 2Z58A 3LNCA 1W0JA 4TS9A 4TTSA 1KL7A 2QD4A 4N7JA 4RF2A 1QO0A 3DBOB 1SKBA 3P2MA 3QBJA 4N5HX 1G5RA 2AQIA 1PLLA 5KREA 4TGLA 2B3TA 2G1JA 2PRYA 1WLSA 3B48A 1KBOA 3HV0A 1EX7A 4LEIA 4R3WA 3I32A 1WBDA 1BS1A 3ANSA 2IE0A 3CUUA 1DFIA 2HWKA 3NM4A 1D4AA 4RVGA 4S1WA 4EW6A 4DB4A 4HYTA 3I04A 4QBGB 3LPMA 3H9QA 1G7CA 3QPDA 5EVJA 4ZI7A 4G0UA 1QIIA 4QGAA 4YAEA 5E38A 2UUCB 1NUPA 3U7HB 3G9TA 3IMCA 2H4JA 1Z7EA 3AJAA 4G1VA 4K0RA 3A9CA 3VC1A 2CLMB 4YRMA 4TUYB 1EA7A 4E5PA 2VAPA 4PTZA 1TI7A 3GIWA 3HVHA 3N3BC 4N03A 3IUQA 1OH7A 3AXSA 4PXYA 1N2CE 3GP5A 3U1BA 1S6YA 1XO1A 3MB5A 2AK3A 2P9ZA 3CLUC 1E3LA 4IRUB 3WNBA 3V7WA 3R5JA 4PNEA 3IBSA 1YU9A 1RTKA 4A0RA 4DLBA 1YTLA 4EDHA 1VG0B 2AFIE 1CETA 3CBQA 3L8DA 3BTUA 3VTFA 4GYKA 4C2AA 3DMTC 1A50B 1WVMA 5EXDA 1YBMA 4LSZA 4Q6WA 5FFFA 4FDMA 3FUVA 3PT5A 4IOMA 1JDSA 5FQOA 1N5JA 2NZUG 3UK2A 1J06A 3LVBA 5CLQA 1TMGE 5K6RA 3GAAA 4QTUB 4LBZA 5DT2A 1Q11A 3ZIAD 3AKDA 3I8SA 1KY4A 1W6RA 4RO0A 4B3GA 5FL7D 2FSHA 2WW8A 3CF6R 1U3WA 1Z25A 3JQ6A 3M6WA 5AJZA 5TXGA 4XLZA 3KEFA 3SIRA 3LMKA 2GZMA 2PWAA 3OLXA 1OJLA 4QVGA 4CMGA 4NV1A 1PS9A 4X7BA 1DELA 1EFPB 4IJ5A 4OJQA 5ALWA 5C5IA 1XPUA 3I1FA 4WNYA 2HSGA 4MHSA 1CJTC 1N33B 3SX4A 3WLRA 4KRGA 5IVDA 4OQYA 4C29A 2JGFA 2RJOA 2N9UA 5FHQA 3PQ5A 1GN9A 1NF9A 2PMBA 5KZMB 2PRKA 3OX2A 2BISA 3PJGA 1QPBA 1U0HC 4GBGA 3L7IA 1FE8A 4JH0A 1D8AA 1HTWA 2CYCA 4QLAA 3M1AA 2ZSIA 1KRHA 1YVDA 2GPNA 2OV3A 4FOTA 1C1HA 1ZOOA 5BQOA 1FBNA 5JH7B 1UT5A 3CV3A 3FCUB 1H65A 1YRHA 2ZYRA 3G7UA 3GRPA 1MKYA 5EXPA 3AEZA 3WRWA 3R6WA 2OHOA 4WZBA 1N5MA 3QNUA 4IO0A 2BSQA 3B6EA 3PITA 2NGRA 2OZPA 2YZMA 2PT5A 5I9TA 2FE4A 1HLDA 2F3PA 1GPBA 4XGKA 1WKCA 2VNAA 5ALEA 3K9LA 3ZV6A 4MWBA 5B2EA 4O4HF 3X1KA 4CFZA 3T3NA 2RKOA 3WVNA 2Y3IA 3H5RA 1NVKA 2XGGA 4JENA 4RVUA 4X60A 4KPFC 4I55F 3W6OA 3K5WA 4FGKA 1PL6A 2FPMA 3U61B 3V97A 4X20B 4YLYA 3ZU6A 2POCA 3PRKE 5KKAA 4IV5A 3RAGA 1SC6A 1WXGA 4LE1A 3IRVA 5DCYA 3ETHA 4F7WA 2A5LA 2ZJZA 3A1TA 3ET5A 2FQQA 2J7PA 3AEYA 3TIXB 3EARA 3L46A 3W1VA 4V0KA 2OORA 3OEHD 4BX8A 1ZGZA 2EX4A 2BFCA 1FCJA 1VKOA 4OAQA 2FWRA 4WINA 1BC5A 3V2HA 3I6YA 4CIVA 2OFOA 3DGEC 2ZROA 2H51A 1W49A 2BF4A 2VCYA 1M1XB 5EZYA 3KKKA 3ZU2A 3UV3A 3Q7IA 4CIYA 2F9LA 2YWCA 3UTDA 4BMDA 2VUTA 4UM9B 3HRIA 4DLKA 1BGWA 2BFMA 4ZO6A 2CWDA 2BCEA 1JHAA 2JCGA 3N53A 1PFWA 3OOSA 4MKZA 2NZJA 2G80A 3MWEA 1DDOA 3D3NA 3OZTA 4DM3A 4F85A 1O89A 3I53A 3P5BA 4I50A 1J23A 4E0BA 4K87A 1X1EA 3DMDA 2ODQA 1GP2A 1SIBE 2BOVA 1IWPB 3G8YA 1H2WA 3JQ8B 3QW4B 4NE7A 1NBMD 4D0NA 3QE0A 4KLZA 2C4UA 4HX2A 1QRDA 3HYNA 3A3NA 3TQOA 1TIBA 4GNKA 3K0CC 1G4HA 1ESDA 3NP9A 4CDNA 1FP4A 2IU4A 1Z12A 2JAWA 4AJEA 1SG6A 2P2GA 4H35A 5LZ5A 5KO2A 5A0FA 2VOEA 3MZ0A 1KK2A 2WWRA 1RRKA 2LR0A 2VHYA 1VFPA 4ND2A 1EWQA 1O87A 1A2QA 2BFAA 2XY4A 1ZZGA 2QUIA 2J31A 1WZIA 3G2QA 2EWMA 3IUJA 2UU9B 3N2GA 4PYMA 4KDCA 5EFOA 3V9PA 3Q6NA 4QJ4A 2PQ6A 3EXIA 1KMHB 5CJPA 2QKYA 4JR1A 3N39C 3CF2A 5E3IA 5KYXB 1ODTC 3K8ZA 3ZE9A 2XVXA 4WZAB 1QC5B 4YMIA 3CUYA 2QM8A 1VZ3A 1TLFA 3ZHOA 4S24A 4C03A 4D42A 4KR7A 5K0EA 2P9BA 4KWHA 1TVEA 1NMQA 4LMAA 4GI5A 1BGVA 5KNLA 3Q8KA 4DQUA 5AJUA 5FBWB 1OFUA 1GL6A 3IKJA 1A9YA 2E1RA 3ZY2A 1X7WA 2YNMA 1X1RA 4BZQA 5LL6P 4E2ZA 3FGPA 3KKLA 3MQ2A 5HFAA 3V4LA 4MAMA 1VE7A 5EI5A 2X9VA 1MHTA 2CNKA 3O4GA 3FYSA 4MWZA 5ERXA 4AN4A 4RMJA 1V43A 5KWVA 2ZYIA 3TZEA 3HCBA 4H3VA 1TAUA 1KP2A 3I64A 5EJ9A 2C88A 3MFQA 4ZAGA 4B44A 4BKOA 2QTZA 4EGFA 1C0LA 1D1QA 2VHXA 1NUTA 1VGQA 4K86A 4IP0A 4U5QA 4WL0A 4E70A 3BTOA 3OT4A 2A3NA 3M8KA 2EKZA 5DKFA 3HZRA 1VBFA 4TYPA 1B15A 1SVOA 3C15C 4C78A 2VL7A 4JVLA 2X6QA 3DFUA 3AEKA 1U4NA 4KZKA 4YS6A 5D3ZA 5HZMA 2QEQA 4FZ3A 4TTAA 1T24A 2WOOA 1AZLA 4TV8A 4EY5A 2HLDA 2IYFA 3F3KA 3E5NA 4OFBA 4BO1A 3T7JA 4F3CA 1OB5A 3R9XB 4FHDA 4D74A 2W4MA 1KRXA 3UAVA 1YRYE 1KS9A 3RS7A 3VM6A 3ER9A 3AG6A 4JDPA 5ITSA 2JIRA 3H8VA 2C29D 4KXVA 4YY3B 3MRVA